KATANA_ID GO Definiton GeneName

AT3G05327

GO:0051726

NULL

NULL

Show
AT3G05327

AT3G05327

 

GO:0051726

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

1

 

0

 

0

 

17

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

1

 

1

 

1

 

0

 

0

 

19

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

11893

 

AT2G01905

GO:0051726

NULL

NULL

Show
AT2G01905

AT2G01905

 

GO:0051726

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

7243

 

AT3G54950

GO:0051707

NULL

NULL

Show
AT3G54950

AT3G54950

 

GO:0051707

 

NULL

 

Acyl Lipid Metabolism Family

 

Patatin-like Acyl-Hydrolase

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

47

 

5

 

5

 

15

 

4

 

5

 

15

 

0

 

0

 

0

 

19

 

3

 

0

 

3

 

0

 

0

 

0

 

2

 

1

 

1

 

31

 

4

 

6

 

8

 

0

 

6

 

8

 

0

 

0

 

0

 

17

 

0

 

0

 

3

 

0

 

0

 

GE_C_20 putative protein

 

ATGCATAGAGTACGCAATAAACCGGTTAAATCCACCGCTACTGCTTCCGTCAAGCATTTAATCAAACAGAGAGGCGGCGACGGAGCTACGGCGGCTTCCAAGTCGGCGAATGATTATAATAATAATGATAGTCTCTTGACGGATATGCAGGAACCAAGCATCGATACAGATAAACTCAGCTACGAGATTTTCTCTATTCTTGAGAGCAAATTTCTTTTCGGGTACGACGACTCGAAACCCGAACCCGCGAATTCGGTTGTTGCTGGGTCGATTAAGAACCAGAGAGGTAAAATCTGTATTCTGAGTATCGATGGAGGTGGAATGAGAGGGATCTTACCCGGTAAGGCTTTGGCTTATCTAGAACACGCTCTGAAATCTAAATCGGGTGACCCGAATGCCCGAATCGCCGATTACTTTGACGTAGCCGCCGGGTCCGGTATAGGTGGGATTTACACAGCCATGTTGTTCGGGTCAAGAGACGGTAACCGCCCCATCTTCAAAGCAGATGACACGTGGCAGTTCTTAACGAGAAACGCCAAGGGTCTTTACGGAGGAGCAGGAATCTTGAAACGGGTCTTGAGAACCGGGTCGGGTTGTTGTTCCGGGACGGCTAAGTTAAAGAAAGTGATGAAAGAGTCTTTCTCGGAGCTAACCTTAAAGGACACGCTTAAACCGGTGCTTATACCTTGCTACGACCTCAAAAGCTCTGGCCCGTTTCTGTTCTCACGGGCCGATGCGCTTGAGACGGACGGCTATGATTTTAGGCTCTCGGAGGTTTGTAGAGCGACTTGGGCTGAGCCGGGTGTGTTTGAGCCCGTGGAGATGAAGTCGGTTGATGGGCAGACCAAGTGTGTGGCTGTTGGTGGAGGATTAGCCATGAGCAATCCCACAGCGGCTGCAATCACGCATGTCCTGCACAACAAGCAGGAGTTTCCGTTTGTGCGAGGTGTTGAGGATTTGCTTGTGTTGTCTCTTGGTATGGGTCAGTTGCTTGATGTTAGCTATGAGTATGATCGGATTATCAAGTGGAAGGCTAAGCATTGGGCTCGCCCCGCAGCTCTTATTTCTAATGACGGTGCTGCTGACACTGTCGATCAAGCTGTGGCCATGGCTTTTGGTCACTGCCGCAGTAGTAACTATGTCCGGATTCAGGCGAATGGGTCGAACTTAGGACCTTGGAGTCCTAACATGGACACAGACCCTAGTGGGAGCAATGTGAATATGCTGATGGGAGTAGCAGAGGAGATGCTTAAACAAAAGAATGTTGAATCTGTTTTGTTTGGAGGTAAAAGAATCGATGAACAGAGCAACTTCGAGAAGCTTGACTGGTTAGCTGGGGAACTTGTTCTCGAGCATCAAAGGAGAAATAGCAGAATCGCTCCAACCGTAGCGTTCAAGCAATCCGTGCATAGAGCAGATCAAAAGACAAGTGATAAAGATATCGGTGTGACCGCAAGAGAACGATGA

 

1

 

68416.m06092 patatin-related low similarity to patatin [GI:169500][Solanum tuberosum]; contains Patatin domain PF01734

 

