KATANA_ID GO Definiton GeneName

ART1

GO:0005575|GO:0003674|GO:0009910

NULL

NULL

Show
ART1

ART1

 

GO:0005575|GO:0003674|GO:0009910

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

46

 

AT1G01010

GO:0005575|GO:0003700|GO:0007275

NULL

NULL

Show
AT1G01010

AT1G01010

 

GO:0005575|GO:0003700|GO:0007275

 

NULL

 

NULL

 

NAC Transcription Factor Family

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

195

 

62

 

18

 

33

 

2

 

0

 

13

 

0

 

2

 

18

 

10

 

0

 

0

 

8

 

0

 

86

 

0

 

2

 

1

 

1

 

229

 

75

 

22

 

40

 

2

 

0

 

16

 

0

 

2

 

21

 

12

 

0

 

0

 

7

 

0

 

113

 

T25K16 NAC domain protein, putative

 

ATGGAGGATCAAGTTGGGTTTGGGTTCCGTCCGAACGACGAGGAGCTCGTTGGTCACTATCTCCGTAACAAAATCGAAGGAAACACTAGCCGCGACGTTGAAGTAGCCATCAGCGAGGTCAACATCTGTAGCTACGATCCTTGGAACTTGCGCTTCCAGTCAAAGTACAAATCGAGAGATGCTATGTGGTACTTCTTCTCTCGTAGAGAAAACAACAAAGGGAATCGACAGAGCAGGACAACGGTTTCTGGTAAATGGAAGCTTACCGGAGAATCTGTTGAGGTCAAGGACCAGTGGGGATTTTGTAGTGAGGGCTTTCGTGGTAAGATTGGTCATAAAAGGGTTTTGGTGTTCCTCGATGGAAGATACCCTGACAAAACCAAATCTGATTGGGTTATCCACGAGTTCCACTACGACCTCTTACCAGAACATCAGAGGACATATGTCATCTGCAGACTTGAGTACAAGGGTGATGATGCGGACATTCTATCTGCTTATGCAATAGATCCCACTCCCGCTTTTGTCCCCAATATGACTAGTAGTGCAGGTTCTGTGGTCAACCAATCACGTCAACGAAATTCAGGATCTTACAACACTTACTCTGAGTATGATTCAGCAAATCATGGCCAGCAGTTTAATGAAAACTCTAACATTATGCAGCAGCAACCACTTCAAGGATCATTCAACCCTCTCCTTGAGTATGATTTTGCAAATCACGGCGGTCAGTGGCTGAGTGACTATATCGACCTGCAACAGCAAGTTCCTTACTTGGCACCTTATGAAAATGAGTCGGAGATGATTTGGAAGCATGTGATTGAAGAAAATTTTGAGTTTTTGGTAGATGAAAGGACATCTATGCAACAGCATTACAGTGATCACCGGCCCAAAAAACCTGTGTCTGGGGTTTTGCCTGATGATAGCAGTGATACTGAAACTGGATCAATGATTTTCGAAGACACTTCGAGCTCCACTGATAGTGTTGGTAGTTCAGATGAACCGGGCCATACTCGTATAGATGATATTCCATCATTGAACATTATTGAGCCTTTGCACAATTATAAGGCACAAGAGCAACCAAAGCAGCAGAGCAAAGAAAAGGTGATAAGTTCGCAGAAAAGCGAATGCGAGTGGAAAATGGCTGAAGACTCGATCAAGATACCTCCATCCACCAACACGGTGAAGCAGAGCTGGATTGTTTTGGAGAATGCACAGTGGAACTATCTCAAGAACATGATCATTGGTGTCTTGTTGTTCATCTCCGTCATTAGTTGGATCATTCTTGTTGGTTAA

 

1

 

68414.m00001 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAC domain protein NAM GB: AAD17313 GI:4325282 from [Arabidopsis thaliana]

 

MEDQVGFGFRPNDEELVGHYLRNKIEGNTSRDVEVAISEVNICSYDPWNLRFQSKYKSRDAMWYFFSRRENNKGNRQSRTTVSGKWKLTGESVEVKDQWGFCSEGFRGKIGHKRVLVFLDGRYPDKTKSDWVIHEFHYDLLPEHQRTYVICRLEYKGDDADILSAYAIDPTPAFVPNMTSSAGSVVNQSRQRNSGSYNTYSEYDSANHGQQFNENSNIMQQQPLQGSFNPLLEYDFANHGGQWLSDYIDLQQQVPYLAPYENESEMIWKHVIEENFEFLVDERTSMQQHYSDHRPKKPVSGVLPDDSSDTETGSMIFEDTSSSTDSVGSSDEPGHTRIDDIPSLNIIEPLHNYKAQEQPKQQSKEKVISSQKSECEWKMAEDSIKIPPSTNTVKQSWIVLENAQWNYLKNMIIGVLLFISVISWIILVG*

 

47

 

AT1G01020

GO:0016020|GO:0003674|GO:0008150|GO:0016020|GO:0003674|GO:0008150

NULL

NULL

Show
AT1G01020

AT1G01020

 

GO:0016020|GO:0003674|GO:0008150|GO:0016020|GO:0003674|GO:0008150

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

31

 

6

 

23

 

43

 

36

 

6

 

0

 

3

 

3

 

15

 

16

 

7

 

3

 

8

 

0

 

43

 

0

 

4

 

1

 

1

 

36

 

0

 

29

 

43

 

35

 

7

 

0

 

2

 

3

 

0

 

16

 

0

 

8

 

7

 

0

 

0

 

T25K16 unknown protein

 

ATGGCGGCGAGTGAACACAGATGCGTGGGATGTGGTTTTAGGGTAAAGTCATTGTTCATTCAATACTCTCCGGGTAACATTCGTCTCATGAAATGCGGAAATTGCAAGGAAGTAGCAGATGAGTACATCGAGTGTGAACGCATGATTATTTTCATCGATTTAATCCTTCACAGACCAAAGGTATATAGACACGTCCTCTACAATGCAATTAATCCAGCAACTGTCAATATTCAGCATCTGTTGTGGAAGTTGGTCTTCGCCTATCTTCTTCTAGACTGTTATAGAAGCTTGCTACTGAGAAAAAGTGATGAAGAATCGAGCTTTTCTGATAGCCCTGTTCTTCTATCTATAAAGGTTAGATCGTTTCTTTTTAATGGACTTAATTAG

 

1

 

68414.m00002 transmembrane ARV1-like family protein contains similarity to ARV1 [Homo sapiens] gi|12044055|gb|AAG47671

 

MAASEHRCVGCGFRVKSLFIQYSPGNIRLMKCGNCKEVADEYIECERMIIFIDLILHRPKVYRHVLYNAINPATVNIQHLLWKLVFAYLLLDCYRSLLLRKSDEESSFSDSPVLLSIKVRSFLFNGLN*

 

48

 

AT1G01030

GO:0005575|GO:0003700|GO:0009908|GO:0045449|GO:0045449|GO:0045449|GO:0048366

NULL

NULL

Show
AT1G01030

AT1G01030

 

GO:0005575|GO:0003700|GO:0009908|GO:0045449|GO:0045449|GO:0045449|GO:0048366

 

NULL

 

NULL

 

ABI3VP1 Transcription Factor Family

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

77

 

13

 

32

 

61

 

24

 

0

 

8

 

0

 

12

 

8

 

2

 

0

 

0

 

3

 

0

 

0

 

0

 

4

 

1

 

1

 

0

 

36

 

3

 

36

 

10

 

0

 

5

 

0

 

1

 

2

 

0

 

0

 

0

 

1

 

0

 

0

 

T25K16 DNA-binding protein, putative

 

