KATANA_ID GO Definiton GeneName

AT2G36660

GO:0003723|GO:0003743

NULL

unnamed-PAB-like

Show
AT2G36660

AT2G36660

 

GO:0003723|GO:0003743

 

NULL

 

Protein synthesis factors

 

PABP - poly(A) binding protein

 

unnamed-PAB-like

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

0

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

4

 

0

 

0

 

0

 

0

 

0

 

0

 

4

 

0

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

4

 

0

 

0

 

0

 

0

 

0

 

f13k3 putative poly(A) binding protein

 

ATGGCGACTGTTCATGCTGCATTACATGCGGCGGATGCTTCTTCTTCGGGATCGAGTTCTCCAGTGACGGCGTCGTTATATGTCGGAGACTTACACCCTTCCGTCACCGAAGGTATACTCTACGACGCGTTCGCCGAGTTCAAGAGCTTAACTTCTGTTCGTCTCTGTAAAGACGCTTCGTCTGGTCGCTCTCTCTGTTATGGCTACGCTAACTTTCTCTCGCGTCAAGACGCTAACCTTGCCATTGAGAAAAAAAATAACAGTTTGTTGAATGGAAAAATGATTCGAGTAATGTGGTCTGTTCGAGCACCTGATGCTAGGAGAAATGGGGTTGGAAATGTCTTTGTTAAGAATTTGCCTGAGTCAGTCACCAATGCGGTTCTGCAAGATATGTTCAAGAAATTTGGGAACATTGTTTCCTGTAAGGTTGCAACTCTTGAAGATGGAAAGAGTCGGGGATATGGTTTTGTTCAATTTGAGCAAGAAGACGCTGCACATGCTGCTATTCAGACCTTGAATAGTACCATTGTTGCTGACAAGGAGATCTATGTTGGAAAATTCATGAAAAAGACTGATCGAGTGAAACCTGAGGAAAAGTACACGAACTTGTACATGAAGAATCTCGATGCAGATGTCAGTGAGGATCTTTTAAGGGAAAAGTTTGCAGAGTTTGGGAAAATTGTTAGCCTAGCAATTGCAAAAGATGAGAACCGATTATGTAGAGGATATGCATTTGTCAACTTTGACAACCCAGAGGATGCAAGACGGGCAGCTGAAACAGTGAATGGAACAAAATTTGGTTCGAAGTGTCTATATGTAGGAAGGGCGCAAAAGAAAGCAGAACGGGAGCAACTGCTAAGGGAACAATTTAAAGAGAAACATGAAGAACAGAAGATGATAGCCAAGGTGTCAAACATATATGTGAAAAACGTCAATGTTGCTGTTACTGAGGAGGAGCTGAGAAAACACTTCAGTCAATGTGGCACAATCACTTCGACAAAGCTGATGTGTGATGAGAAAGGAAAAAGCAAGGGGTTTGGATTTGTGTGCTTCTCAACACCTGAAGAAGCTATTGATGCTGTGAAAACCTTTCATGGGCAAATGTTTCACGGGAAACCACTATATGTGGCTATTGCTCAAAAGAAAGAGGACAGAAAGATGCAGTTACAGGTTCAATTTGGGAACCGTGTGGAAGCTAGAAAAAGCAGCTCTTCAGCTTCTGTCAATCCAGGGACATACGCTCCACTTTACTACACAAACACTCATCCCGGGATGGTATATCAATCATACCCGCTGATGTGGAAGTCTGCTAACATGATTGGTTCATCATACCCAAACTCTGAAGCAGTCACATATCCCCCAATGGTTGCTAATGCGCCAAGTAAGAATAGGCAGAACAGAATAGGAAAGTTGGATAGGAATGCTGTTTCGTATGTGCCAAATGTGTATCAGTCTACTCAAATGCTTCCTTTGTCAAGAGATTTTTCGAAGCAGCAGCATAGCAGAACCTATGGTCGTGGGAAAGAAATGAAGAAATCAATCCAACAGAGACAGTCTGAAACAGTTGGGATGGAGATGCAATTGCTCGGAGAGTTGCTACACCCTCTTGTCGAGAAACTGGAGCCCCAGCTTGCAAACAAAATCACAGGGATGCTTCTGGAAATGGACAAGTCGGAATTGCTTCTTTTGCTGAAATCACCAGAAGACTTGGCTGTTAGAGTTGATGAAGCGTTTGAAGTTCTGAAATCATCCAAGACAAATCTGACCGCTCCAAACACTCATCGTTCTGATTACTTGGCGTCTGGCATTGCTGGCGTTTCGATTAAGTGA

