KATANA_ID GO Definiton GeneName

AT1G01150

GO:0005634|GO:0003677|GO:0008270|GO:0045449|GO:0045449|GO:0045449

NULL

NULL

Show
AT1G01150

AT1G01150

 

GO:0005634|GO:0003677|GO:0008270|GO:0045449|GO:0045449|GO:0045449

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

6

 

0

 

0

 

0

 

15

 

0

 

0

 

22

 

0

 

5

 

0

 

0

 

0

 

0

 

0

 

0

 

4

 

1

 

1

 

0

 

15

 

0

 

0

 

0

 

11

 

0

 

0

 

19

 

0

 

7

 

0

 

0

 

0

 

0

 

0

 

F6F3 hypothetical protein

 

ATGGTGAGTGATCTCCCGCTTGATGAAGATGATATCGCTCTCCTCAAGAGTCCTTATTGTGATGATGGTGGTGATGAGGACGTCAACTCTGCTCCAAACATTTTCACTTATGATAATGTGCCTCTTAAGAAGCGCCACTACCTTGGGACAAGTGACACTTTCAGAAGCTTTGAGCCGTTGAACGAACACGCATGTATTGTATGCGATATTGCAGACGATGGTGTAGTACCTTGTTCTGGGAATGAATGCCCTCTCGCTGTTCACAGGAAGTGTGTTGAGCTTGATTGTGAAGATCCTGCAACCTTTTACTGTCCCTATTGTTGGTTTAAGGAGCAAGCTACTAGATCCACGGCTTTGAGAACAAGGGGTGTTGCAGCTGCGAAGACCCTTGTTCAATATGGATGTAGTGAGCTGAGGAGTGGAGATATAGTCATGACGAGAGAAAACAGTCAACTAGAGAATGGTTCTGATAATTCACTACCAATGCAACTACATGAGAACCTTCATCAATTACAAGAACTGGTCAAGCACCTTAAGGCTCGAAATTCCCAGTTAGACGAGTCAACAGATCAATTCATTGATATGGAGAAATCTTGCGGAGAAGCTTATGCTGTTGTTAATGATCAGCCAAAAAGGGTACTATGGACAGTCAACGAAGAGAAGATGTTGAGGGGAGTGGAGAAATTTTCTGATACAATCAACAAAAACATGCCTTGGAAGAAGATTTTGGAGATGGGAAAAGGTATATTCCACACAACTCGTAATTCCTCCGATCTTAAGGACAAATGGAGAAATATGGTCGAGATTGACATCATCATCGTCGTCGCAGAGATCGGAGATCAAAATGGAGAGGGAAAGAAACGCAGGAGTGATGAAGAAGATGAGTCCAACAGGAACCATCCAAAGATTAGAATTTGTGGGATGGTATTTGTAAAGCCAATAACTTAG

 

1

 

68414.m00024 expressed protein ; expression supported by MPSS

 

MVSDLPLDEDDIALLKSPYIGEIVEEIGFVREKRIAHCIVQCDDGGDEDVNSAPNIFTYDNVPLKKRHYLGTSDTFRSFEPLNEHACIVCDIADDGVVPCSGNECPLAVHRKCVELDCEDPATFYCPYCWFKEQATRSTALRTRGVAAAKTLVQYGCSELRSGDIVMTRENSQLENGSDNSLPMQLHENLHQLQELVKHLKARNSQLDESTDQFIDMEKSCGEAYAVVNDQPKRVLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSDLKDKWRNMNYLDLVEVEIDIIIVVAEIGDQNGEGKKRRSDEEDESNRNHPKIRICGMVFVKPIT*

 

61

 

AT1G01160

GO:0008150|GO:0005634|GO:0005515|GO:0003713

NULL

NULL

Show
AT1G01160

AT1G01160

 

GO:0008150|GO:0005634|GO:0005515|GO:0003713

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

84

 

72

 

65

 

45

 

75

 

22

 

42

 

26

 

22

 

66

 

10

 

3

 

3

 

14

 

3

 

73

 

0

 

4

 

1

 

1

 

97

 

82

 

72

 

52

 

77

 

24

 

47

 

29

 

25

 

73

 

11

 

4

 

2

 

15

 

4

 

88

 

F6F3 unknown protein

 

ATGCAGCAGCAGCAGTCTCCGCAAATGTTTCCGATGGTTCCGTCGATTCCCCCTGCTAACAACATCACTACCGAACAGATCCAAAAGTACCTTGATGAGAACAAGAAGCTGATTATGGCCATCATGGAAAACCAGAATCTCGGTAAACTTGCTGAGTGCGCCCAGTACCAAGCTCTTCTCCAGAAGAACTTGATGTATCTTGCTGCAATTGCTGATGCTCAACCCCCACCACCTACGCCAGGACCTTCACCATCTACAGCTGTCGCTGCCCAGATGGCAACACCGCATTCTGGGATGCAACCACCTAGCTACTTCATGCAACACCCACAAGCATCCCCTGCAGGGATTTTCGCTCCAAGGGGTCCTTTACAGTTTGGTAGCCCACTCCAGTTTCAGGATCCGCAACAGCAGCAGCAGATACATCAGCAAGCTATGCAAGGACACATGGGGATTAGACCAATGGGTATGACCAACAACGGGATGCAGCATGCGATGCAACAACCAGAAACCGGTCTTGGAGGAAACGTGGGGCTTAGAGGAGGAAAGCAAGATGGAGCAGATGGACAAGGAAAAGATGATGGCAAGTGA

 

1

 

68414.m00026 SSXT protein-related / transcription co-activator-related similar to SYT/SSX4 fusion protein (GI:11127695) [Homo sapiens]; supporting cDNA gi|21539891|gb|AY102640.1|; contains Pfam profile PF05030: SSXT protein (N-terminal region)

 

MQQQQSPQMFPMVPSIPPANNITTEQIQKYLDENKKLIMAIMENQNLGKLAECAQYQALLQKNLMYLAAIADAQPPPPTPGPSPSTAVAAQMATPHSGMQPPSYFMQHPQASPAGIFAPRGPLQFGSPLQFQDPQQQQQIHQQAMQGHMGIRPMGMTNNGMQHAMQQPETGLGGNVGLRGGKQDGADGQGKDDGK*

 

62

 