ATGGATCTATCCCTGGCTCCGACAACAACAACAAGTTCCGACCAAGAACAAGACAGAGACCAAGAATTAACCTCCAACATCGGAGCAAGCAGCAGCTCCGGTCCCAGCGGAAACAACAACAACCTTCCGATGATGATGATTCCACCTCCGGAGAAAGAACACATGTTCGACAAAGTGGTAACACCAAGCGACGTCGGAAAACTCAACAGACTCGTGATCCCTAAACAACACGCTGAGAGGTATTTCCCTCTAGACTCCTCAAACAACCAAAACGGCACGCTTTTGAACTTCCAAGACAGAAACGGCAAGATGTGGAGATTCCGTTACTCGTATTGGAACTCTAGCCAGAGCTACGTTATGACCAAAGGATGGAGCCGTTTCGTCAAAGAGAAAAAGCTCGATGCAGGAGACATTGTCTCTTTCCAACGAGGCATCGGAGATGAGTCAGAAAGATCCAAACTTTACATAGATTGGAGGCATAGACCCGACATGAGCCTCGTTCAAGCACATCAGTTTGGTAATTTTGGTTTCAATTTCAATTTCCCGACCACTTCTCAATATTCCAACAGATTTCATCCATTGCCAGAATATAACTCCGTCCCGATTCACCGGGGCTTAAACATCGGAAATCACCAACGTTCCTATTATAACACCCAGCGTCAAGAGTTCGTAGGGTATGGTTATGGGAATTTAGCTGGAAGGTGTTACTACACGGGATCACCGTTGGATCATAGGAACATTGTTGGATCAGAGCCGTTGGTTATAGACTCAGTCCCTGTGGTTCCCGGGAGATTAACTCCGGTGATGTTACCGCCGCTTCCTCCGCCTCCTTCTACGGCGGGAAAGAGACTAAGGCTCTTTGGGGTGAATATGGAATGTGGCAATGACTATAATCAACAAGAAGAGTCATGGTTGGTGCCACGTGGCGAAATTGGTGCATCTTCTTCTTCTTCTTCAGCTCTACGACTAAATTTATCGACTGATCATGATGATGATAATGATGATGGTGATGATGGCGATGATGATCAATTTGCTAAGAAAGGGAAGTCTTCACTTTCTCTCAATTTCAATCCATGA

 

1

 

68414.m00003 DNA-binding protein, putative similar to DNA-binding proteins from [Arabidopsis thaliana] RAV1 GI:3868857, RAV2 GI:3868859; contains Pfam profile PF02362: B3 DNA binding domain

 

MDLSLAPTTTTSSDQEQDRDQELTSNIGASSSSGPSGNNNNLPMMMIPPPEKEHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDSSNNQNGTLLNFQDRNGKMWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGIGDESERSKLYIDWRHRPDMSLVQAHQFGNFGFNFNFPTTSQYSNRFHPLPEYNSVPIHRGLNIGNHQRSYYNTQRQEFVGYGYGNLAGRCYYTGSPLDHRNIVGSEPLVIDSVPVVPGRLTPVMLPPLPPPPSTAGKRLRLFGVNMECGNDYNQQEESWLVPRGEIGASSSSSSALRLNLSTDHDDDNDDGDDGDDDQFAKKGKSSLSLNFNP*

 

49

 

AT1G01040

GO:0008026|GO:0008026|GO:0004525|GO:0009908|GO:0005634|GO:0005634|GO:0003725|GO:0005515|GO:0006396|GO:0006396|GO:0009880|GO:0000910|GO:0010098|GO:0035196|GO:0035196|GO:0031053|GO:0031053|GO:0035279|GO:0035279|GO:0010228|GO:0010267|GO:0010267|GO:0010445|GO:0010445

NULL

NULL

Show
AT1G01040

AT1G01040

 

GO:0008026|GO:0008026|GO:0004525|GO:0009908|GO:0005634|GO:0005634|GO:0003725|GO:0005515|GO:0006396|GO:0006396|GO:0009880|GO:0000910|GO:0010098|GO:0035196|GO:0035196|GO:0031053|GO:0031053|GO:0035279|GO:0035279|GO:0010228|GO:0010267|GO:0010267|GO:0010445|GO:0010445

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

19

 

22

 

13

 

11

 

50

 

12

 

19

 

17

 

19

 

22

 

4

 

0

 

0

 

12

 

0

 

58

 

0

 

4

 

1

 

1

 

12

 

11

 

18

 

6

 

42

 

10

 

15

 

19

 

26

 

20

 

1

 

0

 

0

 

9

 

0

 

48

 

T25K16 CAF protein

 