MHRVRNKPVKSTATASVKHLIKQRGGDGATAASKSANDYNNNDSLLTDMQEPSIDTDKLSYEIFSILESKFLFGYDDSKPEPANSVVAGSIKNQRGKICILSIDGGGMRGILPGKALAYLEHALKSKSGDPNARIADYFDVAAGSGIGGIYTAMLFGSRDGNRPIFKADDTWQFLTRNAKGLYGGAGILKRVLRTGSGCCSGTAKLKKVMKESFSELTLKDTLKPVLIPCYDLKSSGPFLFSRADALETDGYDFRLSEVCRATWAEPGVFEPVEMKSVDGQTKCVAVGGGLAMSNPTAAAITHVLHNKQEFPFVRGVEDLLVLSLGMGQLLDVSYEYDRIIKWKAKHWARPAALISNDGAADTVDQAVAMAFGHCRSSNYVRIQANGSNLGPWSPNMDTDPSGSNVNMLMGVAEEMLKQKNVESVLFGGKRIDEQSNFEKLDWLAGELVLEHQRRNSRIAPTVAFKQSVHRADQKTSDKDIGVTARER*

 

15948

 

AT1G73620

GO:0051707

NULL

NULL

Show
AT1G73620

AT1G73620

 

GO:0051707

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

14

 

48

 

14

 

181

 

230

 

1

 

13

 

9

 

5

 

6

 

15

 

0

 

0

 

0

 

0

 

4

 

0

 

4

 

1

 

1

 

11

 

82

 

13

 

160

 

218

 

1

 

6

 

19

 

5

 

23

 

13

 

0

 

0

 

0

 

0

 

6

 

F25P22 thaumatin like protein

 

ATGACCAATGAGAAATGTGAAGTTGCTCTTCCACTAAAGTTGAAATCAGAAAAACCATCAATGGCTTCTTCATCATCTCTCTTTCTCCTCCCTCTCCTTCTTCTTGTCTCCCAAGCTTCAGCTTCAACGGTTATATTTTACAACAAGTGCACGTACACTGTCTGGCCTGGGATCCAACCTAGCTCCGGTCAGTCATTACTCGCCGGCGGCGGATTTAAACTGTCGCCGAACAGAGCTTACACTCTCCAACTTCCACCGCTCTGGTCCGGTCGCTTCTGGGGCCGCCACGGTTGCTCCTTTGACAGATCTGGCCGTGGTCGCTGCGCCACCGGAGACTGTGGTGGTTCTTTCCTCTGTAACGGAGCTGGCGGTGTACCTCCGGCTACTCTTGCCGAGATCACCCTCGGTCATGACATGGACTTTTATGACGTCAGCCTCGTTGATGGATATAACTTGGCGATGTCGATAATGCCGGTGAAGGGTACGGGAAAGTGTACCTACGCTGGTTGCGTAAGCGACCTGAACCGGATGTGCCCGGTTGGTCTACAAGTCCGTTCACGTGACGGGACACAGGTAGTAGCCTGTAAAAGCGCATGCTCTGCGTTTAACTCACCACGCTATTGCTGTACCGGCTTGTTCGGTAACCCACAGTCATGCAAGCCAACGGCTTACTCTAAGATCTTCAAGGTAGCTTGCCCTAAGGCTTACTCATACGCCTACGATGACCCAACTAGCATTGCGACATGTTCTAAAGCTAATTATGTCGTCACTTTTTGCCCTCACCGCGGCCGTTGA

 

1

 

68414.m08523 thaumatin-like protein, putative / pathogenesis-related protein, putative strong similarity to SP|P50699 Thaumatin-like protein precursor {Arabidopsis thaliana}, pathogenesis-related group 5 protein [Brassica rapa] GI:2749943; contains Pfam profile: PF00314 thaumatin family

 

MTNEKCEVALPLKLKSEKPSMASSSSLFLLPLLLLVSQASASTVIFYNKCTYTVWPGIQPSSGQSLLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCSFDRSGRGRCATGDCGGSFLCNGAGGVPPATLAEITLGHDMDFYDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGTQVVACKSACSAFNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCPHRGR*

 

6391

 

AT4G38670

GO:0051707

NULL

NULL

Show
AT4G38670

AT4G38670

 

GO:0051707

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

13

 

6

 

3

 

0

 

43

 

0

 

9

 

0

 

0

 

2

 

7

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

25

 

0

 

WT_D_31 thaumatin-like protein

 