AT1G01170

GO:0003674|GO:0006950|GO:0012505|GO:0003674|GO:0006950|GO:0012505

NULL

NULL

Show
AT1G01170

AT1G01170

 

GO:0003674|GO:0006950|GO:0012505|GO:0003674|GO:0006950|GO:0012505

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

2

 

0

 

94

 

0

 

72

 

292

 

341

 

168

 

21

 

6

 

253

 

113

 

146

 

252

 

143

 

0

 

0

 

2

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

277

 

228

 

175

 

18

 

3

 

279

 

89

 

150

 

273

 

205

 

0

 

F6F3 unknown protein

 

ATGGCATCAGGAGGTAAAGCCAAGTACATAATCGGTGCTCTCATCGGTTCTTTCGGAATCTCATACATCTTCGACAAAGTTATCTCTGATAATAAGATCTTTGGAGGGACTACTCCAGGAACTGTCTCTAACAAAGAATGGTGGGCAGCAACGGATGAGAAATTCCAAGCATGGCCAAGAACCGCTGGTCCTCCCGTTGTTATGAATCCCATTAGCCGTCAGAATTTCATCGTCAAGACTCGTCCGGAATGA

 

1

 

68414.m00028 ozone-responsive stress-related protein, putative similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain;

 

MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNKEWWAATDEKFQAWPRTAGPPVVMNPISRQNFIVKTRPE*

 

63

 

AT1G01180

GO:0008150

NULL

NULL

Show
AT1G01180

AT1G01180

 

GO:0008150

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

0

 

7

 

0

 

0

 

1

 

0

 

3

 

4

 

1

 

0

 

4

 

0

 

28

 

9

 

0

 

0

 

4

 

1

 

1

 

0

 

0

 

2

 

0

 

0

 

1

 

3

 

2

 

1

 

0

 

0

 

4

 

0

 

28

 

18

 

0

 

F6F3 unknown protein

 

ATGAAGGAGGATCGTCGTCTTCCTCACAAACGCGACGCCTTCCAATTCTTGAAAACCAAGGCTGCGTACGTTATCGTCATAGTTCTAACCTACGCCTTTGGTTACTTCTCCGCCTACCACTATCATCAACCGCTGCAGCAGCAGCTGCCACCGTCTACGACAGCCGTGGAAACGACAAAACCTCAAGTTTGTTCAATCGACAACTTCCGAGTTACGACTCCATGCGGCAATCTTGTTCCGCCGGAATTGATTCGCCAGACTGTTATTGACCGGATCTTTAACGGAACTTCTCCGTACATCGATTTCCCACCACCGCACGCCAAGAAGTTTCTCCGGCCAAAAAGAATCAAAGGTTGGGGATCATACGGGGCCGTTTTCGAGAATCTAATCCGCCGAGTCAAACCTAAGACGATCGTCGAAGTCGGGAGTTTTCTCGGCGCGTCGGCGATACACATGGCGAATCTCACGCGCCGACTTGGGCTCGAGGAGACTCAGATTCTATGCGTCGACGACTTCCGTGGCTGGCCCGGTTTTCGAGACCGGTTTAAGGACATGGCTTTGGTTAACGGTGACGTTCTGCTTATGTACCAGTTTATGCAAAACGTGGTTATCTCGGATTTTTCCGGTTCGATATTGCCGGTTCCTTTCTCGACCGGTTCGGCTTTGGAGAAGCTGTGTGAGTGGGGAGTGACGGCGGACCTGGTGGAGATAGACGCGGGTCACGATTTTAATTCGGCATGGGCGGATATAAACCGGGCGGTTCGGATACTCCGACCCGGCGGTGTTATATTTGGTCACGATTATTTCACGGCGGCGGATAATAGAGGAGTGAGGAGAGCCGTGAATCTGTTCGCAGAGATTAACCGGTTAAAGGTCAAAACCGATGGTCAACATTGGGTTATTGATTCGGTCAAAGTAATTAATAAAGGGACAAGATTTGCGATCTCAAAAACTGTTGCGAAGATTAAAGAGGATGCCAATCAATGGTTCTTTGCTCAAGTTCTTGAGAATCAGGATTTGGTGAATGAGCAAGCTGTTCACATTTCGGTTAAGGTGCTGCGCGGGTTTTTGAGAGATGAACACGGTAAGGTCCTAATTCATGCTAGAAGATCTTTTGCATCTGTTCATAGCAAGCTTGATGCTACTTTTCTTTGTTGGCAATGGGCCATGGAGAGTATGAAAAGTCTCAGAGTTGATAAAATCATCTTTGCCTCTGAAGACAATGATCTAATTGGAGCTGTTACGCGACTGCCGTCTTGGCCTTCGTATAAATTTCAGATTCACTTTTTGTTGGGAGAATTAATAAGAAGCTCTAATCTTGGAGCTCATCTTATTGCCAAGAGCGTGACAATGGAGGATCGCCGCCAATCGTATGTAGCAACCGGGTTTCCTTTTTGGCTGAAACATCTTTTTGAGAAAGAAAGAAGTATTGCTTAG

 

1

 

68414.m00030 expressed protein

 

MKEDRRLPHKRDAFQFLKTKAAYVIVIVLTYAFGYFSAYHYHQPLQQQLPPSTTAVETTKPQVCSIDNFRVTTPCGNLVPPELIRQTVIDRIFNGTSPYIDFPPPHAKKFLRPKRIKGWGSYGAVFENLIRRVKPKTIVEVGSFLGASAIHMANLTRRLGLEETQILCVDDFRGWPGFRDRFKDMALVNGDVLLMYQFMQNVVISDFSGSILPVPFSTGSALEKLCEWGVTADLVEIDAGHDFNSAWADINRAVRILRPGGVIFGHDYFTAADNRGVRRAVNLFAEINRLKVKTDGQHWVIDSVKVINKGTRFAISKTVAKIKEDANQWFFAQVLENQDLVNEQAVHISVKVLRGFLRDEHGKVLIHARRSFASVHSKLDATFLCWQWAMESMKSLRVDKIIFASEDNDLIGAVTRLPSWPSYKFQIHFLLGELIRSSNLGAHLIAKSVTMEDRRQSYVATGFPFWLKHLFEKERSIA*

 

64

 

AT1G01183

GO:0005575|GO:0003674|GO:0035195|GO:0035195

NULL

NULL

Show
AT1G01183

AT1G01183

 