ATGGTAATGGAGGATGAGCCTAGAGAAGCCACAATAAAGCCTTCTTATTGGCTAGATGCTTGCGAGGACATCTCTTGTGATCTTATCGATGATCTCGTGTCTGAATTTGATCCTTCCTCTGTTGCTGTCAATGAATCCACTGATGAAAACGGCGTCATCAATGATTTTTTCGGTGGGATTGATCACATTTTAGATAGTATCAAGAACGGTGGAGGCTTACCAAACAATGGCGTTTCTGATACCAATTCTCAAATCAACGAGGTTACTGTAACTCCTCAGGTTATTGCTAAGGAGACAGTGAAGGAGAATGGGTTGCAAAAGAATGGCGGTAAGAGAGACGAATTCTCGAAAGAGGAAGGAGACAAGGATAGGAAGAGAGCTAGGGTTTGTAGTTATCAGAGTGAAAGGAGTAACCTTTCAGGTAGAGGGCATGTTAATAATTCTAGGGAGGGAGATAGGTTTATGAATAGGAAACGTACTCGTAATTGGGACGAGGCGGGTAACAATAAGAAGAAAAGGGAATGTAACAATTACAGAAGAGATGGTAGAGATAGAGAAGTTAGGGGTTATTGGGAGAGGGATAAAGTTGGTTCCAATGAGTTGGTTTATAGGTCAGGGACTTGGGAAGCTGATCATGAAAGAGATGTTAAGAAAGTGAGTGGTGGAAACCGCGAATGCGATGTCAAGGCAGAGGAGAACAAGAGTAAGCCTGAAGAACGTAAAGAGAAGGTTGTGGAAGAGCAAGCAAGGCGATACCAGTTGGATGTTCTTGAACAAGCTAAAGCGAAAAACACGATTGCTTTCCTTGAGACCGGTGCTGGAAAGACACTTATCGCGATTCTTCTTATTAAAAGTGTTCATAAGGATCTGATGAGCCAGAACAGAAAAATGCTCTCGGTGTTCTTGGTTCCCAAAGTGCCTTTGGTTTATCAGCAAGCAGAAGTGATCCGTAATCAAACTTGTTTTCAAGTTGGACATTATTGTGGTGAGATGGGACAGGACTTTTGGGATTCTCGAAGGTGGCAACGAGAGTTTGAGTCTAAGCAGGTTCTAGTTATGACAGCACAAATTCTGTTGAATATACTGAGACACAGTATCATTAGAATGGAAACAATTGATCTTCTTATTCTCGACGAGTGTCACCACGCTGTCAAGAAACATCCATACTCTTTAGTGATGTCAGAGTTTTACCATACAACTCCTAAAGATAAAAGACCTGCCATCTTTGGAATGACTGCTTCGCCTGTTAATTTAAAGGGTGTTTCAAGCCAAGTAGATTGTGCGATAAAGATACGTAACCTCGAGACCAAGTTGGATTCTACGGTTTGTACTATAAAAGATCGAAAAGAATTAGAGAAACATGTGCCTATGCCTTCAGAGATAGTCGTCGAGTATGACAAAGCTGCTACTATGTGGTCTCTTCATGAGACAATAAAGCAAATGATTGCAGCTGTTGAAGAAGCGGCACAAGCAAGTTCAAGGAAAAGCAAGTGGCAATTTATGGGGGCTAGGGATGCTGGAGCAAAGGATGAATTGAGACAGGTTTATGGCGTCTCTGAAAGAACGGAGAGCGATGGTGCTGCCAATTTGATTCATAAACTTAGAGCTATCAATTATACTCTTGCTGAATTGGGTCAATGGTGTGCTTACAAGGTGGGACAATCATTCTTGTCTGCTTTGCAAAGTGATGAGAGGGTGAATTTCCAAGTCGACGTGAAGTTTCAAGAATCATACCTCAGTGAGGTGGTGTCACTCTTGCAATGTGAGCTTCTGGAAGGCGCTGCTGCTGAAAAAGTCGCGGCGGAAGTTGGCAAACCAGAAAATGGTAATGCACATGACGAGATGGAGGAGGGAGAGCTCCCTGATGATCCTGTGGTCTCGGGAGGGGAGCACGTTGATGAAGTAATAGGCGCCGCAGTGGCTGATGGGAAAGTTACTCCAAAAGTACAATCATTGATCAAACTACTCCTCAAATATCAGCACACAGCTGATTTTCGAGCTATTGTTTTCGTTGAGAGGGTGGTTGCTGCTTTGGTTCTTCCTAAGGTTTTTGCGGAGCTGCCTTCGCTTAGTTTTATACGGTGTGCCAGCATGATTGGACACAATAACAGCCAGGAGATGAAATCATCTCAAATGCAGGATACAATTTCCAAATTCCGAGATGGGCATGTGACACTGTTAGTTGCCACAAGCGTTGCTGAGGAAGGACTTGATATTAGGCAATGTAACGTTGTTATGCGTTTCGACCTTGCAAAGACGGTGCTGGCATACATTCAGTCTCGTGGCCGGGCAAGAAAGCCTGGATCAGACTACATACTCATGGTTGAGAGAGGAAATGTATCTCACGCAGCGTTCCTAAGGAATGCTAGGAACAGTGAGGAGACACTTCGAAAAGAAGCAATAGAAAGGACTGATCTTAGTCATCTCAAAGATACATCGAGATTAATCTCAATTGATGCTGTGCCTGGTACAGTTTATAAGGTGGAGGCAACTGGTGCCATGGTTAGCTTGAATTCCGCGGTTGGTCTTGTACATTTCTACTGCTCTCAGCTTCCTGGTGACAGGTATGCAATCCTTCGTCCTGAGTTTAGCATGGAGAAGCATGAAAAGCCTGGGGGCCACACGGAATATTCATGTAGGCTTCAGCTTCCTTGCAATGCACCGTTTGAAATACTTGAGGGTCCTGTTTGCAGTTCAATGCGTCTTGCACAACAGGCTGTATGTTTAGCTGCTTGCAAGAAACTGCATGAGATGGGTGCATTTACCGATATGCTATTACCGGACAAAGGAAGTGGTCAAGACGCTGAGAAGGCTGACCAAGATGATGAAGGTGAGCCTGTTCCTGGAACTGCTAGACATAGAGAGTTCTATCCTGAAGGTGTGGCGGATGTACTTAAGGGAGAATGGGTTTCATCTGGAAAGGAAGTTTGTGAGAGCTCAAAGCTATTCCATTTATACATGTATAATGTCAGATGTGTAGATTTTGGCTCTTCAAAAGATCCATTCCTAAGCGAAGTTTCAGAGTTCGCGATTCTTTTTGGCAATGAGCTGGATGCAGAGGTATTATCGATGTCTATGGATCTTTATGTTGCTCGGGCCATGATCACTAAAGCATCTCTTGCTTTCAAGGGATCACTTGATATTACAGAAAACCAGCTATCATCTCTAAAAAAGTTTCATGTGAGGTTAATGAGTATCGTGTTGGATGTTGATGTTGAACCCTCCACGACACCATGGGATCCTGCAAAGGCCTACCTGTTTGTCCCTGTTACTGACAATACGTCTATGGAACCCATAAAAGGGATCAACTGGGAATTGGTTGAAAAGATTACGAAAACCACAGCGTGGGACAACCCTCTTCAGAGAGCTCGTCCCGATGTATATCTCGGGACTAATGAGAGAACTCTTGGTGGGGACAGAAGGGAATATGGGTTTGGTAAACTTCGTCACAACATTGTATTTGGGCAGAAATCTCACCCAACTTATGGTATTAGAGGAGCTGTTGCATCCTTCGATGTTGTGAGAGCTTCTGGATTGTTACCTGTGAGAGATGCTTTTGAGAAGGAAGTAGAAGAGGATTTATCAAAAGGAAAATTGATGATGGCTGATGGGTGCATGGTTGCAGAAGATCTTATTGGGAAAATAGTGACAGCCGCACATTCCGGGAAGCGGTTTTACGTAGATTCAATTTGTTATGACATGAGTGCAGAAACATCTTTCCCTAGGAAAGAGGGATATCTTGGTCCCCTAGAGTACAACACGTACGCTGACTATTACAAGCAAAAGTATGGAGTTGATTTGAACTGTAAGCAACAACCTTTGATTAAAGGACGTGGTGTTTCGTATTGCAAGAACCTTCTTTCTCCTCGGTTTGAACAGTCAGGTGAATCTGAGACAGTCCTTGATAAGACATATTACGTGTTTCTTCCACCTGAACTATGCGTTGTGCATCCGCTTTCGGGTTCACTTATCCGAGGTGCTCAGAGGTTACCCTCTATAATGAGAAGAGTTGAGAGCATGTTACTCGCTGTTCAACTCAAAAATTTGATTAGTTATCCTATTCCCACATCAAAGATTCTTGAAGCCTTGACTGCCGCCTCGTGCCAGGAAACGTTCTGCTACGAGAGAGCTGAGCTTTTAGGAGATGCGTATCTAAAATGGGTTGTTAGTCGTTTTCTGTTTCTCAAGTATCCTCAAAAGCACGAGGGTCAGCTTACAAGGATGAGGCAACAAATGGTTAGTAATATGGTTCTTTATCAGTTTGCTCTGGTTAAAGGGCTTCAGTCATATATCCAGGCGGATCGATTCGCCCCGTCTAGGTGGTCTGCTCCTGGTGTGCCTCCGGTTTTCGACGAGGACACAAAAGATGGAGGATCTTCGTTTTTCGATGAAGAGCAAAAACCTGTTTCCGAGGAAAACAGCGATGTGTTTGAAGATGGGGAGATGGAGGATGGTGAACTAGAGGGTGATTTGAGTTCGTACCGAGTTTTATCTAGCAAAACGTTAGCTGATGTTGTTGAGGCTTTGATTGGTGTTTATTACGTCGAAGGGGGTAAGATTGCAGCTAATCATTTGATGAAATGGATTGGGATTCACGTGGAGGATGATCCTGATGAAGTCGATGGAACATTGAAAAATGTTAATGTTCCAGAGAGTGTGCTCAAGAGCATCGACTTTGTTGGTCTTGAGAGAGCTCTTAAATATGAGTTTAAAGAGAAAGGTCTTCTTGTTGAAGCTATAACACATGCTTCAAGACCATCTTCAGGTGTTTCGTGTTACCAGAGATTGGAATTTGTTGGTGACGCGGTCTTGGATCATCTCATCACAAGACATCTATTTTTCACATACACAAGCCTTCCTCCTGGTCGGTTAACAGATCTTCGAGCTGCAGCGGTTAACAACGAGAATTTTGCTCGCGTTGCGGTTAAACATAAACTCCACTTGTACCTTCGTCACGGTTCAAGCGCCCTCGAAAAACAGATTCGGGAATTTGTGAAGGAGGTTCAAACCGAGTCATCGAAACCGGGGTTTAACTCTTTTGGTTTGGGAGACTGCAAAGCACCAAAAGTTCTTGGAGACATTGTTGAATCTATTGCAGGTGCTATTTTTCTTGATAGTGGAAAAGATACAACTGCTGCTTGGAAGGTTTTTCAACCTTTGCTTCAGCCCATGGTGACACCAGAGACACTTCCAATGCATCCGGTGCGAGAGCTACAAGAGCGGTGCCAGCAACAAGCAGAAGGGTTAGAATACAAAGCGAGTAGGAGTGGTAACACAGCGACTGTGGAAGTTTTCATCGACGGTGTTCAAGTTGGAGTAGCGCAAAACCCGCAGAAGAAAATGGCTCAAAAGCTAGCTGCGAGGAACGCACTTGCAGCTTTGAAAGAGAAAGAAATAGCAGAATCAAAGGAGAAGCATATCAACAACGGTAATGCGGGAGAGGATCAAGGCGAGAATGAGAATGGGAACAAGAAGAATGGGCATCAGCCGTTTACGAGACAAACGTTGAATGATATTTGTTTGAGGAAGAATTGGCCAATGCCTTCTTACAGATGTGTGAAAGAAGGAGGACCGGCTCATGCAAAGAGATTTACGTTTGGGGTAAGAGTTAATACGAGCGATAGAGGATGGACCGATGAGTGTATTGGCGAGCCAATGCCGAGTGTTAAGAAAGCTAAGGATTCAGCTGCGGTTCTTCTACTTGAGCTTTTAAATAAAACTTTTTCTTGA

 

1

 

68414.m00004 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from [Arabidopsis thaliana]

 

