DdbjClustalwAnalyzeSimple

DdbjClustalwAnalyzeSimple

 

description of DdbjClustalwAnalyzeSimple

 

DDBJ

 

string query

 

string

 

query="> RABSTOUT rabbit Guinness receptor
LKMHLMGHLKMGLKMGLKGMHLMHLKHMHLMTYTYTTYRRWPLWMWLPDFGHAS
ADSCVCAHGFAVCACFAHFDVCFGAVCFHAVCFAHVCFAAAVCFAVCAC
> MUSNOSE mouse nose drying factor
mhkmmhkgmkhmhgmhmhglhmkmhlkmgkhmgkmkytytytryrwtqtqwtwyt
fdgfdsgafdagfdgfsagdfavdfdvgavfsvfgvdfsvdgvagvfdv
> HSHEAVEN human Guinness receptor repeat
mhkmmhkgmkhmhgmhmhg lhmkmhlkmgkhmgkmk ytytytryrwtqtqwtwyt
fdgfdsgafdagfdgfsag dfavdfdvgavfsvfgv dfsvdgvagvfdv
mhkmmhkgmkhmhgmhmhg lhmkmhlkmgkhmgkmk ytytytryrwtqtqwtwyt
fdgfdsgafdagfdgfsag dfavdfdvgavfsvfgv dfsvdgvagvfdv
"

 

output sample

 

http://togows.dbcls.jp/soap/clients/ddbj/ruby/DdbjClustalwAnalyzeSimple.rb

 

http://togows.dbcls.jp/soap/clients/ddbj/perl/DdbjClustalwAnalyzeSimple.pl

 

http://togows.dbcls.jp/soap/clients/ddbj/python/DdbjClustalwAnalyzeSimple.py

 

http://togows.dbcls.jp/soap/clients/ddbj/java/DdbjClustalwAnalyzeSimple.java

 

25