 

1

 

68415.m04496 polyadenylate-binding protein, putative / PABP, putative

 

MATVHAALHAADASSSGSSSPVTASLYVGDLHPSVTEGILYDAFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVRAPDARRNGVGNVFVKNLPESVTNAVLQDMFKKFGNIVSCKVATLEDGKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKKTDRVKPEEKYTNLYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENRLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRAQKKAEREQLLREQFKEKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIAQKKEDRKMQLQVQFGNRVEARKSSSSASVNPGTYAPLYYTNTHPGMVYQSYPLMWKSANMIGSSYPNSEAVTYPPMVANAPSKNRQNRIGKLDRNAVSYVPNVYQSTQMLPLSRDFSKQQHSRTYGRGKEMKKSIQQRQSETVGMEMQLLGELLHPLVEKLEPQLANKITGMLLEMDKSELLLLLKSPEDLAVRVDEAFEVLKSSKTNLTAPNTHRSDYLASGIAGVSIK*

 

10235

 

AT1G34140

GO:0003723|GO:0003743

NULL

unnamed-PAB-like

Show
AT1G34140

AT1G34140

 

GO:0003723|GO:0003743

 

NULL

 

Protein synthesis factors

 

PABP - poly(A) binding protein

 

unnamed-PAB-like

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

0

 

0

 

3

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

0

 

1

 

4

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

F12G12 putative protein

 

ATGGAGGTGCTGAATTATTGTAAGTTAAAGGGAAAACCTATGAGGATAATGTTTTCAGAACGTGATCCTAGCAACAGAATGAGTGGACGAGGTAACGTGTTTGTCAAGAATCTAGACGAATCTATCGACAACAAGCAACTTTGCGATATGTTCTCTGCATTTGGCAAAGTTCTCTCTTGCAAAGTGGCTCGTGATGCTTCTGGAGTTTCCAAAGGATATGGGTTCGTCCAGTTTTACTCAGACCTTTCAGTCTACACCGCATGCAATTTTCACAATGGCACGCTCATCCGCAATCAACATATTCATGTTTGTCCATTCGTTAGCCGTGGTCAATGGGATAAATCTCGGGTTTTCACTAATGTTTATGTTAAAAACTTGGTGGAGACTGCGACGGATGCTGATTTGAAGAGGCTCTTTGGGGAGTTTGGGGAGATAACTAGCGCGGTGGTGATGAAAGATGGAGAAGGTAAGTCTAGAAGGTTCGGGTTTGTGAACTTCGAGAAGGCTGAGGCCGCGGTTACTGCGATAGAGAAGATGAACGGGGTAGTAGTTGATGAAAAGGAGTTGCATGTTGGAAGAGCTCAGAGGAAAACTAATAGAACTGAGGATTTGAAAGCTAAATTTGAACTAGAAAAGATAATACGGGATATGAAAACACGTAAAGGGATGAATCTTTATGTGAAGAATCTTGATGATTCTGTTGATAACACAAAGCTTGAAGAATTATTCTCAGAGTTTGGGACCATCACTTCTTGCAACAAAGGTGTTGGGTTTGTTGAGTTCTCAACGAGCGAAGAAGCTTCGAAAGCGATGCTCAAGATGAATGGGAAAATGGTGGGAAATAAACCTATCTATGTTTCTTTGGCACAATGCAAAGAGCAACATAAGCTTCATTTACAAACTCAATTTAATAACCCACCACCAAGTCCTCACCAACAACCTATCTTCAGTCAAGTGGTCGCTCCGGCAACAATGTTATCTCAACAAACTCCATTAAGAGGATACAACTTCCAACCATATTCTATGTGCGGATCAAGAATGCCAAACAGTTGCCCTCCAATCTCTATCCCTAATTTCATGGTGCCACAACCATTTCGTCCAACACTATATCCACCTGCTCCGCTTGTCGGCCTCTACGGTAGTTTGCCACAGCCACTACTGCAACCAAATCTATGGAACCCATACCGTAGATTTTAG