MVMEDEPREATIKPSYWLDACEDISCDLIDDLVSEFDPSSVAVNESTDENGVINDFFGGIDHILDSIKNGGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENGLQKNGGKRDEFSKEEGDKDRKRARVCSYQSERSNLSGRGHVNNSREGDRFMNRKRTRNWDEAGNNKKKRECNNYRRDGRDREVRGYWERDKVGSNELVYRSGTWEADHERDVKKVSGGNRECDVKAEENKSKPEERKEKVVEEQARRYQLDVLEQAKAKNTIAFLETGAGKTLIAILLIKSVHKDLMSQNRKMLSVFLVPKVPLVYQQAEVIRNQTCFQVGHYCGEMGQDFWDSRRWQREFESKQVLVMTAQILLNILRHSIIRMETIDLLILDECHHAVKKHPYSLVMSEFYHTTPKDKRPAIFGMTASPVNLKGVSSQVDCAIKIRNLETKLDSTVCTIKDRKELEKHVPMPSEIVVEYDKAATMWSLHETIKQMIAAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYGVSERTESDGAANLIHKLRAINYTLAELGQWCAYKVGQSFLSALQSDERVNFQVDVKFQESYLSEVVSLLQCELLEGAAAEKVAAEVGKPENGNAHDEMEEGELPDDPVVSGGEHVDEVIGAAVADGKVTPKVQSLIKLLLKYQHTADFRAIVFVERVVAALVLPKVFAELPSLSFIRCASMIGHNNSQEMKSSQMQDTISKFRDGHVTLLVATSVAEEGLDIRQCNVVMRFDLAKTVLAYIQSRGRARKPGSDYILMVERGNVSHAAFLRNARNSEETLRKEAIERTDLSHLKDTSRLISIDAVPGTVYKVEATGAMVSLNSAVGLVHFYCSQLPGDRYAILRPEFSMEKHEKPGGHTEYSCRLQLPCNAPFEILEGPVCSSMRLAQQAVCLAACKKLHEMGAFTDMLLPDKGSGQDAEKADQDDEGEPVPGTARHREFYPEGVADVLKGEWVSSGKEVCESSKLFHLYMYNVRCVDFGSSKDPFLSEVSEFAILFGNELDAEVLSMSMDLYVARAMITKASLAFKGSLDITENQLSSLKKFHVRLMSIVLDVDVEPSTTPWDPAKAYLFVPVTDNTSMEPIKGINWELVEKITKTTAWDNPLQRARPDVYLGTNERTLGGDRREYGFGKLRHNIVFGQKSHPTYGIRGAVASFDVVRASGLLPVRDAFEKEVEEDLSKGKLMMADGCMVAEDLIGKIVTAAHSGKRFYVDSICYDMSAETSFPRKEGYLGPLEYNTYADYYKQKYGVDLNCKQQPLIKGRGVSYCKNLLSPRFEQSGESETVLDKTYYVFLPPELCVVHPLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASCQETFCYERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYIQADRFAPSRWSAPGVPPVFDEDTKDGGSSFFDEEQKPVSEENSDVFEDGEMEDGELEGDLSSYRVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVLKSIDFVGLERALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLEYKASRSGNTATVEVFIDGVQVGVAQNPQKKMAQKLAARNALAALKEKEIAESKEKHINNGNAGEDQGENENGNKKNGHQPFTRQTLNDICLRKNWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS*

 

50

 

AT1G01050

GO:0005737|GO:0016020|GO:0005634|GO:0004427|GO:0016462|GO:0008152

inorganic pyrophosphatase, putative (soluble) / pyrophosphate phospho-hydrolase, putative / PPase, putative [EC:3.6.1.1] [SP:Q93V56_ARATH]

NULL

Show
AT1G01050

AT1G01050

 

GO:0005737|GO:0016020|GO:0005634|GO:0004427|GO:0016462|GO:0008152

 

inorganic pyrophosphatase, putative (soluble) / pyrophosphate phospho-hydrolase, putative / PPase, putative [EC:3.6.1.1] [SP:Q93V56_ARATH]

 

NULL

 

NULL

 

NULL

 

NULL

 

UDP-glucose biosynthesis (from glucose 6-phosphate)

 

3.6.1.1

 

inorganic pyrophosphatase

 

0

 

4

 

1

 

1

 

202

 

374

 

163

 

359

 

201

 

0

 

0

 

0

 

3

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

0

 

4

 

1

 

1

 

230

 

412

 

176

 

404

 

226

 

0

 

0

 

0

 

3

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

T25K16 soluble inorganic pyrophosphatase, putative

 

ATGAGTGAAGAAACTAAAGATAACCAGAGGCTGCAGCGACCAGCTCCTCGTCTTAACGAGAGGATTCTCTCATCCTTGTCAAGAAGATCCGTAGCTGCTCATCCATGGCATGATCTTGAGATTGGACCTGGAGCTCCACAGATTTTCAATGTGGTTGTTGAGATCACTAAAGGAAGCAAGGTCAAATACGAGCTTGACAAAAAGACAGGACTCATCAAGGTTGATCGTATTCTCTACTCATCAGTTGTGTACCCTCACAACTATGGTTTTGTTCCTCGCACATTGTGTGAAGACAATGACCCCATTGATGTCTTAGTCATCATGCAGGAACCTGTGCTTCCGGGTTGTTTTCTGCGTGCCAGAGCCATTGGATTAATGCCTATGATTGACCAGGGTGAAAAAGATGACAAGATCATTGCAGTGTGTGTTGATGATCCTGAATATAAGCACTACACTGACATCAAAGAACTTCCTCCTCACCGTCTCTCTGAAATCCGTCGTTTCTTCGAAGACTACAAGAAAAACGAGAACAAGGAAGTTGCAGTGAATGATTTTCTGCCATCTGAGTCTGCGGTTGAAGCTATCCAGTACTCAATGGACCTCTATGCTGAATACATTCTCCACACCCTGAGGCGTTGA

 

1

 

68414.m00005 inorganic pyrophosphatase, putative [soluble] / pyrophosphate phospho-hydrolase, putative / PPase, putative strong similarity to SP|Q43187 Soluble inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho- hydrolase) (PPase) {Solanum tuberosum}; contains Pfam profile PF00719: inorganic pyrophosphatase

 

MSEETKDNQRLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSESAVEAIQYSMDLYAEYILHTLRR*

 

51

 

AT1G01060

GO:0005634|GO:0003677|GO:0003700|GO:0009651|GO:0009651|GO:0009737|GO:0009733|GO:0009723|GO:0009739|GO:0009753|GO:0009751|GO:0045449|GO:0045449|GO:0045449|GO:0046686|GO:0003700|GO:0042752|GO:0005634|GO:0003677|GO:0003700|GO:0005634|GO:0003677|GO:0005634

-

NULL

Show
AT1G01060

AT1G01060

 

GO:0005634|GO:0003677|GO:0003700|GO:0009651|GO:0009651|GO:0009737|GO:0009733|GO:0009723|GO:0009739|GO:0009753|GO:0009751|GO:0045449|GO:0045449|GO:0045449|GO:0046686|GO:0003700|GO:0042752|GO:0005634|GO:0003677|GO:0003700|GO:0005634|GO:0003677|GO:0005634

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

47

 

0

 

0

 

0

 

15

 

0

 

0

 

115

 

11

 

0

 

0

 

0

 

105

 

1

 

0

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

33

 

0

 

0

 

0

 

0

 

83

 

0

 

0

 

T25K16 DNA-binding protein, putative

 