GO:0005575|GO:0003674|GO:0035195|GO:0035195

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

65

 

AT1G01190

GO:0006118|GO:0019825|GO:0012505

CYP78A8; CYP78A8 (cytochrome P450, family 78, subfamily A, polypeptide 8); oxygen binding [EC:1.14.-.-]

CYP78A8

Show
AT1G01190

AT1G01190

 

GO:0006118|GO:0019825|GO:0012505

 

CYP78A8; CYP78A8 (cytochrome P450, family 78, subfamily A, polypeptide 8); oxygen binding [EC:1.14.-.-]

 

Cytochrome P450

 

CYP78A

 

CYP78A8

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

3

 

0

 

3

 

45

 

1

 

0

 

0

 

0

 

0

 

76

 

0

 

0

 

0

 

1

 

0

 

15

 

0

 

4

 

1

 

1

 

4

 

0

 

4

 

52

 

1

 

0

 

0

 

0

 

0

 

82

 

0

 

0

 

0

 

1

 

0

 

17

 

F6F3 cytochrome P450, putative

 

ATGAGAACCGAAATAGAAAGTTTGTGGGTATTTGCTCTTGCATCAAAATTCAATATTTACATGCAACAACATTTTGCTTCCCTTCTCGTCGCCATTGCTATCACTTGGTTTACCATAACCATCGTATTTTGGTCTACTCCGGGTGGACCGGCTTGGGGAAAATACTTCTTCACTCGCCGGTTTATTTCTCTCGATTACAACCGAAAATACAAGAATCTCATTCCCGGTCCTAGAGGGTTTCCACTTGTGGGAAGCATGAGCCTTAGGTCAAGCCACGTGGCTCATCAGCGCATAGCGTCTGTGGCTGAGATGAGTAACGCCAAGCGGCTCATGGCGTTTAGCCTCGGTGATACTAAGGTGGTGGTGACGTGTCATCCTGCCGTGGCAAAGGAGATACTAAACAGTTCGGTTTTTGCTGACCGACCGGTTGACGAAACCGCTTACGGTTTGATGTTTAACCGAGCCATGGGATTTGCTCCCAATGGTACTTATTGGCGTACGCTGCGTCGGTTAGGCTCGAACCATCTTTTTAACCCGAAGCAAATCAAACAATCGGAGGATCAGAGACGGGTGATAGCGACTCAGATGGTGAATGCGTTTGCACGTAACCCTAAATCCGCGTGTGCAGTGCGTGATTTGCTCAAAACAGCGTCGTTGTGTAACATGATGGGTTTGGTTTTCGGGAGAGAGTATGAATTGGAGTCAAATAACAACTTGGAATCTGAATGCTTAAAGGGTTTGGTTGAAGAAGGGTACGATCTTCTAGGTACGTTAAATTGGACCGACCATCTTCCTTGGTTAGCCGGTTTAGATTTCCAACAAATCCGGTTTAGGTGCTCGCAGCTCGTACCGAAAGTAAATCTGTTATTGAGCCGTATCATACATGAACAACGTGCTGCCACGGGTAACTTTCTTGACATGTTACTTTCTCTTCAAGGTTCAGAAAAATTATCAGAATCCGACATGGTTGCTGTTCTTTGGGAAATGATATTTAGGGGAACGGACACTGTTGCGGTTTTGGTCGAGTGGGTGCTAGCGAGGATTGTGATGCATCCCAAAGTTCAATTAACGGTCCACGATGAGCTTGACCGAGTCGTTGGCAGATCAAGAACCGTGGATGAGTCAGACCTTCCATCACTCACGTATCTAACGGCTATGATCAAAGAAGTGTTGAGGCTGCATCCACCAGGTCCACTGCTTTCTTGGGCACGACTGTCTATAACAGACACTTCCGTAGATGGATATCACGTGCCGGCTGGGACCACCGCGATGGTCAACATGTGGGCTATAGCACGTGACCCACACGTGTGGGAGGATCCTTTAGAGTTTAAGCCTGAGAGGTTCGTGGCTAAAGAGGGTGAAGCTGAGTTCTCTGTTTTCGGGTCGGATCTGAGGTTGGCACCGTTCGGGTCGGGTAAGAGGGTTTGCCCTGGAAAGAATTTGGGACTTACAACGGTGTCGTTTTGGGTTGCAACGCTCTTGCATGAGTTTGAGTGGCTTCCTAGCGTCGAAGCTAACCCTCCAGATCTCTCGGAGGTTTTGAGGCTCTCGTGTGAGATGGCTTGTCCACTCATCGTTAACGTAAGCTCAAGGCGTAAGATAATGTAA

 

1

 

68414.m00032 cytochrome P450, putative similar to cytochrome P450 SP:O48927 from [Glycine max]

 

MRTEIESLWVFALASKFNIYMQQHFASLLVAIAITWFTITIVFWSTPGGPAWGKYFFTRRFISLDYNRKYKNLIPGPRGFPLVGSMSLRSSHVAHQRIASVAEMSNAKRLMAFSLGDTKVVVTCHPAVAKEILNSSVFADRPVDETAYGLMFNRAMGFAPNGTYWRTLRRLGSNHLFNPKQIKQSEDQRRVIATQMVNAFARNPKSACAVRDLLKTASLCNMMGLVFGREYELESNNNLESECLKGLVEEGYDLLGTLNWTDHLPWLAGLDFQQIRFRCSQLVPKVNLLLSRIIHEQRAATGNFLDMLLSLQGSEKLSESDMVAVLWEMIFRGTDTVAVLVEWVLARIVMHPKVQLTVHDELDRVVGRSRTVDESDLPSLTYLTAMIKEVLRLHPPGPLLSWARLSITDTSVDGYHVPAGTTAMVNMWAIARDPHVWEDPLEFKPERFVAKEGEAEFSVFGSDLRLAPFGSGKRVCPGKNLGLTTVSFWVATLLHEFEWLPSVEANPPDLSEVLRLSCEMACPLIVNVSSRRKIM*

 

66

 

AT1G01200

GO:0005525|GO:0015031|GO:0007264

NULL

NULL

Show
AT1G01200

AT1G01200

 

GO:0005525|GO:0015031|GO:0007264

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

21

 

3

 

0

 

11

 

5

 

0

 

1

 

0

 

2

 