 

1

 

68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM)

 

MEVLNYCKLKGKPMRIMFSERDPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARDASGVSKGYGFVQFYSDLSVYTACNFHNGTLIRNQHIHVCPFVSRGQWDKSRVFTNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEGKSRRFGFVNFEKAEAAVTAIEKMNGVVVDEKELHVGRAQRKTNRTEDLKAKFELEKIIRDMKTRKGMNLYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEASKAMLKMNGKMVGNKPIYVSLAQCKEQHKLHLQTQFNNPPPSPHQQPIFSQVVAPATMLSQQTPLRGYNFQPYSMCGSRMPNSCPPISIPNFMVPQPFRPTLYPPAPLVGLYGSLPQPLLQPNLWNPYRRF*

 

3373

 

AT1G49760

GO:0003723|GO:0003743

NULL

unnamed-PAB-like

Show
AT1G49760

AT1G49760

 

GO:0003723|GO:0003743

 

NULL

 

Protein synthesis factors

 

PABP - poly(A) binding protein

 

unnamed-PAB-like

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

125

 

281

 

156

 

264

 

119

 

167

 

212

 

173

 

275

 

281

 

77

 

58

 

33

 

80

 

83

 

90

 

0

 

2

 

1

 

1

 

148

 

325

 

176

 

312

 

135

 

196

 

258

 

201

 

316

 

308

 

87

 

62

 

37

 

86

 

122

 

63

 

F14J22 Putative Poly-A Binding Protein (F14J22.3)

 

ATGGCTCAGATTCAGCATCAGGGTCAAAATGCCAATGGTGGTGTAGCTGTTCCCGGTGCTGCTGCGGCTGAAGCTGCGGCGGCTGCGGCTGGAGCTGCGGCGGCGGCTGCCGGAGCTGCGCAGCAAGGGACGACGTCTTTATATGTCGGTGATCTGGATGCGACCGTGACGGATTCACAGCTGTTTGAGGCGTTTACCCAAGCGGGTCAGGTGGTTTCTGTCCGTGTCTGCAGAGACATGACGACTCGGAGATCTCTAGGCTATGGCTACGTTAACTATGCAACTCCTCAAGATGCTTCCAGGGCACTGAATGAGCTGAATTTCATGGCTCTTAATGGAAGGGCTATAAGAGTTATGTATTCTGTTCGTGATCCAAGTCTCCGTAAGAGCGGAGTTGGTAATATATTTATTAAGAATCTTGACAAATCAATTGATCACAAAGCACTTCACGAGACATTTTCAGCCTTTGGTCCCATTCTATCTTGCAAAGTGGCCGTTGATCCCTCTGGTCAGTCGAAAGGCTATGGGTTTGTGCAGTACGACACTGATGAAGCAGCTCAGGGAGCCATTGATAAACTGAATGGAATGCTTCTTAACGATAAGCAAGTTTATGTTGGACCCTTTGTTCACAAGCTGCAGAGAGATCCTTCGGGTGAGAAAGTTAAGTTCACTAATGTTTATGTCAAAAATCTCTCCGAGTCCTTGAGTGATGAAGAGCTTAACAAAGTTTTTGGAGAGTTCGGAGTGACTACTAGTTGTGTTATCATGAGAGATGGTGAAGGAAAGTCTAAAGGCTTTGGATTTGTCAATTTTGAGAATTCTGATGATGCAGCCAGAGCTGTTGACGCTCTAAATGGAAAGACCTTTGACGACAAGGAGTGGTTTGTTGGGAAGGCCCAAAAGAAGTCCGAGAGGGAAACTGAACTCAAACAAAAGTTTGAGCAAAGTTTGAAGGAGGCTGCAGACAAGTCTCAGGGGTCGAACTTATATGTTAAGAACTTGGATGAGAGCGTCACAGATGATAAGCTCAGAGAACATTTTGCTCCCTTTGGAACTATTACATCATGCAAGGTGATGCGTGACCCCAGTGGAGTGAGTAGAGGATCTGGATTTGTCGCATTTTCAACTCCTGAGGAAGCAACTAGAGCTATTACAGAGATGAATGGAAAAATGATCGTTACCAAACCTCTATATGTTGCTCTTGCGCAGCGGAAAGAAGACCGCAAAGCTAGGTTACAGGCTCAATTTTCACAGATGAGGCCGGTCAATATGCCACCTGCGGTTGGTCCTAGGATGCAAATGTATCCACCAGGTGGTCCACCAATGGGTCAGCAACTCTTCTATGGTCAAGGGCCTCCTGCTATGATTCCTCAGCCTGGATTCGGATATCAACAACAGCTTGTACCGGGTATGAGACCTGGTGGGTCTCCAATGCCAAACTTCTTCATGCCTATGATGCAACAAGGCCAGCAACAGCAACAGCAGCAACAGCAGCAGCAGCGACCTGGTGGTGGTAGAAGAGGAGCTCTTCCACAACCACAACAACCTTCTCCTATGATGCAGCAGCAGATGCATCCAAGAGGTCGAATGTATCGGTATCCTCAGCGAGATGTAAACACAATGCCTGGTCCTACTCAAAACATGCTTTCTGTTCCATATGACGTCTCAAGTGGTGGTGGTGTGCATCATCGTGACTCGCCTACTTCTCAACCTGTTCCTATTGTAGCTTTGGCTACACGGCTTGCGAATGCAGCTCCAGAGCAACAGAGAACGATGCTTGGTGAGAATCTATACCCGCTTGTGGAGCAGCTGGAGCCAGAATCCGCAGCTAAAGTCACGGGAATGCTTCTTGAAATGGACCAAACCGAAGTACTTCACTTGCTGGAATCACCAGAGGCACTTAAAGCTAAAGTTACAGAAGCAATGGATGTTCTGAGGAGTGTAGCACAGCAGCAAGCGGGTGGTGCAGCTGATCAGTTAGCTTCTCTGTCTCTTGGAGACAACATCGTACCTTGA