ATGGATACTAATACATCTGGAGAAGAATTATTAGCTAAGGCAAGAAAGCCATATACAATAACAAAGCAGCGAGAGCGATGGACTGAGGATGAGCATGAGAGGTTTCTAGAAGCCTTGAGGCTTTATGGAAGAGCTTGGCAACGAATTGAAGAACATATTGGGACAAAGACTGCTGTTCAGATCAGAAGTCATGCACAAAAGTTCTTCACAAAGTTGGAGAAAGAGGCTGAAGTTAAAGGCATCCCTGTTTGCCAAGCTTTGGACATAGAAATTCCGCCTCCTCGTCCTAAACGAAAACCCAATACTCCTTATCCTCGAAAGCCTGGGAACAACGGTACATCTTCCTCTCAAGTATCATCAGCAAAAGATGCAAAACTTGTTTCATCGGCCTCTTCTTCACAGTTGAATCAGGCGTTCTTGGATTTGGAAAAAATGCCGTTCTCTGAGAAAACATCAACTGGAAAAGAAAATCAAGATGAGAATTGCTCGGGTGTTTCTACTGTGAACAAGTATCCCTTACCAACGAAACAGGTAAGTGGCGACATTGAAACAAGTAAGACCTCAACTGTGGACAACGCGGTTCAAGATGTTCCCAAGAAGAACAAAGACAAAGATGGTAACGATGGTACTACTGTGCACAGCATGCAAAACTACCCTTGGCATTTCCACGCAGATATTGTGAACGGGAATATAGCAAAATGCCCTCAAAATCATCCCTCAGGTATGGTATCTCAAGACTTCATGTTTCATCCTATGAGAGAAGAAACTCACGGGCACGCAAATCTTCAAGCTACAACAGCATCTGCTACTACTACAGCTTCTCATCAAGCGTTTCCAGCTTGTCATTCACAGGATGATTACCGTTCGTTTCTCCAGATATCATCTACTTTCTCCAATCTTATTATGTCAACTCTCCTACAGAATCCTGCAGCTCATGCTGCAGCTACATTCGCTGCTTCGGTCTGGCCTTATGCGAGTGTCGGGAATTCTGGTGATTCATCAACCCCAATGAGCTCTTCTCCTCCAAGTATAACTGCCATTGCCGCTGCTACAGTAGCTGCTGCAACTGCTTGGTGGGCTTCTCATGGACTTCTTCCTGTATGCGCTCCAGCTCCAATAACATGTGTTCCATTCTCAACTGTTGCAGTTCCAACTCCAGCAATGACTGAAATGGATACCGTTGAAAATACTCAACCGTTTGAGAAACAAAACACAGCTCTGCAAGATCAAAACTTGGCTTCGAAATCTCCAGCTTCATCATCTGATGATTCAGATGAGACTGGAGTAACCAAGCTAAATGCCGACTCAAAAACCAATGATGATAAAATTGAGGAGGTTGTTGTTACTGCCGCTGTGCATGACTCAAACACTGCCCAGAAGAAAAATCTTGTGGACCGCTCATCCTGTGGCTCAAATACACCTTCAGGGAGTGACGCAGAAACTGATGCATTAGATAAAATGGAGAAAGATAAAGAGGATGTGAAGGAGACAGATGAGAATCAGCCAGATGTTATTGAGTTAAATAACCGTAAGATTAAAATGAGAGACAACAACAGCAACAACAATGCAACTACTGATTCGTGGAAGGAAGTCTCCGAAGAGGGTCGTATAGCGTTTCAGGCTCTCTTTGCAAGAGAAAGATTGCCTCAAAGCTTTTCGCCTCCTCAAGTGGCAGAGAATGTGAATAGAAAACAAAGTGACACGTCAATGCCATTGGCTCCTAATTTCAAAAGCCAGGATTCTTGTGCTGCAGACCAAGAAGGAGTAGTAATGATCGGTGTTGGAACATGCAAGAGTCTTAAAACGAGACAGACAGGATTTAAGCCATACAAGAGATGTTCAATGGAAGTGAAAGAGAGCCAAGTTGGGAACATAAACAATCAAAGTGATGAAAAAGTCTGCAAAAGGCTTCGATTGGAAGGAGAAGCTTCTACATGA

 

2

 

68414.m00007 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA LATE ELONGATED HYPOCOTYL MYB transcription factor GI:3281845

 

MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST*

 

52

 

AT1G01070

GO:0016020|GO:0016020

NULL

NULL

Show
AT1G01070

AT1G01070

 

GO:0016020|GO:0016020

 

NULL

 

NULL

 

Nodulin-like protein family

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

6

 

30

 

129

 

20

 

5

 

0

 

0

 

0

 

5

 

17

 

0

 

0

 

0

 

9

 

0

 

3

 

0

 

4

 

1

 

1

 

7

 

36

 

142

 

24

 

6

 

0

 

0

 

0

 

6

 

19

 

0

 

0

 

0

 

10

 

0

 

1

 

T25K16 unknown protein

 

ATGGCTGGAGATATGCAAGGAGTGAGAGTAGTAGAAAAATATTCACCGGTCATAGTGATGGTGATGTCAAATGTAGCGATGGGTTCGGTGAATGCACTTGTGAAGAAAGCTCTTGATGTTGGTGTGAACCATATGGTCATTGGTGCTTATCGAATGGCTATTTCCGCTTTAATTTTGGTTCCCTTTGCCTATGTCTTGGAAAGGAAAACAAGACCACAAATAACGTTTAGGCTAATGGTCGATCATTTCGTCAGTGGCCTTCTCGGGGCGAGTTTGATGCAGTTTTTCTTTTTGCTTGGTCTGTCGTACACGTCAGCAACTGTTTCGTGTGCTTTGGTAAGCATGTTGCCTGCAATCACCTTCGCTTTGGCCCTTATTTTCAGGACTGAAAATGTGAAGATTCTAAAGACCAAAGCAGGAATGTTGAAGGTGATTGGAACTTTGATCTGTATAAGTGGAGCTTTGTTCTTAACATTTTACAAAGGCCCACAAATATCAAACTCTCACTCTCACTCTCACGGTGGGGCTTCCCACAACAACAACGATCAAGACAAGGCCAATAATTGGCTTCTTGGATGTCTTTATTTAACCATAGGAACAGTGTTGCTATCTCTATGGATGTTGTTTCAAGGGACTTTAAGTATTAAGTACCCTTGCAAATACTCGAGCACTTGTCTTATGTCAATTTTCGCGGCATTTCAATGTGCTCTCTTGAGCCTTTACAAGAGCAGAGACGTTAATGATTGGATCATAGATGATAGATTCGTTATCACCGTCATCATATACGCTGGAGTGGTAGGACAAGCAATGACGACGGTTGCAACAACATGGGGGATTAAAAAATTAGGAGCTGTGTTCGCATCGGCGTTTTTCCCACTTACTCTCATTTCGGCTACTCTATTTGATTTCCTCATTTTACACACTCCTTTATACCTTGGAAGTGTGATTGGATCACTAGTGACCATAACGGGTCTCTACATGTTCTTGTGGGGGAAGAACAAAGAAACGGAATCATCAACTGCATTGTCTTCAGGAATGGATAACGAAGCTCAATATACTACTCCTAATAAGGATAACGACTCTAAGTCGCCCGTTTAA

 

2

 

68414.m00008 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula]

 

MLIYMYNFNEFSKEFLLLLNRKTRPQITFRLMVDHFVSGLLGASLMQFFFLLGLSYTSATVSCALVSMLPAITFALALIFRTENVKILKTKAGMLKVIGTLICISGALFLTFYKGPQISNSHSHSHGGASHNNNDQDKANNWLLGCLYLTIGTVLLSLWMLFQGTLSIKYPCKYSSTCLMSIFAAFQCALLSLYKSRDVNDWIIDDRFVITVIIYAGVVGQAMTTVATTWGIKKLGAVFASAFFPLTLISATLFDFLILHTPLYLGSVIGSLVTITGLYMFLWGKNKETESSTALSSGMDNEAQYTTPNKDNDSKSPV*

 

53

 

AT1G01080

GO:0009507|GO:0003723|GO:0008150|GO:0009507|GO:0003723

NULL

NULL

Show
AT1G01080

AT1G01080

 

GO:0009507|GO:0003723|GO:0008150|GO:0009507|GO:0003723

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

17

 

47

 

0

 

35

 

22

 

46

 

24

 

28

 

0

 

20

 

11

 

23

 

48

 

37

 

0

 

0

 

4

 

1

 

1

 

0

 

21

 

52

 

0

 

39

 

25

 

54

 

23

 

31

 

0

 

23

 

12

 

26

 

52

 

44

 

0

 

T25K16 ribonucleoprotein, putative

 

ATGGCGGCCTCCTGCTTCGCAATTCCCTTATCTTCTTCTTCTCGATCGTCTCACAATGCAATTCCCAAATACAAAACCCTAATCTCTTCTTCTTCTTACTCTTACTTAGAATCTCTGAAACTTCAATTCTCTTCTTCCAATTCTTTTCATCACTCTTCTCTTTCTCGTCCCTTTGTAGCTCAACCACTTCAAATCAAGGTCTCTTCTTCAGAATTATCAGTTCTCGATGAAGAAAAAGAAGAAGAAGTAGTTAAAGGAGAAGCAGAACCCAATAAAGATAGTGTCGTCTCCAAAGCAGAACCAGTAAAGAAACCGAGACCTTGCGAGCTCTACGTGTGTAATATCCCTAGAAGCTACGACATTGCTCAGCTTCTTGACATGTTTCAGCCTTTTGGAACTGTAATCTCTGTAGAGGTATCGCGAAATCCTCAGACGGGAGAGAGCCGTGGAAGCGGGTACGTGACAATGGGTTCTATAAACTCTGCCAAAATCGCCATTGCTTCTCTTGATGGAACAGAAGTAGGTGGTCGGGAAATGCGGGTTAGGTACTCTGTTGACATGAATCCAGGAACAAGAAGAAACCCTGAAGTCTTGAACTCAACTCCAAAGAAGATTCTGATGTACGAAAGCCAACACAAGGTCTATGTCGGAAATCTCCCTTGGTTCACACAGCCTGATGGTTTGAGAAACCACTTTAGCAAGTTTGGCACAATCGTAAGCACGAGAGTGTTACATGATCGTAAGACCGGGAGAAACAGAGTCTTTGCCTTTCTTTCTTTTACAAGCGGTGAAGAACGTGATGCGGCTTTATCATTCAATGGAACACAATATGAAGGTCGCAGAATCATCGTCAGAGAAGGTATCGAGAAGAGTGAGTCGTAA