5

 

0

 

0

 

0

 

0

 

0

 

33

 

0

 

2

 

1

 

1

 

25

 

3

 

0

 

14

 

5

 

0

 

2

 

0

 

2

 

5

 

0

 

0

 

0

 

0

 

0

 

42

 

F6F3 GTP-binding protein, putative

 

ATGCCGGAAAAGATCGATTACGTGTTCAAGGTGGTGGTCATTGGAGATTCTGCTGTCGGGAAAACGCAGCTCCTCTCACGTTTTACACACAACGAGTTCTGTTATGATTCAAAATCAACCATTGGTGTCGAGTTTCAGACACGGACCATCACTCTTCGGGGCAAACTCGTCAAAGCTCAGATCTGGGACACCGCCGGTCAAGAGAGAGCGGTGACTAGCGCCTACTACAGAGGTGCGTTAGGTGCGATGGTGGTTTACGACATTACCAAACGCCTCTCATTCGACCACGTTGCACGTTGGGTCGAGGAATTACGTGCTCACGCCGATGATTCCGCCGTGATCATGCTCGTCGGAAACAAAGCCGATCTCTCCGTTGGTAAACGTGCCGTTCCTACGGAGGATGCAGTCGAATTCGCCGAGACTCAACGGCTTTTTTTCTCGGAAGTCTCGGCTCTAAGCGGCGGAAACGTCGACGAAGCTTTTTTCCGTTTACTCGAGGAGATTTTCAGCCGCGTTGTTGTTTCGAGAAAAGCTATGGAATCCGACGGTGGAGCCACCGTGAAACTTGACGGTTCGAGAATTGATGTCATCTCTGGTTCGGATCTTGAGACTAGTAATATCAAGGAACAAGCTTCGTGCTCGTGTTGA

 

1

 

68414.m00034 Ras-related GTP-binding protein, putative similar to GTP-binding protein GB:D12541 GI:303736 from [Pisum sativum]

 

MNEEMSGESPENNKHVKKPTMPEKIDYVFKVVVIGDSAVGKTQLLSRFTHNEFCYDSKSTIGVEFQTRTITLRGKLVKAQIWDTAGQERYRAVTSAYYRGALGAMVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADLSVGKRAVPTEDAVEFAETQRLFFSEVSALSGGNVDEAFFRLLEEIFSRVVVSRKAMESDGGATVKLDGSRIDVISGSDLETSNIKEQASCSC*

 

67

 

AT1G01210

GO:0005634|GO:0003677|GO:0003899|GO:0003700|GO:0006354|GO:0006354|GO:0006354|GO:0006355|GO:0006355|GO:0006355

DNA-directed RNA polymerase III family protein [EC:2.7.7.6] [SP:Q9LNK0_ARATH]

NULL

Show
AT1G01210

AT1G01210

 

GO:0005634|GO:0003677|GO:0003899|GO:0003700|GO:0006354|GO:0006354|GO:0006354|GO:0006355|GO:0006355|GO:0006355

 

DNA-directed RNA polymerase III family protein [EC:2.7.7.6] [SP:Q9LNK0_ARATH]

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

7

 

0

 

18

 

8

 

12

 

1

 

7

 

0

 

0

 

7

 

6

 

3

 

0

 

0

 

0

 

7

 

0

 

4

 

1

 

1

 

9

 

0

 

21

 

10

 

10

 

1

 

8

 

0

 

0

 

8

 

6

 

4

 

0

 

0

 

0

 

8

 

F6F3 unknown protein

 

ATGGAGTTTTGTCCAACATGTGGGAATCTGTTGCGATACGAGGGAGGTGGCAATTCGAGATTCTTCTGTTCCACATGTCCATACGTCGCCTACATCCAAAGACAGGTGGAGATAAAGAAGAAGCAACTTCTGGTTAAGAAATCTATAGAAGCTGTTGTGACTAAAGATGATATACCCACAGCTGCTGAAACTGAAGCCCCATGTCCAAGGTGTGGCCACGACAAGGCATACTTCAAATCAATGCAGATTCGTTCAGCAGATGAGCCAGAATCAAGATTTTATAGATGCTTGAAGTGCGAGTTCACTTGGCGTGAGGAATGA

 

1

 

68414.m00035 DNA-directed RNA polymerase III family protein similar to SP|O13896 DNA-directed RNA polymerases III 12.5 kDa polypeptide (EC 2.7.7.6) {Schizosaccharomyces pombe}; contains Pfam profiles PF02150: RNA polymerases M/15 Kd subunit, PF01096: Transcription factor S-II (TFIIS)

 

MEFCPTCGNLLRYEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLVKKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWREE*

 

68

 

AT1G01220

GO:0005737|GO:0005524|GO:0004335|GO:0004335|GO:0008152|GO:0016310|GO:0016310

NULL

NULL

Show
AT1G01220

AT1G01220

 

GO:0005737|GO:0005524|GO:0004335|GO:0004335|GO:0008152|GO:0016310|GO:0016310

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

galactose degradation I|galactose degradation II

 

2.7.1.6|2.7.1.6

 

galactokinase|galactokinase

 

0

 

2

 

1

 

1

 

8

 

39

 

50

 

26

 

35

 

5

 

15

 

9

 

28

 

7

 

4

 

0

 

0

 

12

 

11

 

8

 

0

 

2

 

1

 

1

 

10

 

45

 

58

 

32

 

41

 

6

 

18

 

10

 

32

 

9

 

5

 

0

 

0

 

13

 

15

 

12

 

F6F3 unknown protein

 