 

1

 

68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum]

 

MAQIQHQGQNANGGVAVPGAAAAEAAAAAAGAAAAAAGAAQQGTTSLYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLRKSGVGNIFIKNLDKSIDHKALHETFSAFGPILSCKVAVDPSGQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVHKLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFENSDDAARAVDALNGKTFDDKEWFVGKAQKKSERETELKQKFEQSLKEAADKSQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVALAQRKEDRKARLQAQFSQMRPVNMPPAVGPRMQMYPPGGPPMGQQLFYGQGPPAMIPQPGFGYQQQLVPGMRPGGSPMPNFFMPMMQQGQQQQQQQQQQQRPGGGRRGALPQPQQPSPMMQQQMHPRGRMYRYPQRDVNTMPGPTQNMLSVPYDVSSGGGVHHRDSPTSQPVPIVALATRLANAAPEQQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLESPEALKAKVTEAMDVLRSVAQQQAGGAADQLASLSLGDNIVP*

 

4053

 

AT5G18110

GO:0005737|GO:0003723|GO:0003743|GO:0003743|GO:0006413|GO:0006413|GO:0006413|GO:0006413

NULL

unassigned-nCBP

Show
AT5G18110

AT5G18110

 

GO:0005737|GO:0003723|GO:0003743|GO:0003743|GO:0006413|GO:0006413|GO:0006413|GO:0006413

 

NULL

 

Protein synthesis factors

 

nCBP - novel cap binding protein

 

unassigned-nCBP

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

204

 

91

 

114

 

207

 

132

 

3

 

11

 

25

 

2

 

16

 

17

 

6

 

0

 

16

 

0

 

33

 

0

 

4

 

1

 

1

 

217

 

90

 

118

 

230

 

147

 

3

 

13

 

25

 

2

 

18

 

17

 

7

 

0

 

18

 

0

 

17

 

MRG7 eukaryotic cap-binding protein (gb|AAC17220.1)

 