ATGATGAATCGGATCCTCTTGTTTATGATCCTGGCTTTTGTCTCATCTCTTTCAGAAGTTGAGCCAATTTCGTTCAAGATCACGAATCGTTGCCGGAACACGATATGGCCCGGTTTGCTCTCTGGTGCTAACTCAGCGCCGCTCCCCACAACTGGCTTTCGTCTCTCTAGAGGAAAATCTAAAACCGTCGCAATACCAGAGTCGTGGTCCGGTCGTCTCTGGGCACGAACCTTGTGTTCACAAGATCGGAGTTCCGGTTCTTTCGTCTGCTTAACCGGAGATTGCGGCTCGGGAAAAGTCGAATGTTCAGGCTCCGGAGCTAAACCTCCAGCAACTCTCGCCGAGTTTACTCTCAACGGCACAGGAGGACTAGATTTTTACGACGTTAGCCTCGTCGACGGTTACAATCTCCCGATGCTAATCTTGCCCAAGAAAATCGTCATTGGAGGATGCGGAGCCACCGGGTGTCTCGTGGACTTGAACGGCGCGTGTCCCAGAGACCTAAAGCTGGTGACGCGTGGGAATGGGAACGGTGTTGCTTGCCGTAGCGCGTGCGAGGCATTCGGAGACCCAAGGTATTGCTGCAGCGATGCGTACGCCACGCCGGACACGTGTCAGCCTTCGGTTTACTCGCTCTTCTTTAAGCATGCGTGCCCACGAGCATACAGCTACGCCTATGACGATAAGACGAGCACTTACACTTGCGCCACCGGAGCCGATTACTTCATCATCTTCTGTCCGCCACCGTATACAAGCGAGAAGCTTTTAGGATCGAGGAAAGATGGTGCAACACTGCCACTAGTAAACAAGAGCATGATTCATTTGCCGCATCCGCACAGCAGCTGA

 

1

 

68417.m05475 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile PF00314: Thaumatin family

 

MMNRILLFMILAFVSSLSEVEPISFKITNRCRNTIWPGLLSGANSAPLPTTGFRLSRGKSKTVAIPESWSGRLWARTLCSQDRSSGSFVCLTGDCGSGKVECSGSGAKPPATLAEFTLNGTGGLDFYDVSLVDGYNLPMLILPKKIVIGGCGATGCLVDLNGACPRDLKLVTRGNGNGVACRSACEAFGDPRYCCSDAYATPDTCQPSVYSLFFKHACPRAYSYAYDDKTSTYTCATGADYFIIFCPPPYTSEKLLGSRKDGATLPLVNKSMIHLPHPHSS*

 

20792

 

AT3G55990

GO:0050826|GO:0050826

NULL

NULL

Show
AT3G55990

AT3G55990

 

GO:0050826|GO:0050826

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

41

 

11

 

29

 

40

 

37

 

3

 

7

 

3

 

26

 

37

 

4

 

0

 

17

 

2

 

0

 

0

 

4

 

1

 

1

 

0

 

50

 

11

 

31

 

46

 

42

 

3

 

8

 

4

 

30

 

41

 

4

 

0

 

19

 

2

 

0

 

bs_c_27 unknown protein

 

ATGCAACCTTGGAGAAGAAAATTTCCATTGTTCGAAACAGGAGTTACAATGAAACAGAGGAAGAACAGTAATCTCTCAATCTTCGTCGTAGTCTTCTCTGTTTTCCTCTTCGGGATCTTCATGTACAATGAAGACGTCAAGTCCATCGCAGAGTTTCCTTTCTCCACCTCAAAACCTCACGACGTCCACGACGAAGCGACACCGATCACAGAGATCACAACACTACCGGTTCAAGAGTCGATCAAGAACTCAGACCCAATTCAGGAATCGATCAAAAACGCAGACTCAGTTCAAGATTCAGTTAAAGACGTAGCAGAACCAGTTCAAGAGGAGGTATCGAAAACAGAGGAAGTTAAAAAGATTGAGCTTTTCGCTGCGACGGAGGATGAAGAAGACGTGGAATTGCCGCCGGAGGAATGCGATTTGTTCACCGGAGAATGGGTTTTTGATAACGAGACGCATCCATTGTATAAAGAGGATCAATGTGAGTTCTTGACGGCGCAAGTCACTTGCATGAGAAATGGAAGAAGAGATTCTCTGTATCAGAACTGGAGATGGCAACCTAGAGATTGTTCTTTACCAAAGTTCAAAGCGAAATTGCTGTTGGAGAAGCTAAGGAACAAGAGAATGATGTTCGTTGGAGATTCCCTAAACCGGAACCAATGGGAATCAATGGTTTGTTTGGTTCAATCAGTGGTTCCTCCCGGTCGAAAAAGCTTGAACAAAACCGGTTCTCTCTCCGTCTTCCGAGTCGAGGATTATAATGCGACGGTGGAGTTTTATTGGGCACCATTTTTGGTGGAATCGAATTCAGATGATCCAAATATGCATAGTATACTTAACCGTATAATAATGCCTGAGTCCATTGAAAAGCATGGAGTCAACTGGAAAGGCGTTGACTTTCTTGTTTTCAACACTTACATTTGGTGGATGAACACATTCGCTATGAAAGTCCTACGAGGATCGTTCGATAAAGGAGACACCGAGTATGAGGAGATCGAACGGCCAGTAGCGTATAGGAGAGTGATGAGGACTTGGGGAGATTGGGTGGAACGAAATATTGATCCTCTACGTACCACTGTCTTCTTTGCTAGCATGTCTCCTCTTCACATCAAGAGCTTGGATTGGGAGAATCCAGATGGGATCAAGTGTGCATTAGAGACGACACCAATCCTAAACATGTCAATGCCATTCAGCGTAGGAACAGACTACAGACTGTTTTCAGTAGCGGAAAACGTCACGCATTCTCTTAATGTTCCGGTTTACTTTCTCAACATTACCAAACTCTCCGAATACCGGAAAGATGCTCACACTTCGGTTCACACAATCCGACAAGGCAAAATGCTGACGCCGGAGCAACAAGCCGATCCCAACACTTACGCCGATTGTATCCATTGGTGTCTTCCCGGTTTACCTGACACGTGGAATGAGTTCCTTTACACACGTATCATTTCCCGTTCGTGA