ATGTCTAAGCAGAGGAAGAAAGCTGACTTAGCCACCGTTTTGCGCAAGTCATGGTACCACTTAAGGCTCTCGGTGCGCCATCCCACTCGGGTCCCGACTTGGGATGCGATTGTGCTCACAGCGGCTAGTCCTGAACAAGCGGAGCTCTACGACTGGCAGCTCCGGCGAGCGAAACGTATGGGACGAATAGCTAGCTCCACTGTCACTTTGGCCGTTCCTGATCCAGATGGCAAACGGATCGGGTCTGGTGCTGCTACTCTCAACGCCATTTATGCTCTCGCTCGTCATTATGAGAAATTGGGTTTTGATCTTGGTCCCGAGATGGAAGTTGCGAATGGTGCTTGCAAATGGGTTAGATTCATCTCTGCAAAGCATGTATTGATGCTTCATGCTGGAGGTGACTCCAAAAGGGTTCCATGGGCAAATCCTATGGGCAAAGTATTCCTCCCACTTCCTTATCTTGCAGCTGATGACCCTGATGGTCCTGTTCCTCTCCTTTTTGATCATATTCTTGCTATCGCTTCATGTGCAAGACAAGCTTTCCAAGACCAAGGTGGATTATTTATTATGACTGGAGACGTCCTTCCTTGTTTTGATGCTTTTAAAATGACTCTCCCTGAAGACGCAGCTTCCATAGTTACTGTGCCTATTACTCTCGATATTGCCTCCAACCATGGTGTTATTGTCACATCAAAATCTGAGTCACTTGCTGAAAGCTATACAGTTAGTTTAGTCAATGATCTTCTGCAGAAGCCTACAGTAGAGGATCTTGTCAAGAAAGATGCAATTTTACATGATGGACGGACACTCCTTGACACTGGGATAATATCTGCTAGGGGCAGAGCATGGTCGGACCTGGTCGCTCTTGGATGCTCGTGCCAACCCATGATCTTAGAGCTTATAGGTAGTAAGAAAGAGATGAGTTTGTATGAAGATTTGGTGGCTGCTTGGGTTCCTTCAAGGCATGATTGGCTGCGAACCAGACCTTTGGGTGAACTTCTTGTTAACAGTCTGGGGAGGCAAAAGATGTACAGCTACTGCACCTATGATTTGCAGTTTTTGCATTTTGGAACATCAAGTGAGGTATTGGATCATTTAAGCGGGGATGCTTCAGGAATTGTTGGTCGGAGACACTTATGTTCCATCCCTGCAACTACGGTTTCTGATATTGCAGCATCTTCCGTTATTTTGTCTAGTGAAATTGCACCTGGTGTCTCCATTGGTGAAGATTCACTTATATATGATTCAACAGTTTCTGGTGCTGTACAAATTGGTTCTCAGTCCATAGTTGTTGGTATTCACATCCCGAGCGAAGATCTTGGAACTCCAGAGAGTTTCAGGTTCATGCTTCCTGATAGGCATTGTCTTTGGGAGGTCCCACTAGTGGGACATAAGGGAAGAGTGATTGTGTATTGTGGTCTCCATGACAATCCAAAGAACTCAATTCATAAAGATGGAACTTTTTGCGGTAAACCCTTGGAGAAGGTATTGTTTGATCTTGGCATTGAGGAAAGCGACCTCTGGAGCTCGTATGTTGCACAAGATAGATGTTTGTGGAATGCAAAACTGTTCCCGATTCTTACGTATAGTGAAATGCTGAAGTTAGCGTCGTGGTTGATGGGTTTAGATGATAGTAGAAACAAGGAGAAGATTAAGTTGTGGAGAAGCTCACAACGTGTAAGCTTAGAAGAGTTGCATGGATCAATCAACTTTCCTGAGATGTGCAATGGTTCCAGCAATCATCAAGCTGATCTTGCGGGTGGAATCGCTAAAGCATGTATGAACTATGGTATGCTTGGGCGTAATTTGTCTCAGCTGTGCCATGAGATTTTACAGAAAGAGTCATTAGGATTGGAAATATGCAAGAATTTTCTGGATCAATGTCCCAAATTTCAGGAGCAGAACTCCAAAATTCTTCCAAAGAGTCGAGCATACCAGGTAGAAGTTGATCTTCTTCGAGCATGTGGGGATGAAGCAAAAGCTATAGAGTTGGAGCATAAAGTATGGGGAGCAGTTGCAGAAGAAACTGCTTCAGCTGTGAGATATGGTTTTAGAGAACATCTGTTGGAATCAAGTGGCAAGTCTCATTCTGAGAATCATATTTCTCATCCGGATCGAGTTTTTCAACCAAGAAGGACAAAAGTTGAACTACCAGTTCGGGTAGATTTTGTAGGAGGTTGGAGTGATACACCTCCATGGAGCTTAGAGCGTGCAGGTTACGTCCTGAACATGGCTATAACCTTAGAAGGTTCACTTCCAATTGGCACAATCATTGAAACAACAAATCAGATGGGAATCTCAATCCAAGACGACGCTGGAAACGAGCTACACATCGAAGATCCAATAAGCATTAAGACACCATTTGAAGTCAATGATCCATTCAGGCTTGTTAAATCTGCTCTATTGGTAACCGGCATTGTCCAAGAAAATTTTGTTGACTCCACAGGGTTAGCAATAAAGACATGGGCCAATGTTCCTCGTGGCAGTGGTCTAGGAACCTCGAGCATTCTAGCTGCAGCTGTTGTGAAAGGACTTCTCCAGATATCTAATGGAGATGAAAGCAATGAAAACATTGCAAGACTTGTCTTGGTTCTGGAGCAACTCATGGGTACAGGAGGTGGCTGGCAAGATCAGATTGGTGGATTATATCCAGGAATCAAATTCACTTCAAGTTTTCCAGGAATCCCTATGCGTCTTCAAGTTGTTCCTTTACTCGCCTCGCCACAGCTAATTTCAGAGTTGGAGCAACGCCTCCTTGTTGTTTTCACGGGTCAAGTCAGGCTAGCTCATCAAGTCCTACACAAGGTCGTTACAAGGTATTTGCAAAGAGATAATCTCCTAATTTCAAGCATTAAGCGATTGACGGAGCTGGCGAAATCCGGTAGAGAAGCGTTGATGAACTGTGAAGTTGACGAGGTAGGCGACATAATGTCAGAAGCTTGGAGACTGCATCAAGAGCTGGATCCGTATTGCAGCAATGAGTTTGTGGATAAGCTTTTTGAGTTTTCGCAACCTTATAGCTCAGGATTCAAGCTGGTAGGTGCAGGTGGTGGTGGATTCTCACTTATATTGGCTAAGGACGCAGAGAAAGCCAAGGAGTTAAGACAGAGATTGGAAGAACATGCAGAGTTTGATGTCAAAGTTTACAACTGGAGCATCT

 

1

 

68414.m00036 GHMP kinase-related contains similarity to L-fucose kinase [Homo sapiens] gi|21212956|emb|CAD29647