 

1

 

68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris]

 

MAASCFAIPLSSSSRSSHNAIPKYKTLISSSSYSYLESLKLQFSSSNSFHHSSLSRPFVAQPLQIKVSSSELSVLDEEKEEEVVKGEAEPNKDSVVSKAEPVKKPRPCELYVCNIPRSYDIAQLLDMFQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDMNPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALSFNGTQYEGRRIIVREGIEKSES*

 

54

 

AT1G01090

GO:0009507|GO:0004739|GO:0008152

NULL

NULL

Show
AT1G01090

AT1G01090

 

GO:0009507|GO:0004739|GO:0008152

 

NULL

 

Acyl Lipid Metabolism Family

 

Plastidial Pyruvate Dehydrogenase E1 alpha subunit

 

NULL

 

NULL

 

acetyl-CoA biosynthesis (from pyruvate)

 

1.2.4.1

 

pyruvate dehydrogenase (acetyl-transferring)

 

0

 

2

 

1

 

1

 

124

 

635

 

281

 

237

 

282

 

131

 

269

 

475

 

553

 

139

 

228

 

24

 

58

 

129

 

62

 

94

 

0

 

2

 

1

 

1

 

145

 

715

 

317

 

265

 

307

 

148

 

312

 

544

 

613

 

157

 

260

 

23

 

65

 

142

 

74

 

129

 

T25K16 pyruvate dehydrogenase E1 alpha subunit

 

ATGGCGACGGCTTTCGCTCCCACTAAGCTCACTGCCACGGTTCCTCTGCATGGATCCCATGAGAATCGTCTCTTGCTCCCGATCCGATTGGCTCCTCCTTCTTCTTTCCTCGGATCCACCCGTTCCCTCTCCCTTCGCAGACTCAATCACTCCAACGCCACCCGTCGATCTCCCGTCGTCTCTGTCCAGGAAGTTGTCAAGGAGAAGCAATCCACCAATAATACCAGCCTGTTGATAACCAAAGAGGAAGGATTGGAGTTGTATGAAGATATGATACTAGGTAGATCTTTCGAAGACATGTGTGCTCAAATGTATTACCGAGGCAAGATGTTTGGTTTTGTTCACTTGTACAATGGCCAAGAGGCTGTTTCTACTGGCTTTATCAAGCTCCTTACCAAGTCTGACTCTGTCGTTAGTACCTACCGTGACCATGTCCATGCCCTCAGCAAAGGTGTCTCTGCTCGTGCTGTTATGAGCGAGCTCTTCGGCAAGGTTACTGGATGCTGCAGAGGCCAAGGTGGATCCATGCACATGTTCTCCAAAGAACACAACATGCTTGGTGGCTTTGCTTTTATTGGTGAAGGCATTCCTGTCGCCACTGGTGCTGCCTTTAGCTCCAAGTACAGGAGGGAAGTCTTGAAACAGGATTGTGATGATGTCACTGTCGCCTTTTTCGGAGATGGAACTTGTAACAACGGACAGTTCTTCGAGTGTCTCAACATGGCTGCTCTCTATAAACTGCCTATTATCTTTGTTGTCGAGAATAACTTGTGGGCCATTGGGATGTCTCACTTGAGAGCCACTTCTGACCCCGAGATTTGGAAGAAAGGTCCTGCATTTGGGATGCCTGGTGTTCATGTTGACGGTATGGATGTCTTGAAGGTCAGGGAAGTCGCTAAAGAAGCTGTCACTAGAGCTAGAAGAGGAGAAGGTCCAACCTTGGTTGAATGTGAGACTTATAGATTCAGAGGACACTCCTTGGCTGATCCCGATGAGCTCCGTGATGCTGCTGAGAAAGCCAAATACGCGGCTAGAGACCCAATCGCAGCATTGAAGAAGTATTTGATAGAGAACAAGCTTGCAAAGGAAGCAGAGCTAAAGTCAATAGAGAAAAAGATAGACGAGTTGGTGGAGGAAGCGGTTGAGTTTGCAGACGCTAGTCCACAGCCCGGTCGCAGTCAGTTGCTAGAGAATGTGTTTGCTGATCCAAAAGGATTTGGAATTGGACCTGATGGACGGTACAGATGTGAGGACCCCAAGTTTACCGAAGGCACAGCTCAAGTCTGA

 

1

 

68414.m00011 pyruvate dehydrogenase E1 component alpha subunit, chloroplast identical to pyruvate dehydrogenase E1 alpha subunit GB:AAB86803 GI:2454182 from [Arabidopsis thaliana]; identical to cDNA pyruvate dehydrogenase E1 alpha subunit mRNA, nuclear gene encoding plastid protein GI:2454181

 

MATAFAPTKLTATVPLHGSHENRLLLPIRLAPPSSFLGSTRSLSLRRLNHSNATRRSPVVSVQEVVKEKQSTNNTSLLITKEEGLELYEDMILGRSFEDMCAQMYYRGKMFGFVHLYNGQEAVSTGFIKLLTKSDSVVSTYRDHVHALSKGVSARAVMSELFGKVTGCCRGQGGSMHMFSKEHNMLGGFAFIGEGIPVATGAAFSSKYRREVLKQDCDDVTVAFFGDGTCNNGQFFECLNMAALYKLPIIFVVENNLWAIGMSHLRATSDPEIWKKGPAFGMPGVHVDGMDVLKVREVAKEAVTRARRGEGPTLVECETYRFRGHSLADPDELRDAAEKAKYAARDPIAALKKYLIENKLAKEAELKSIEKKIDELVEEAVEFADASPQPGRSQLLENVFADPKGFGIGPDGRYRCEDPKFTEGTAQV*

 

55

 

AT1G01100

GO:0005840|GO:0003735|GO:0006414|GO:0006414|GO:0006414|GO:0005840|GO:0003735|GO:0006414|GO:0006414|GO:0006414

NULL

RPP1A

Show
AT1G01100

AT1G01100

 

GO:0005840|GO:0003735|GO:0006414|GO:0006414|GO:0006414|GO:0005840|GO:0003735|GO:0006414|GO:0006414|GO:0006414

 

NULL

 

Cytoplasmic ribosomal protein gene family

 

P1

 

RPP1A

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

948

 

979

 

687

 

1877

 

1058

 

3176

 

2558

 

4123

 

2622

 

2077

 

1615

 

793

 

1294

 

691

 

260

 

29

 

0

 

2

 

1

 

1

 

526

 

757

 

561

 

1177

 

594

 

1941

 

1510

 

3677

 

2394

 

1849

 

1085

 

628

 

484

 

705

 

253

 

210

 

T25K16 acidic ribosomal protein, putative

 

ATGTCGACAGTTGGAGAGCTTGCTTGCAGCTACGCTGTTATGATCCTCGAGGACGAGGGTATCGCTATCACGGCTGACAAAATCGCGACCTTGGTGAAAGCTGCTGGTGTTAGTATTGAGTCATACTGGCCAATGCTATTCGCCAAGATGGCTGAGAAACGTAACGTGACTGATCTCATCATGAACGTTGGTGCTGGTGGTGGAGGTGGTGCTCCGGTTGCAGCTGCTGCTCCAGCTGCTGGCGGTGGTGCGGCAGCTGCTCCTGCTGCTGAGGAGAAGAAGAAGGATGAGCCAGCAGAAGAGAGTGACGGAGATTTGGGTTTCGGTTTGTTTGACTAA

 

2

 

68414.m00013 60S acidic ribosomal protein P1 (RPP1A) similar to 60S ACIDIC RIBOSOMAL PROTEIN P1 GB:O23095 from [Arabidopsis thaliana]

 

MSTVGELACSYAVMILEDEGIAITADKIATLVKAAGVSIESYWPMLFAKMAEKRNVTDLIMNVGAGGGGGAPVAAAAPAAGGGAAAAPAAEEKKKDEPAEESDGDLGFGLFD*

 

56

 

AT1G01110

GO:0005739|GO:0003674

NULL

NULL

Show
AT1G01110

AT1G01110

 

GO:0005739|GO:0003674

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

1

 

44

 

2

 

26

 

5

 

3

 

18

 

9

 

15

 

0

 

2

 

0

 

0

 

2

 

0

 

0

 

0

 

4

 

1

 

1

 

1

 

50

 

2

 

31

 

5

 

3

 

18

 

8

 

16

 

0

 

2

 

0

 

0

 

2

 

0

 

0

 

T25K16 unknown protein

 