 

1

 

68416.m06221 expressed protein contains Pfam profile PF03005: Arabidopsis proteins of unknown function

 

MQPWRRKFPLFETGVTMKQRKNSNLSIFVVVFSVFLFGIFMYNEDVKSIAEFPFSTSKPHDVHDEATPITEITTLPVQESIKNSDPIQESIKNADSVQDSVKDVAEPVQEEVSKTEEVKKIELFAATEDEEDVELPPEECDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRRVMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRIISRS*

 

16055

 

AT3G29765

GO:0046983

NULL

NULL

Show
AT3G29765

AT3G29765

 

GO:0046983

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

1

 

68416.m03762 hAT dimerisation domain-containing protein

 

MTSPPIQKDIVHCFSEEVTRSIIEEMDNDVFGLLVDESADASDKEQMAVVFRFVDKYGVVKERFIGVIHVQETSSLSLKSAIDSLFAKYGLSLKKLRGKGYDGASNMKGKFNGLRSLILKENSSAYYVHCFAHQLQLVVMAVAKKHVEVGEFFYMISVLLNVVGASCKRKDKIREIDRQKVEEKISNGEIKTGTGLNQELSLQRPGNTRWGSHYKTLLRLEELFSSIVIVLEYIQDEGTDTTKRQQAYGILKYFHTFDFVFYLELMLLVMGLTDSLSKALQRKDQDILNAISLVKTTKCQLQKVRDDGWDAFMAEVSSFSEKTNTGMLKMEEEFVDSRRPRKKTGITNLHHYKVDCFYTVLDMQLQEFNDCFDELNSELLICMSSLSPIDSFRQFDKSMLVRLTEFYPDDFSFVERRSLDHQLEIYLDNVKNDERFTDLEHLGDLARVMVETRKHLSHPLVYRLLKLSLILPVATATVVRCFSAMNFVKTTLRNRFGDVFLSDCLVCFIEKQVLNTVTNESVIKRFQDMSERRVHL*

 

14483

 

AT2G11270

GO:0046912

NULL

NULL

Show
AT2G11270

AT2G11270

 

GO:0046912

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

1

 

68415.m01208 citrate synthase-related contains similarity to Swiss-Prot:P20115 citrate synthase, mitochondrial precursor [Arabidopsis thaliana]

 

MVFRHLIIPFNLNNNRGRFHVVIKLFSLYSRETSYTNTTFNFQDRSKKLKLKHGKVPVGNITVDMVLGGMRGMTGLHNRNLIA*

 

7818

 

AT1G62760

GO:0046910

NULL

NULL

Show
AT1G62760

AT1G62760

 

GO:0046910

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

F23N19 hypothetical protein

 

ATGAACATCTTATCTCAAACCCAAATCCTTCATCTCTCTATAGCTATTCTTCTCTTCATCACAACATCATCATCATCATTATCACCATCATCATCATCACCATCATTATCACCATCACCACCATCATCATCACCATCATCGGCACCACCATCATCATTATCACCATCATCACCACCACCACTATCATTATCACCATCATCACCACCACCACCGCCACCATCATCATCACCTCTATCATCATTATCACCATCATTATCACCATCACCACCATCATCATCACCATCATCGGCACCACCATCATCATTATCACCATCATCACCACCACCACTATCATTATCACCATCATCACCACCACCACCGCCACCATCATCATCACCTCTATCATCATTATCACCATCATCATCTTCATCAACATACTCAAATCAAACCAACTTAGATTACATCAAAACATCATGTAACATTACACTCTACAAAACCATTTGCTACAACTCTCTATCTCCTTACGCCTCAACAATCCGTTCCAACCCTCAAAAACTCGCTGTCATCGCCCTCAATCTCACCCTCTCATCCGCCAAATCTGCCTCCAAATTCGTCAAAAACATATCTCACGGAGGTGGTCTAACACGTTTGGAAGTAGTTGCGGTTGCTGATTGCGTTGAAGAGATTGGAGACTCGGTGACTTCGCTTCAAGATTCGATAAGGGAATTGGATTCTATCAACTATAAAGATAGTGCAAAGTTTGAGATGGTTATGTCGGATGTTGAAACATGGGTTAGTGCTGCTCTCACGAATGATGACACATGTATGGATGGTTTCAGTCTAGTTAAAACGGCCGTGAAAGATTTGGTTCGACGACATGTTGTTGAGGTAGCTCGGCTTACTAGCAACGCGCTTGCTCTCATTAATATGTACGCCTCTACGCAAGAAAACTTTTCTTAA