ATGGAGGTTTTGGATAGGAGAGACGATGAGATCAGGGACTCGGGAAACATGGACAGCATCAAGTCACACTATGTTACCGACTCTGTTTCCGAGGAACGCCGCTCTCGTGAGCTCAAGGATGGAGACCATCCTTTACGGTACAAGTTTTCGATATGGTACACTCGTCGCACACCAGGGGTTCGGAACCAGTCTTATGAAGATAACATCAAGAAGATGGTAGAATTCAGCACGGTTGAAGGATTTTGGGCCTGCTACTGTCACCTTGCTCGTTCTTCTCTCTTGCCTAGTCCAACAGATCTTCATTTCTTTAAGGATGGGATTCGTCCATTGTGGGAGGATGGTGCCAACTGCAATGGAGGAAAGTGGATCATACGTTTCTCAAAAGTTGTATCTGCTCGCTTCTGGGAGGATCTGCTTCTTGCGTTGGTAGGCGACCAGCTTGATGATGCTGATAACATATGTGGGGCAGTACTGAGTGTCCGTTTCAACGAGGACATCATTAGTGTATGGAATCGCAATGCTTCTGACCATCAGGCAGTGATGGGTTTGAGAGACTCAATCAAGCGGCATTTGAAGTTGCCTCATGCATATGTCATGGAATACAAGCCACACGATGCTTCTCTCCGCGACAACTCTTCCTACAGAAACACATGGCTGAGAGGATAG

 

1

 

68418.m02126 novel cap-binding protein (nCBP) identical to novel cap-binding protein nCBP [Arabidopsis thaliana] GI:3108209; contains Pfam profile PF01652: Eukaryotic initiation factor 4E

 

MEVLDRRDDEIRDSGNMDSIKSHYVTDSVSEERRSRELKDGDHPLRYKFSIWYTRRTPGVRNQSYEDNIKKMVEFSTVEGFWACYCHLARSSLLPSPTDLHFFKDGIRPLWEDGANCNGGKWIIRFSKVVSARFWEDLLLALVGDQLDDADNICGAVLSVRFNEDIISVWNRNASDHQAVMGLRDSIKRHLKLPHAYVMEYKPHDASLRDNSSYRNTWLRG*

 

22659

 

AT4G30680

GO:0003743|GO:0008150

NULL

unassigned-mystery-4g-like-protein

Show
AT4G30680

AT4G30680

 

GO:0003743|GO:0008150

 

NULL

 

Protein synthesis factors

 

eIF4G-like - related to eIF4G

 

unassigned-mystery-4g-like-protein

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

23

 

4

 

28

 

63

 

4

 

0

 

8

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

1

 

1

 

25

 

4

 

19

 

67

 

5

 

0

 

9

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

WU_D_21 translation initiation factor-like protein

 

ATGCAGCAAGGTGACTCAATGCTGAGCTTGAGGCCTGGAGGTGGTCGTGGAGGAAGCAGACGCTTTGCCCCACGCTTTACCTTATCTTCTTCCTCTGATCTTACCAATGGCGGAGACGCTCCTTCTTTTGCCGTTAAGGGCAGTGGAGGCCTTCTGAACGATAGACCAAGTGCCCTTGTGCAAGGTAATGGTTCCCAACAGCCTAAACCTGTTCCTTCCCCGACCAGACAAACTGTGGAGAAGCCAAAACCACAACCACAGCCACAGGAGGTGGCTCCTCCTACGACTACTAGCTTGAACACAGTAGAGCTCAGTAGAAAGACCAACTCGCTTTTGGAGGAATATTTCAATGTCCGTCTATTGGATGAGGCATTACAATGCATAGAAGAACTGAAAACCCCGTCTTACCATCCTGAGCTTGTCAAGGAAGCTATCTCCCTCGGCTTGGAGAAGAACCCTCCTTGTGTTGAACCAGTGGCGAAGCTCTTGGAACATCTGGTCTCTAAGAATGTTCTAACTCCTAAAGACTTAAGGAATGGTTGTCTGCTCTATGGGTCTATGCTCGATGACATTGGGATCGATCTGCCAAAAGCGCCAAACAACTTTGGGGAGATCCTTGGGAGTTTGGTTATGGCCAAAGCATCGGATTCTGAGTTGGTGAAAGAGATTCTAATGAAAATGGGAGACGAATGGTTCAAGAAAGCAGTCTTGGAAGCTGTGATGAGGAGTGTTAGTGAGTCTCTACTCACTACGGAAGCAGTAGAGGTTGAGGCTTGCCGTGGTTTGGTGTAG