ATGGGGAAAAAGAACGGCTCTTCTTCTTGGCTCACCGCTGTAAAGCGAGCTTTCCGATCTCCGACGAAGAAAGATCATAGTAATGACGTCGAAGAAGATGAAGAAAAGAAGAGAGAGAAGAGACGGTGGTTTAGAAAACCGGCGACTCAAGAATCTCCGGTGAAGTCTTCCGGTATCTCTCCACCAGCACCTCAGGAAGATTCACTTAACGTAAACTCAAAACCCTCTCCGGAGACAGCACCGAGTTACGCAACTACGACGCCGCCATCCAACGCCGGTAAACCCCCGTCCGCCGTAGTCCCCATCGCCACGTCAGCATCTAAGACACTCGCACCGAGGCGGATTTATTACGCAAGAGAAAATTACGCTGCTGTTGTCATCCAGACTTCTTTCAGAGGATATTTGGCAAGAAGAGCATTAAGAGCATTAAAAGGGTTAGTGAAGCTACAAGCATTGGTGAGGGGACATAATGTGAGAAAGCAAGCTAAAATGACATTAAGGTGTATGCAAGCTCTGGTTCGAGTCCAGTCTCGTGTGCTTGACCAACGCAAACGCTTGTCTCATGACGGTAGTCGCAAATCCGCGTTCAGTGACTCTCACGCTGTTTTTGAATCTCGCTATCTTCAAGATTTGTCAGATCGACAATCCATGTCAAGAGAAGGAAGCAGCGCCGCGGAAGATTGGGATGACCGACCACACACGATAGACGCAGTGAAAGTGATGCTACAACGGAGACGGGACACAGCATTGAGACATGACAAGACTAATTTGTCACAAGCTTTCTCTCAAAAGATGTGGAGGACGGTTGGTAACCAATCCACGGAAGGACACCACGAGGTAGAACTTGAAGAGGAAAGGCCAAAATGGCTTGACCGGTGGATGGCTACTAGACCGTGGGATAAACGAGCTAGTAGTAGAGCTTCGGTTGACCAAAGGGTTTCAGTTAAAACCGTTGAAATCGACACTTCTCAGCCTTACTCAAGAACAGGAGCAGGAAGCCCGAGTCGTGGCCAAAGACCTAGTTCCCCATCAAGAACTAGCCACCATTACCAATCCCGCAATAATTTCTCAGCCACTCCATCTCCGGCTAAGTCTAGACCAATACTTATTCGGTCAGCTAGTCCACGGTGCCAGAGAGACCCGAGGGAAGACCGTGACCGAGCAGCTTATAGTTATACATCAAACACACCAAGCTTGAGATCCAATTATAGTTTCACAGCTAGGAGTGGATGTAGCATTAGTACCACAATGGTTAATAATGCATCATTGTTGCCTAATTACATGGCGAGTACAGAGTCAGCTAAAGCGAGGATCCGGTCTCATAGTGCACCGAGGCAACGGCCCTCAACTCCCGAGAGGGACCGTGCGGGTTTGGTCAAGAAACGGCTCTCGTATCCGGTACCACCGCCAGCGGAGTATGAGGACAATAATAGCTTAAGGAGTCCAAGCTTTAAGAGTGTGGCTGGTTCACATTTTGGTGGAATGTTAGAGCAGCAATCGAATTACTCTTCATGTTGCACTGAGTCTAACGGTGTTGAGATCTCTCCAGCTTCTACTAGTGACTTTAGGAATTGGCTTAGATGA

 

1

 

68414.m00014 expressed protein contains Prosite PS00165: Serine/threonine dehydratases pyridoxal-phosphate attachment site

 

MTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSMSREGSSAAEDWDDRPHTIDAVKVMLQRRRDTALRHDKTNLSQAFSQKMWRTVGNQSTEGHHEVELEEERPKWLDRWMATRPWDKRASSRASVDQRVSVKTVEIDTSQPYSRTGAGSPSRGQRPSSPSRTSHHYQSRNNFSATPSPAKSRPILIRSASPRCQRDPREDRDRAAYSYTSNTPSLRSNYSFTARSGCSISTTMVNNASLLPNYMASTESAKARIRSHSAPRQRPSTPERDRAGLVKKRLSYPVPPPAEYEDNNSLRSPSFKSVAGSHFGGMLEQQSNYSSCCTESNGVEISPASTSDFRNWLR*

 

57

 

AT1G01120

GO:0008415|GO:0000038|GO:0000038|GO:0030497|GO:0030497|GO:0042335|GO:0016020|GO:0010025|GO:0010025|GO:0010025|GO:0010025|GO:0009922

NULL

NULL

Show
AT1G01120

AT1G01120

 

GO:0008415|GO:0000038|GO:0000038|GO:0030497|GO:0030497|GO:0042335|GO:0016020|GO:0010025|GO:0010025|GO:0010025|GO:0010025|GO:0009922

 

NULL

 

Acyl Lipid Metabolism Family

 

Ketoacyl-CoA Synthase

 

NULL

 

NULL

 

very long chain fatty acid biosynthesis

 

2.3.1.-

 

3-ketoacyl-CoA synthase||fatty acid elongase||fatty acid elongase

 

0

 

4

 

1

 

1

 

53

 

61

 

88

 

12

 

216

 

28

 

52

 

24

 

60

 

21

 

72

 

0

 

30

 

50

 

0

 

37

 

0

 

4

 

1

 

1

 

61

 

71

 

98

 

14

 

248

 

32

 

59

 

26

 

64

 

24

 

84

 

0

 

31

 

52

 

0

 

51

 

T25K16 putative fatty acid elongase 3-ketoacyl-CoA synthase 1 (At1g01120)

 

ATGGAGAGAACAAACAGCATTGAGATGGATCGAGAGAGATTAACGGCGGAGATGGCGTTTCGAGATTCATCATCGGCCGTTATAAGAATTCGAAGACGTTTGCCGGATTTATTAACGTCCGTTAAGCTCAAATACGTGAAGCTTGGACTTCACAACTCTTGCAACGTGACCACCATTCTCTTCTTCTTAATTATTCTTCCTTTAACCGGAACCGTGCTGGTTCAGCTAACCGGTCTAACGTTCGATACGTTCTCTGAGCTTTGGTCTAACCAGGCGGTTCAACTCGACACGGCGACGAGACTTACCTGCTTGGTTTTCCTCTCCTTCGTTTTGACCCTCTACGTGGCTAACCGGTCTAAACCGGTTTACCTAGTGGATTTCTCCTGCTACAAACCGGAAGACGAGCGTAAAATATCAGTAGATTCGTTCTTGACGATGACTGAGGAAAATGGATCATTCACCGATGACACGGTTCAGTTCCAGCAAAGAATCTCGAACCGGGCCGGTTTGGGAGACGAGACGTATCTGCCACGTGGCATAACTTCAACGCCCCCGAAGCTAAATATGTCAGAGGCACGTGCCGAAGCTGAAGCCGTTATGTTTGGAGCCTTAGATTCCCTCTTCGAGAAAACCGGAATTAAACCGGCCGAAGTCGGAATCTTGATAGTAAACTGCAGCTTATTCAATCCGACGCCGTCTCTATCAGCGATGATCGTGAACCATTACAAGATGAGAGAAGACATCAAAAGTTACAACCTCGGAGGAATGGGTTGCTCCGCCGGATTAATCTCAATCGATCTCGCTAACAATCTCCTCAAAGCAAACCCTAATTCTTACGCTGTCGTGGTAAGCACGGAAAACATAACCCTAAACTGGTACTTCGGAAATGACCGGTCAATGCTCCTCTGCAACTGCATCTTCCGAATGGGCGGAGCTGCGATTCTCCTCTCTAACCGCCGTCAAGACCGGAAGAAGTCAAAGTACTCGCTGGTCAACGTCGTTCGAACACATAAAGGATCAGACGACAAGAACTACAATTGCGTGTACCAGAAGGAAGACGAGAGAGGAACAATCGGTGTCTCTTTAGCTAGAGAGCTCATGTCTGTCGCCGGAGACGCTCTGAAAACAAACATCACGACTTTAGGACCGATGGTTCTTCCATTGTCAGAGCAGTTGATGTTCTTGATTTCCTTGGTCAAAAGGAAGATGTTCAAGTTAAAAGTTAAACCGTATATTCCGGATTTCAAGCTAGCTTTCGAGCATTTCTGTATTCACGCAGGAGGTAGAGCGGTTCTAGACGAAGTGCAGAAGAATCTTGATCTCAAAGATTGGCACATGGAACCTTCTAGAATGACTTTGCACAGATTTGGTAACACTTCGAGTAGCTCGCTTTGGTATGAGATGGCTTATACCGAAGCTAAGGGTCGGGTTAAAGCTGGTGACCGACTTTGGCAGATTGCGTTTGGATCGGGTTTCAAGTGTAATAGTGCGGTTTGGAAAGCGTTACGACCGGTTTCGACGGAGGAGATGACCGGTAATGCTTGGGCTGGTTCGATTGATCAATATCCGGTTAAAGTTGTGCAATGA