 

1

 

68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992

 

MNILSQTQILHLSIAILLFITTSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSSSSSTYSNQTNLDYIKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVKNISHGGGLTRLEVVAVADCVEEIGDSVTSLQDSIRELDSINYKDSAKFEMVMSDVETWVSAALTNDDTCMDGFSLVKTAVKDLVRRHVVEVARLTSNALALINMYASTQENFS*

 

5279

 

AT5G63530

GO:0046872|GO:0046914|GO:0046916

NULL

NULL

Show
AT5G63530

AT5G63530

 

GO:0046872|GO:0046914|GO:0046916

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

4

 

108

 

51

 

19

 

29

 

167

 

250

 

266

 

388

 

41

 

248

 

56

 

28

 

152

 

6

 

35

 

0

 

2

 

1

 

1

 

5

 

122

 

55

 

23

 

30

 

194

 

304

 

293

 

450

 

45

 

284

 

63

 

32

 

166

 

10

 

0

 

MLE2 putative metal-binding protein

 

ATGGGAGAGGAAGAGAAGAAACCAGAAGCAGCAGAGGAAAAGAAAATGGAAGAGAAGAAACCAGAAGAGAAAAAAGAAGGAGAAGACAAGAAAGTGGATGCTGAGAAAAAAGGAGAAGATTCTGACAAGAAGCCTCAAGAAGGAGAATCTAACAAAGATTCCAAAGAAGATTCTGCTCCGGCGGCGCCTGAGGCTCCAGCACCGCCTCCTCCGCCGCAAGAGGTTGTTCTTAAGGTTTACATGCACTGTGAAGGATGTGCTAGAAAAGTCCGCCGTTGTCTCAAAGGCTTCGAAGGAGTGGAAGATGTGATGACTGATTGTAAAACGGGGAAAGTGGTGGTGAAAGGTGAGAAAGCTGATCCATTGAAAGTATTAGCTAGAGTTCAGAGGAAGACCCACCGTCAAGTTCAGCTTCTGTCTCCGATTCCTCCTCCGCCTCCGCCGCCGGAGAAGAAAGCAGAGGAGGATAAACCCATTGTGGAAGAGAAGAAAGTGGAGCCTCCGGTGGTTGTGACGGTGGTTCTTAAGGTTCACATGCACTGTGAAGCTTGTGCGACAGAGATCAAGAAACGGATCATGAGAATGAAAGGAGTGGAATCTGCTGAATCCGACTTAAAGAGTTCTCAAGTGACGGTGAAAGGAGTTTTTGAACCACAAAAGCTTGTAGAATACGTTTATAAGCGAACCGGAAAACATGCTGCGATCATGAAAATCGACCCACCGCCTCCACCACCACCTGAGGAGGCGGCTGCGGCAGCGGAAGGAGAGAAGAAGGAAGAAGAAAAGGGAGAAGGAGAATCCAAAGGCGAAGAAGGGAAGGATGATAAGGCGAAGACGGACGAAGAAAAGAAAGAAGGGGATGGTGGTAAAGGGGAAGGCGAAGCAGCGGATAATGGCGGTGGGGAGGAAGAAGGCAAAGTTGTGGAGGTGAGAAAGATAGAGAATCCTTATTACTACTACTATTACCAACCACCGCGTGTGGCGATTCCGCCTATGGAAATGCCGCCACACGCTTATCCGCCTCAATTGTTCAGCGACGAGAATCCAAATGCATGTACTGTAATGTAA

 

1

 

68418.m07974 copper chaperone (CCH)-related low similarity to copper homeostasis factor [GI:3168840]; nearly identical to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain

 