 

MSKQRKKADLATVLRKSWYHLRLSVRHPTRVPTWDAIVLTAASPEQAELYDWQLRRAKRMGRIASSTVTLAVPDPDGKRIGSGAATLNAIYALARHYEKLGFDLGPEMEVANGACKWVRFISAKHVLMLHAGGDSKRVPWANPMGKVFLPLPYLAADDPDGPVPLLFDHILAIASCARQAFQDQGGLFIMTGDVLPCFDAFKMTLPEDAASIVTVPITLDIASNHGVIVTSKSESLAESYTVSLVNDLLQKPTVEDLVKKDAILHDGRTLLDTGIISARGRAWSDLVALGCSCQPMILELIGSKKEMSLYEDLVAAWVPSRHDWLRTRPLGELLVNSLGRQKMYSYCTYDLQFLHFGTSSEVLDHLSGDASGIVGRRHLCSIPATTVSDIAASSVILSSEIAPGVSIGEDSLIYDSTVSGAVQIGSQSIVVGIHIPSEDLGTPESFRFMLPDRHCLWEVPLVGHKGRVIVYCGLHDNPKNSIHKDGTFCGKPLEKVLFDLGIEESDLWSSYVAQDRCLWNAKLFPILTYSEMLKLASWLMGLDDSRNKEKIKLWRSSQRVSLEELHGSINFPEMCNGSSNHQADLAGGIAKACMNYGMLGRNLSQLCHEILQKESLGLEICKNFLDQCPKFQEQNSKILPKSRAYQVEVDLLRACGDEAKAIELEHKVWGAVAEETASAVRYGFREHLLESSGKSHSENHISHPDRVFQPRRTKVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMGISIQDDAGNELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWANVPRGSGLGTSSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTGGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVFTGQVRLAHQVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVDEVGDIMSEAWRLHQELDPYCSNEFVDKLFEFSQPYSSGFKLVGAGGGGFSLILAKDAEKAKELRQRLEEHAEFDVKVYNWSICI*

 

69

 

AT1G01225

GO:0005575

NULL

NULL

Show
AT1G01225

AT1G01225

 

GO:0005575

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

3

 

7

 

0

 

0

 

0

 

0

 

0

 

2

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

8

 

0

 

0

 

0

 

0

 

0

 

2

 

F6F3 unknown protein

 

ATGGGTTTGCTTACGAACAAGATTGAGAGAGAAGAGCTAAAGCCAGGAGATCACATCTATACTTACAGAGCAATCTTCGCTTATTCTCACCACGGAATCTTTGTCGGTGGGTCCAAAGTTGTTCATTTCAGACCTGAACACAACCCCATGGATTCATCAACATCATCAATATCATCATCTTCCTCTGAAGATATCTGTTCCATATTTCCTGATTGCGGTTTCAGACAACCGGACAGTGGAGTAGTCCTTTCTTGCTTAGACTGTTTCCTCAAGAACGGCTCACTCTACTGCTTCGAATATGGAGTCAGTCCATCGGTTTTCCTAACCAAAGTCCGCGGAGGGACTTGCACAACCGCGCAATCTGATACAACTGATTCAGTCATCCACAGGGCAATGTACCTTCTCCAAAACGGATTTGGCAACTACGACATTTTCAAGAACAACTGTGAGGATTTCGCGCTCTATTGCAAGACCGGTTTGCTTATAATGGATAAGCTCGGTGTAGGGAGAAGCGGTCAAGCTTCTTCAATTGTTGGTGCTCCTTTGGCTGCACTCCTCTCTTCTCCTTTCAAATTGCTTATTCCAAGTCCCATTGGTGTGGCAACAGTTACTGCTGGTATGTACTGTATGAGTCGCTATGCTACCGATATTGGTGTTAGAAGCGACGTCATTAAGGTCTCAGTTGAGGATTTGGCTCTCAACCTTGACGTAAAGACCATTGAGCAAGGTGAAGAAGAAGAAGAAGACGAAGAAGAAGATTCTGATACCGACTATGTTAGGTGA

 

1

 

68414.m00037 NC domain-containing protein-related contains weak hit to Pfam profile PF04970: NC domain

 

MGLLTNKIEREELKPGDHIYTYRAIFAYSHHGIFVGGSKVVHFRPEHNPMDSSTSSISSSSSEDICSIFPDCGFRQPDSGVVLSCLDCFLKNGSLYCFEYGVSPSVFLTKVRGGTCTTAQSDTTDSVIHRAMYLLQNGFGNYDIFKNNCEDFALYCKTGLLIMDKLGVGRSGQASSIVGAPLAALLSSPFKLLIPSPIGVATVTAGMYCMSRYATDIGVRSDVIKVSVEDLALNLDVKTIEQGEEEEEDEEEDSDTDYVR*

 

70

 

AT1G01230

GO:0005783|GO:0003674|GO:0006457|GO:0006457|GO:0006457

NULL

NULL

Show
AT1G01230

AT1G01230

 

GO:0005783|GO:0003674|GO:0006457|GO:0006457|GO:0006457

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

7

 

0

 

0

 

0

 

0

 

0

 

4

 

0

 

6

 

10

 

49

 

36

 

0

 

7

 

0

 

0

 

0

 

2

 

1

 

1

 

7

 

0

 

0

 

0

 

0

 

0

 

4

 

0

 

5

 

13

 

60

 

41

 

0

 

7

 

0

 

0

 

F6F3 unknown protein

 

ATGGCGAATCTGTATGTGAAAGCGGTTCCACCACCGGATATGAATAGGAATACGGAATGGTTCATGTATCCAGGAGTTTGGACGACTTACATGCTTATTCTCTTCTTCGGTTGGCTCGTTGTTCTCTCTGTCTCTGGTTGTTCCCCTGGAATGGCTTGGACTGTTGTTAATCTCGCTCACTTCGTTGTAACGTATCACAGCTTCCACTGGATGAAAGGAACTCCTTTTGCAGATGACCAAGGAATCTACAATGGTTTAACTTGGTGGGAACAAATGGACAATGGTCAACAGCTTACCCGCAACCGCAAATTTCTTACCCTAGTTCCTGTTGTTCTGTACTTGATTGCATCGCATACAACAGATTACAGACATCCATGGCTGTTCCTCAACACACTCGCTGTGATGGTTCTCGTTGTTGCCAAGTTCCCCAACATGCACAAGGTACGCATCTTTGGTATCAATGGTGATAAATAA