 

1

 

68414.m00015 fatty acid elongase 3-ketoacyl-CoA synthase 1 (KCS1) nearly identical to GB:AAC99312 GI:4091810 from [Arabidopsis thaliana]

 

MERTNSIEMDRERLTAEMAFRDSSSAVIRIRRRLPDLLTSVKLKYVKLGLHNSCNVTTILFFLIILPLTGTVLVQLTGLTFDTFSELWSNQAVQLDTATRLTCLVFLSFVLTLYVANRSKPVYLVDFSCYKPEDERKISVDSFLTMTEENGSFTDDTVQFQQRISNRAGLGDETYLPRGITSTPPKLNMSEARAEAEAVMFGALDSLFEKTGIKPAEVGILIVNCSLFNPTPSLSAMIVNHYKMREDIKSYNLGGMGCSAGLISIDLANNLLKANPNSYAVVVSTENITLNWYFGNDRSMLLCNCIFRMGGAAILLSNRRQDRKKSKYSLVNVVRTHKGSDDKNYNCVYQKEDERGTIGVSLARELMSVAGDALKTNITTLGPMVLPLSEQLMFLISLVKRKMFKLKVKPYIPDFKLAFEHFCIHAGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAGDRLWQIAFGSGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKVVQ*

 

58

 

AT1G01130

GO:0005575|GO:0003674|GO:0008150

NULL

NULL

Show
AT1G01130

AT1G01130

 

GO:0005575|GO:0003674|GO:0008150

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

4

 

4

 

4

 

7

 

36

 

22

 

15

 

19

 

2

 

72

 

1

 

0

 

21

 

2

 

0

 

0

 

2

 

1

 

1

 

0

 

4

 

5

 

5

 

9

 

43

 

27

 

18

 

22

 

2

 

89

 

1

 

0

 

23

 

4

 

0

 

T25K16 hypothetical protein

 

ATGGAGAAACGTTCAGATTCAGAGAGTGTAGAGATTTTGGGTGATTGGGATTCACCTCCTCCGGAAGAAAGAATCGTAATGGTTTCTGTTCCCACTTCACCAGAATCTGATTACGCGAGATCGAATCAACCGAAAGAGATCGAATCTAGGGTTTCAGACAAGGAAACAGCGTCGGCATCCGGAGAAGTGGCTGCGAGGAGGGTGTTGCCGCCGTGGATGGATCCGTCGTATGAATGGGGTGGTGGCAAATGGAAAGTAGACGGAAGAAAGAACAAGAACAAGAAAGAGAAAGAGAAAGAGAAAGAAGAGATTATTCCTTTTAAAGAAATAATTGAAGCTCTCCTTGGAAACTCCGGTGACAAGGTTCAACAAGACAACAAGGTGTTTGAAGTGGCACCATCGTTGCACGTGGTAGAGCTTAGGAAAACCGGCGATGATACCCTCGAGTTTCACAAGTTCTACAAAAACATCTGGATTGGAGGATGTAGTCTGGAATACTGA

 

1

 

68414.m00016 expressed protein ; expression supported by MPSS

 

MEKRSDSESVEILGDWDSPPPEERIVMVSVPTSPESDYARSNQPKEIESRVSDKETASASGEVAARRVLPPWMDPSYEWGGGKWKVDGRKNKNKKEKEKEKEEIIPFKEIIEALLGNSGDKVQQDNKVFEVAPSLHVVELRKTGDDTLEFHKVYFRFNLYQPVQLPLILFVVIRFSMLKS*

 

59

 

AT1G01140

GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0007165|GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0007165|GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0007165

NULL

AtCIPK9

Show
AT1G01140

AT1G01140

 

GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0007165|GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0007165|GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0007165

 

NULL

 

NULL

 

AtCIPKs

 

AtCIPK9

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

25

 

50

 

0

 

14

 

58

 

100

 

100

 

102

 

5

 

81

 

12

 

6

 

77

 

0

 

0

 

0

 

2

 

1

 

1

 

0

 

30

 

55

 

0

 

17

 

67

 

119

 

112

 

116

 

6

 

91

 

14

 

7

 

87

 

0

 

0

 

F6F3 SOS2-like protein kinase PKS6/CBL-interacting protein kinase 9 (CIPK9)

 

ATGAGTGGAAGCAGAAGGAAGGCGACGCCGGCGAGTAGGACGCGAGTAGGGAATTACGAGATGGGACGAACTCTCGGAGAAGGAAGCTTCGCTAAGGTGAAATACGCCAAGAACACCGTCACCGGAGATCAAGCCGCTATCAAAATCCTCGACCGAGAAAAGGTCTTCCGTCACAAAATGGTCGAACAGCTTAAAAGAGAAATATCTACAATGAAACTGATTAAACATCCAAATGTGGTTGAAATCATTGAGGTTATGGCGAGCAAAACGAAGATCTATATCGTTCTTGAGCTTGTCAATGGAGGTGAACTCTTTGATAAAATCGCGCAACAAGGGAGGCTTAAGGAGGATGAAGCTCGGAGATATTTTCAGCAGCTCATCAATGCTGTGGATTACTGCCACAGTCGAGGTGTCTACCACAGAGATCTCAAGCCTGAAAATCTGATCCTTGACGCAAATGGGGTTTTGAAAGTCTCTGATTTTGGGTTAAGCGCCTTCTCACGACAAGTTCGGGAAGATGGTTTGCTTCATACAGCTTGTGGAACGCCAAACTACGTTGCCCCTGAGGTTTTGTCGGACAAAGGCTATGACGGTGCAGCAGCAGATGTCTGGTCTTGTGGTGTCATTCTCTTTGTGCTTATGGCTGGTTACTTGCCTTTTGATGAGCCGAATCTCATGACATTATACAAACGTATATGCAAGGCTGAGTTTAGCTGCCCACCATGGTTCTCGCAAGGTGCCAAGAGAGTCATCAAGCGTATTCTCGAACCCAACCCTATTACCAGAATAAGTATTGCAGAGTTGCTCGAAGATGAATGGTTCAAGAAAGGGTACAAGCCGCCATCATTTGACCAAGATGACGAGGACATAACCATAGATGATGTTGATGCTGCTTTTAGTAACTCCAAGGAATGTCTTGTAACTGAGAAGAAGGAGAAACCTGTATCCATGAACGCTTTCGAACTTATCTCTAGCTCAAGCGAGTTCAGTCTTGAAAACTTGTTCGAGAAGCAAGCGCAACTTGTGAAGAAAGAAACGCGGTTTACTTCTCAACGATCTGCGAGTGAAATAATGTCGAAAATGGAAGAAACCGCAAAGCCATTAGGCTTTAATGTCCGTAAAGACAACTACAAGATAAAAATGAAAGGAGACAAAAGTGGTCGTAAAGGTCAGCTCTCCGTAGCTACAGAGGTGTTTGAAGTGGCGCCATCATTGCATGTGGTAGAGCTTAGGAAAACCGGTGGTGATACCCTCGAGTTTCACAAGTTCTACAAAAACTTCTCATCTGGATTAAAGGATGTAGTCTGGAATACTGATGCAGCCGCTGAAGAACAAAAGCAATAA

 

3

 

68414.m00020 CBL-interacting protein kinase 9 (CIPK9) identical to CBL-interacting protein kinase 9 [Arabidopsis thaliana] gi|13249117|gb|AAK16684; contains Pfam profiles PF00069: Protein kinase domain and PF03822: NAF domain; identical to cDNA CBL-interacting protein kinase 9 (CIPK9) GI:13249116

 

MSGSRRKATPASRTRVGNYEMGRTLGEGSFAKVKYAKNTVTGDQAAIKILDREKVFRHKMVEQLKREISTMKLIKHPNVVEIIEVMASKTKIYIVLELVNGGELFDKIAQQGRLKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLILDANGVLKVSDFGLSAFSRQVREDGLLHTACGTPNYVAPEVLSDKGYDGAAADVWSCGVILFVLMAGYLPFDEPNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPPSFDQDDEDITIDDVDAAFSNSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQAQLVKKETRFTSQRSASEIMSKMEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATEVFEVAPSLHVVELRKTGGDTLEFHKVCDSFYKNFSSGLKDVVWNTDAAAEEQKQ*

 

60