MGEEEKKPEAAEEKKMEEKKPEEKKEGEDKKVDAEKKGEDSDKKPQEGESNKDSKEDSAPAAPEAPAPPPPPQEVVLKVYMHCEGCARKVRRCLKGFEGVEDVMTDCKTGKVVVKGEKADPLKVLARVQRKTHRQVQLLSPIPPPPPPPEKKAEEDKPIVEEKKVEPPVVVTVVLKVHMHCEACATEIKKRIMRMKGVESAESDLKSSQVTVKGVFEPQKLVEYVYKRTGKHAAIMKIDPPPPPPPEEAAAAAEGEKKEEEKGEGESKGEEGKDDKAKTDEEKKEGDGGKGEGEAADNGGGEEEGKVVEVRKIENPYYYYYYQPPRVAIPPMEMPPHAYPPQLFSDENPNACTVM*

 

26861

 

AT5G56795

GO:0046872|GO:0010038|GO:0012505

NULL

NULL

Show
AT5G56795

AT5G56795

 

GO:0046872|GO:0010038|GO:0012505

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

4

 

0

 

0

 

4

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

26157

 

AT5G57735

GO:0045814

NULL

NULL

Show
AT5G57735

AT5G57735

 

GO:0045814

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

3

 

0

 

0

 

5

 

1

 

9

 

0

 

7

 

0

 

10

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

1

 

1

 

0

 

3

 

0

 

0

 

5

 

0

 

4

 

0

 

5

 

0

 

12

 

0

 

0

 

0

 

0

 

0

 

NULL

 

NULL

 

0

 

NULL

 

NULL

 

26254

 

AT2G23430

GO:0045736|GO:0005634|GO:0004861|GO:0009737|GO:0045740|GO:0045740|GO:0045740|GO:0045736|GO:0010102

NULL

KRP1

Show
AT2G23430

AT2G23430

 

GO:0045736|GO:0005634|GO:0004861|GO:0009737|GO:0045740|GO:0045740|GO:0045740|GO:0045736|GO:0010102

 

NULL

 

NULL

 

Core Cell Cycle Genes

 

KRP1

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

5

 

6

 

5

 

0

 

0

 

1

 

4

 

3

 

5

 

0

 

78

 

14

 

0

 

45

 

0

 

7

 

0

 

4

 

1

 

1

 

6

 

8

 

4

 

0

 

0

 

1

 

4

 

3

 

6

 

0

 

88

 

15

 

0

 

50

 

0

 

0

 

f26b6 cyclin-dependent kinase inhibitor protein

 

ATGGTGAGAAAATATAGAAAAGCTAAAGGAATTGTAGAAGCTGGAGTTTCGTCAACGTATATGCAGCTACGGAGCCGGAGAATTGTTTATGTTAGATCGGAAAAATCAAGCTCTGTCTCCGTCGTCGGTGATAATGGAGTTTCGTCGTCTTGTAGTGGAAGCAATGAATATAAGAAGAAAGAATTAATACATCTGGAGGAGGAAGATAAAGATGGTGACACTGAAACGTCGACGTATCGACGGGGTACGAAGAGGAAGCTTTTTGAAAATCTGAGAGAGGAGGAGAAAGAAGAATTAAGTAAATCCATGGAGAATTATTCATCGGAATTTGAATCGGCGGTTAAAGAATCGTTAGATTGTTGTTGTAGCGGGAGGAAAACGATGGAGGAGACGGTGACGGCGGAGGAGGAGGAGAAGGCGAAATTGATGACGGAGATGCCAACGGAATCGGAAATTGAAGATTTTTTTGTGGAAGCTGAGAAACAACTCAAAGAAAAATTCAAGAAGAAGTACAATTTCGATTTCGAGAAGGAGAAGCCATTAGAAGGACGTTACGAATGGGTAAAGTTAGAGTGA

 

1

 

68415.m02797 kip-related protein 1 (KRP1) / cyclin-dependent kinase inhibitor 1 (ICK1) identical to cyclin-dependent kinase inhibitor (ICK1) [Arabidopsis thaliana] GI:3550262, GI:2052502

 

MVRKYRKAKGIVEAGVSSTYMQLRSRRIVYVRSEKSSSVSVVGDNGVSSSCSGSNEYKKKELIHLEEEDKDGDTETSTYRRGTKRKLFENLREEEKEELSKSMENYSSEFESAVKESLDCCCSGRKTMEETVTAEEEEKAKLMTEMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE*

 

8843

 

AT4G28520

GO:0045735|GO:0045735|GO:0045735|GO:0009793|GO:0045735|GO:0042735|GO:0042735

NULL

NULL

Show
AT4G28520

AT4G28520

 

GO:0045735|GO:0045735|GO:0045735|GO:0009793|GO:0045735|GO:0042735|GO:0042735

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

EN_D_20 12S cruciferin seed storage protein

 