 

1

 

68414.m00038 ORMDL family protein contains Pfam domain PF04061: ORMDL family

 

MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAHFVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTLVPVVLYLIASHTTDYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGDK*

 

71

 

AT1G01240

GO:0006499|GO:0006499|GO:0006499

NULL

NULL

Show
AT1G01240

AT1G01240

 

GO:0006499|GO:0006499|GO:0006499

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

0

 

16

 

0

 

0

 

0

 

0

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

6

 

0

 

0

 

0

 

0

 

F6F3 unknown protein

 

ATGGGAGCAGCTGAAGCAAGAGCATTGTGGCAAAGAACAGCTAGTCGTTGCTTTGTTGTTCATGAGGATGCTAAGATGGCTCCGAGGTTAGCTTGTTGCCAACACCAACAATCTTCTTCGGGCAACACCGAAAAAAACAGCTTTTCTTCCGGAAGTTTTGGAGATTCCTCTGATTTCTCTTGTGATACCAAATGGTGGCTTAAGGGATCAACTGGTTTTGATGAGGAGGTTACAAACTCCTTTCTTGAAGATACCAAATGCAAGAAATTGCATGAATTTGTCGACTTAATCGGAATACGAGAAGAAGAAGACTACAGCTTTATTAGCAAGAAAGCTGACGCTACAACACCGTGGTGGAGAAGCACGACGGATAAAGATGAATTAGCTCTCATGGTGGCGACTAAATCGGTTGATCATAATATCCAGAATTGTGATCTTCCTCCACCTCAAAAACTCCACAAGAGTATTCACTCCTCGAGTGGAGAAAAAGGGTTTAAAACAGCGGTTAAATCGCCATGGAAGCAAGGAGTTTGGAAGGATCGGTTTGAGAGATCTTTGAGTTACAATGGTAGCACAGAGAGCAAGAACACGAGTCCAATGTCTTCCCCTAGAAGTGATGATCTAAGCAAAGGTCAGCTTTTAGAAGCACTAAGGCATTCTCAAACCAGGGCAAGAGAAGCAGAGAGAGCAGCGAGAGAAGCTTGCGCTGAGAAAGACCGTGTGATAACAATCTTGTTGAAACAAGCGAGTCAGATGTTGGCTTATAAGCAATGGTTAAAGCTTCTTGAAATGGAAGCTCTTTATCTGCAGATGAAGAAGGAAGAAGAACAAGAGGAACAGGTCAAAGGAATGAATCTGAAGAAGAGAAAACAGAGAGGGGAGAAGAAGAAAAAGGGTGAGACTGGGAGATATATGATGGCTTTTGCATTAGGGTTTAGTCTCATTGGTGCTGGTTTGCTCTTAGGTTGGACTGTTGGATGGTTGCTTCCCTTCTAG

 

3

 

68414.m00041 expressed protein

 

MGAAEARALWQRTASRCFVVHEDAKMAPRLACCQHQQSSSGNTEKNSFSSGSFGDSSDFSCDTKWWLKGSTGFDEEVTNSFLEDTKCKKLHEFVDLIGIREEEDYSFISKKADATTPWWRSTTDKDELALMVATKSVDHNIQNCDLPPPQKLHKSIHSSSGEKGFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSDDLSKGQLLEALRHSQTRAREAERAAREACAEKDRVITILLKQASQMLAYKQWLKLLEMEALYLQMKKEEEQEEQVKGMNLKKRKQRGEKKKKGETGRYMMAFALGFSLIGAGLLLGWTVGWLLPF*

 

72

 

AT1G01250

GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0006355|GO:0006355|GO:0006355

NULL

NULL

Show
AT1G01250

AT1G01250

 

GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0006355|GO:0006355|GO:0006355

 

NULL

 

NULL

 

AP2-EREBP Transcription Factor Family

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

8

 

4

 

0

 

54

 

2

 

2

 

5

 

8

 

0

 

0

 

3

 

2

 

20

 

0

 

0

 

0

 

2

 

1

 

1

 

0

 

7

 

3

 

0

 

61

 

2

 

2

 

6

 

9

 

0

 

0

 

1

 

2

 

21

 

0

 

0

 

F6F3 transcription factor TINY like protein

 

ATGTCACCACAGAGAATGAAGCTATCATCACCACCAGTTACCAACAACGAACCAACCGCCACCGCTTCTGCCGTTAAATCTTGCGGCGGAGGAGGTAAAGAAACCAGCTCATCGACCACGAGGCATCCAGTGTACCACGGAGTTCGCAAACGCCGATGGGGAAAATGGGTTTCTGAGATCAGAGAGCCCCGGAAAAAGTCTCGGATTTGGCTCGGATCTTTTCCGGTGCCGGAGATGGCTGCTAAGGCCTACGACGTGGCAGCGTTTTGTCTAAAAGGTAGAAAAGCTCAGCTGAATTTCCCTGAAGAAATCGAGGATCTACCTCGACCGTCCACGTGTACTCCCAGAGATATCCAAGTCGCAGCGGCCAAAGCAGCCAACGCCGTGAAGATCATCAAAATGGGAGATGATGACGTGGCAGGAATAGACGACGGAGATGATTTCTGGGAAGGCATTGAGCTGCCTGAGCTTATGATGAGTGGAGGTGGGTGGTCGCCGGAGCCTTTTGTTGCCGGAGATGATGCCACGTGGCTTGTCGACGGAGACTTGTATCAGTATCAGTTCATGGCGTGTCTGTGA

 

1

 

68414.m00042 AP2 domain-containing transcription factor, putative similar to transcription factor TINY GB:CAA64359 GI:1246403 from [Arabidopsis thaliana]

 

MSPQRMKLSSPPVTNNEPTATASAVKSCGGGGKETSSSTTRHPVYHGVRKRRWGKWVSEIREPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEIEDLPRPSTCTPRDIQVAAAKAANAVKIIKMGDDDVAGIDDGDDFWEGIELPELMMSGGGWSPEPFVAGDDATWLVDGDLYQYQFMACL*

 

73

 

AT1G01260

GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0045449|GO:0045449|GO:0045449|GO:0005634

NULL

BHLH013|AtbHLH13

Show
AT1G01260

AT1G01260

 

GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0045449|GO:0045449|GO:0045449|GO:0005634

 

NULL

 

Transcription Factor|NULL

 

basic Helix-Loop-Helix (bHLH) Transcription Factor|bHLH Transcription Factor Family

 

BHLH013|AtbHLH13

 

Myc7E|MYC7E

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

6

 

11

 

3

 

0

 

0

 

40

 

5

 

15

 

24

 

6

 

3

 

0

 

0

 

4

 

0

 

106

 

0

 

4

 

1

 

1

 

6

 

13

 

6

 

0

 

3

 

35

 

1

 

8

 

29

 

11

 

0

 

0

 

0

 

3

 

0

 

76

 

F6F3 transcription factor MYC7E, putative bHLH transcription factor (AtbHLH013)

 

ATGAATATTGGTCGCCTAGTGTGGAACGAGGACGATAAAGCGATTGTTGCGTCATTACTGGGCAAACGAGCTCTCGATTACTTGCTTTCCAACTCTGTTTCCAATGCTAATCTCTTGATGACTCTAGGAAGCGACGAGAATCTGCAGAACAAGCTCTCGGATCTCGTCGAGAGACCCAACGCTTCTAATTTCTCTTGGAACTACGCCATTTTCTGGCAGATTTCCAGGTCAAAGGCCGGAGATTTGGTTCTCTGTTGGGGCGATGGATATTGCAGAGAGCCTAAAGAAGGAGAGAAATCAGAGATCGTTAGGATTCTAAGTATGGGAAGAGAAGAAGAAACGCATCAGACTATGAGAAAGAGAGTATTGCAAAAGCTTCATGATTTGTTTGGTGGCTCAGAAGAAGAGAACTGTGCTTTAGGACTAGATAGAGTTACTGACACTGAGATGTTTCTTCTTTCTTCTATGTATTTCTCATTCCCTCGAGGTGAAGGTGGTCCAGGCAAGTGTTTTGCCTCTGCTAAACCTGTTTGGTTATCCGATGTCGTCAATTCGGGTTCTGATTATTGCGTTAGATCGTTTCTTGCTAAATCTGCTGGCATTCAGACTGTTGTTTTGGTTCCTACTGATCTTGGTGTTGTTGAGTTAGGCTCAACTTCATGTTTGCCTGAAAGTGAAGACTCAATCTTGTCTATAAGATCATTGTTTACCAGTAGTTTGCCTCCGGTTAGAGCTGTTGCTTTACCTGTTACTGTAGCTGAAAAGATTGATGATAACAGAACGAAGATATTCGGCAAGGATTTGCACAATTCAGGGTTTCTTCAACATCATCAGCATCACCAACAACAACAACAACAACCACCGCAACAGCAACAGCATAGACAGTTTAGAGAGAAACTCACGGTTAGAAAAATGGATGATAGAGCTCCCAAGAGATTAGATGCTTATCCGAATAATGGGAACAGGTTTATGTTTTCGAACCCAGGCACCAACAACAACACTCTTCTGAGTCCTACTTGGGTTCAACCTGAGAACTACACGAGGCCAATCAACGTGAAGGAAGTTCCAAGCACGGATGAGTTCAAGTTTTTACCTTTGCAGCAATCATCGCAGAGGCTGCTTCCTCCTGCTCAAATGCAGATAGATTTCTCTGCTGCGAGTTCAAGGGCTTCAGAGAATAATTCAGATGGAGAAGGAGGAGGGGAATGGGCAGATGCAGTGGGTGCTGATGAATCTGGTAACAACAGACCAAGAAAACGCGGAAGGAGACCTGCCAACGGAAGAGCGGAAGCTTTGAACCATGTAGAAGCAGAGAGGCAGAGGCGTGAGAAGCTTAACCAGAGGTTTTACGCTCTGAGATCCGTTGTTCCCAACATATCCAAGATGGACAAAGCGTCCTTGTTGGGAGACGCGGTTTCTTATATAAACGAGCTTCACGCGAAGCTAAAGGTCATGGAAGCAGAGAGAGAGAGGTTAGGGTATAGCTCAAATCCACCTATCAGCTTGGATTCAGATATAAATGTTCAAACCTCAGGTGAAGATGTCACAGTGAGGATAAACTGTCCGTTGGAGTCTCATCCGGCTTCCAGAATCTTCCATGCGTTTGAAGAGAGTAAAGTAGAAGTGATAAACTCGAACCTGGAAGTTTCTCAGGACACAGTGTTGCATACGTTTGTAGTCAAATCTGAAGAATTAACGAAAGAGAAGCTGATATCGGCCTTGTCTAGAGAGCAAACAAATTCAGTTCAGTCAAGAACATCATCAGGTAGATAG

 

1

 

68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain

 

MNIGRLVWNEDDKAIVASLLGKRALDYLLSNSVSNANLLMTLGSDENLQNKLSDLVERPNASNFSWNYAIFWQISRSKAGDLVLCWGDGYCREPKEGEKSEIVRILSMGREEETHQTMRKRVLQKLHDLFGGSEEENCALGLDRVTDTEMFLLSSMYFSFPRGEGGPGKCFASAKPVWLSDVVNSGSDYCVRSFLAKSAGIQTVVLVPTDLGVVELGSTSCLPESEDSILSIRSLFTSSLPPVRAVALPVTVAEKIDDNRTKIFGKDLHNSGFLQHHQHHQQQQQQPPQQQQHRQFREKLTVRKMDDRAPKRLDAYPNNGNRFMFSNPGTNNNTLLSPTWVQPENYTRPINVKEVPSTDEFKFLPLQQSSQRLLPPAQMQIDFSAASSRASENNSDGEGGGEWADAVGADESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPNISKMDKASLLGDAVSYINELHAKLKVMEAERERLGYSSNPPISLDSDINVQTSGEDVTVRINCPLESHPASRIFHAFEESKVEVINSNLEVSQDTVLHTFVVKSEELTKEKLISALSREQTNSVQSRTSSGR*

 

74

 

AT1G01270

GO:0006414|GO:0006414|GO:0006414|GO:0030533|GO:0030533|GO:0030533

NULL

NULL

Show
AT1G01270

AT1G01270

 

GO:0006414|GO:0006414|GO:0006414|GO:0030533|GO:0030533|GO:0030533

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

75