ATGGTTAAGCTCAGCAATCTCCTCGTTGCAACCTTCGGGGTTCTCCTCGTCCTTAACGGCTGCCTTGCGAGGCAGTCACTTGGGGTTCCTCCTCAGCTACAGAACGAGTGTAACCTCGACAACCTAGATGTTCTCCAAGCCACCGAAACTATCAAGAGTGAAGCCGGTCAGATCGAGTACTGGGACCACAACCACCCTCAGCTCCGATGTGTTGGTGTTTCCGTTGCTCGTTATGTAATTGAACAAGGCGGTCTTTACTTGCCCACCTTCTTCACTTCCCCAAAAATTTCCTACGTCGTTCAAGGAACGGGTATCAGCGGAAGAGTGGTCCCTGGATGTGCCGAGACCTTCATGGACTCGCAGCCGATGCAAGGACAACAACAAGGCCAACCATGGCAAGGACGACAGGGACAACAAGGCCAACCATGGGAAGGACAGGGACAACAGGGACAACAAGGAAGACAAGGCCAACCATGGGAAGGACAGGGACAACAGGGACAACAAGGACGACAGGGACAACAAGGCCAACCATGGGAAGGACAGGGACAGCAGGGACAACAAGGGTTCCGTGACATGCACCAGAAGGTGGAACATGTGAGACGCGGAGACGTCTTTGCCAACACTCCAGGCTCTGCCCACTGGATCTACAACTCAGGAGAACAGCCACTTGTCATCATCGCTCTTCTCGACATCGCCAACTACCAAAACCAACTCGACCGCAACCCTAGAGTGTTCCATTTGGCCGGAAACAACCAGCAGGGAGGCTTTGGCGGTTCACAGCAACAACAAGAACAGAAAAACTTGTGGAGCGGGTTCGACGCACAGGTCATAGCTCAAGCATTGAAAATTGACGTTCAGTTGGCTCAGCAGCTTCAGAACCAACAAGACAGCAGAGGAAACATCGTTCGTGTTAAGGGACCTTTCCAGGTCGTGAGGCCACCTCTAAGACAGCCCTACGAGAGCGAGGAGTGGAGACACCCACGTAGCCCACAGGGCAACGGCCTTGAGGAGACTATCTGCAGCATGAGGTCCCACGAGAACATTGACGACCCTGCTCGTGCTGACGTGTACAAGCCCAGCCTAGGTCGCGTGACCAGCGTCAACAGCTATACCTTGCCCATCTTGGAGTATGTCAGGCTCAGTGCCACTCGTGGCGTTCTCCAGGGTAATGCGATGGTGCTTCCTAAATACAACATGAACGCTAACGAGATCTTGTACTGCACTGGAGGACAAGGAAGGATCCAAGTGGTCAACGACAACGGACAGAACGTGTTGGACCAACAGGTGCAGAAGGGACAGCTCGTGGTCATCCCACAAGGGTTCGCATACGTTGTCCAGTCCCACGGAAACAAGTTCGAGTGGATCTCTTTCAAAACTAATGAAAACGCAATGATCAGCACTTTGGCGGGTAGAACCTCGCTCTTGAGGGCATTGCCATTGGAGGTCATATCAAATGGTTTCCAGATCTCTCCCGAGGAAGCTAGGAAGATCAAGTTCAACACACTTGAGACCACTTTGACCCGCGCTGCCGGTAGGCAACAACAACAGTTGATCGAGGAGATTGTCGAGGCTTAA

 

3

 

68417.m04081 12S seed storage protein, putative / cruciferin, putative strong similarity to SP|P33525 Cruciferin CRU1 precursor (11S globulin) (12S storage protein) from Brassica napus; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305 isoform contains non-consensus AC acceptor splice site at intron 3

 

MVKLSNLLVATFGVLLVLNGCLARQSLGVPPQLQNECNLDNLDVLQATETIKSEAGQIEYWDHNHPQLRCVGVSVARYVIEQGGLYLPTFFTSPKISYVVQGTGISGRVVPGCAETFMDSQPMQGQQQGQPWQGRQGQQGQPWEGQGQQGQQGRQGQPWEGQGQQGQQGRQGQQGQPWEGQGQQGQQGFRDMHQKVEHVRRGDVFANTPGSAHWIYNSGEQPLVIIALLDIANYQNQLDRNPRVFHLAGNNQQGGFGGSQQQQEQKNLWSGFDAQVIAQALKIDVYKPSLGRVTSVNSYTLPILEYVRLSATRGVLQGNAMVLPKYNMNANEILYCTGGQGRIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSHGNKFEWISFKTNENAMISTLAGRTSLLRALPLEVISNGFQISPEEARKIKFNTLETTLTRAAGRQQQQLIEEIVEA*

 

19723

 

AT5G44120

GO:0045735|GO:0045735|GO:0012505|GO:0045735|GO:0045735

NULL

NULL

Show
AT5G44120

AT5G44120

 

GO:0045735|GO:0045735|GO:0012505|GO:0045735|GO:0045735

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

MLN1 legumin-like protein

 

ATGGCTCGAGTCTCTTCTCTTCTTTCTTTCTGCTTAACACTTTTGATCCTTTTCCATGGCTACGCGGCTCAACAGGGTCAGCAGGGTCAGCAGTTTCCGAACGAGTGCCAGCTCGACCAGCTCAATGCGCTCGAGCCGTCACACGTACTGAAGAGCGAGGCTGGTCGCATCGAGGTGTGGGACCACCACGCTCCTCAGCTCCGTTGCTCAGGTGTCTCCTTTGCACGTTACATCATCGAGTCTAAGGGTCTCTACTTGCCCTCTTTCTTTAACACCGCGAAGCTCTCTTTCGTGGCTAAGGGACGAGGTCTTATGGGAAAAGTGATCCCTGGATGCGCCGAAACATTCCAAGACTCATCAGAGTTCCAACCACGCTTCGAAGGTCAAGGTCAAAGCCAGAGGTTCCGTGACATGCACCAGAAAGTGGAGCACATTAGGAGCGGTGATACCATTGCCACAACACCCGGTGTAGCACAGTGGTTCTACAACGACGGACAGGAACCACTTGTCATCGTCAGCGTCTTCGATCTAGCCAGTCACCAGAACCAGCTTGACCGCAACCCAAGGCCATTTTACTTAGCCGGAAACAACCCACAAGGTCAAGTATGGCTACAAGGACGAGAGCAACAGCCACAGAAGAACATTTTCAATGGATTTGGACCCGAGGTTATTGCTCAAGCTTTGAAGATCGATCTTCAGACAGCACAGCAACTTCAGAACCAAGATGACAACCGTGGAAACATTGTCCGAGTCCAAGGACCGTTCGGTGTCATTAGGCCGCCTTTGAGGGGCCAGAGACCTCAGGAGGAGGAAGAAGAAGAAGGACGACATGGACGACACGGTAATGGCTTAGAGGAGACCATCTGCAGCGCCAGGTGCACCGATAACCTCGATGACCCGTCTCGTGCTGACGTGTACAAGCCACAGCTCGGTTACATCAGCACTCTCAACAGTTACGATCTCCCCATCCTTCGCTTCATCCGTCTCTCAGCCCTCCGTGGATCTATCCGTCAAAACGCAATGGTGCTTCCACAGTGGAACGCAAACGCGAACGCTATTCTTTACGTGACAGACGGGGAAGCCCAAATCCAGATCGTAAACGACAATGGTAACAGAGTGTTTGACGGACAAGTCTCTCAAGGACAGCTCATAGCCGTACCACAAGGTTTCTCGGTGGTGAAACGCGCAACAAGCAACCGATTCCAGTGGGTTGAGTTCAAAACAAACGCTAACGCGCAAATCAACACTCTGGCGGGACGAACCTCAGTCTTGAGAGGTTTACCACTTGAAGTCATAACCAATGGGTTCCAAATCTCACCCGAAGAAGCAAGGAGGGTCAAGTTCAACACGCTCGAGACCACTTTGACTCACAGCAGTGGCCCAGCTAGCTACGGAAGGCCAAGGGTGGCTGCAGCTTAA

 

3

 

68418.m05400 12S seed storage protein (CRA1) nearly identical to SP|P15455 [Plant Mol Biol 11:805-820 (1988)]; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305

 

MARVSSLLSFCLTLLILFHGYAAQQGQQGQQFPNECQLDQLNALEPSHVLKSEAGRIEVWDHHAPQLRCSGVSFARYIIESKGLYLPSFFNTAKLSFVAKGRGLMGKVIPGCAETFQDSSEFQPRFEGQGQSQRFRDMHQKVEHIRSGDTIATTPGVAQWFYNDGQEPLVIVSVFDLASHQNQLDRNPRPFYLAGNNPQGQVWLQGREQQPQKNIFNGFGPEVIAQALKIDLQTAQQLQNQDDNRGNIVRVQGPFGVIRPPLRGQRPQEEEEEEGRHGRHGNGLEETICSARCTDNLDDPSRADVYKPQLGYISTLNSYDLPILRFIRLSALRGSIRQNAMVLPQWNANANAILYVTDGEAQIQIVNDNGNRVFDGQVSQGQLIAVPQGFSVVKRATSNRFQWVEFKTNANAQINTLAGRTSVLRGLPLEVITNGFQISPEEARRVKFNTLETTLTHSSGPASYGRPRVAAA*

 

24759