 

1

 

68417.m04349 MA3 domain-containing protein similar to SP|Q03387 Eukaryotic initiation factor (iso)4F subunit P82-34 (eIF-(iso)4F P82-34) {Triticum aestivum}; contains Pfam profile PF02847: MA3 domain

 

MQQGDSMLSLRPGGGRGGSRRFAPRFTLSSSSDLTNGGDAPSFAVKGSGGLLNDRPSALVQGNGSQQPKPVPSPTRQTVEKPKPQPQPQEVAPPTTTSLNTVELSRKTNSLLEEYFNVRLLDEALQCIEELKTPSYHPELVKEAISLGLEKNPPCVEPVAKLLEHLVSKNVLTPKDLRNGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMAKASDSELVKEILMKMGDEWFKKAVLEAVMRSVSESLLTTEAVEVEACRGLV*

 

19955

 

AT1G62410

GO:0003743|GO:0006412|GO:0006412|GO:0006412|GO:0012505

NULL

unassigned, similarity to 4G

Show
AT1G62410

AT1G62410

 

GO:0003743|GO:0006412|GO:0006412|GO:0006412|GO:0012505

 

NULL

 

Protein synthesis factors

 

eIF4G-like - related to eIF4G

 

unassigned, similarity to 4G

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

0

 

0

 

0

 

0

 

3

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

F24O1 hypothetical protein

 

ATGGCTAATTTGTGCCCTTTTCTTTCACTACAGCGTTTGACAACCCTTATTTTCGACAAAGCAGTCCTTGAGCCGACCTTTTGCCCTATGTACGCTCAATTGTGCTTTGATATCCGCCACAAAATGCCTAGGTTTCCACCTTCAGCGCCTAAGACTGATGAGATCTCATTCAAGAGGGTTTTGCTGAACACATGTCAAAAGGTGTTTGAGAGAACTGACGACTTAAGTGAGGAGATTAGAAAGATGAACGCGCCAGATCAGGAGGCCGAACGGGAAGACGAAGTAAGACTGTTGAACCTCCGGACTCTAGGAAATCTTCGTTTTTGTGGTGAGCTTTTTTTGAAGCGGATGTTGACAGAAAAGGTTGTTTTAGCCATTGGTCAGAAGCTTTTGGAGGATGCTGAGCAAATGTGTCCATCAGAGGAAAAAATTATAGCTATTTGTCTCTTTCTCAACACTGTTGGCAAAAAGCTTGATTCATTGAACTCAAAACTGATGAACGAGATTTTAAGACGTTTAAAGAATCTGTCAAATCATCCTCAATTGGTTATGAGCTTAAGATTAATGGTTGGGAAGATCATCCATTTGCACTCCATTGGGATAAAGTCCGATCCTATAAACATGTGGGAGGACTCCAAGTGTGGTTATATCCTCGGTATTATCTCGATGTGA

 

1

 

68414.m07041 MIF4G domain-containing protein similar to SP|Q03387 Eukaryotic initiation factor (iso)4F subunit P82-34 (eIF-(iso)4F P82-34) {Triticum aestivum}; contains Pfam profile PF02854: MIF4G domain

 

MANLCPFLSLQRLTTLIFDKAVLEPTFCPMYAQLCFDIRHKMPRFPPSAPKTDEISFKRVLLNTCQKVFERTDDLSEEIRKMNAPDQEAEREDEVRLLNLRTLGNLRFCGELFLKRMLTEKVVLAIGQKLLEDAEQMCPSEEKIIAICLFLNTVGKKLDSLNSKLMNEILRRLKNLSNHPQLVMSLRLMVGKIIHLHSIGIKSDPINMWEDSKCGYILGIISM*

 

5248

 

AT4G20410

GO:0005794|GO:0005783|GO:0005215|GO:0006886|GO:0006886

NULL

gamma-SNAP

Show
AT4G20410

AT4G20410

 

GO:0005794|GO:0005783|GO:0005215|GO:0006886|GO:0006886

 

NULL

 

NSF and SNAP Proteins

 

gamma-SNAP Gene Family

 

gamma-SNAP

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

98

 

129

 

95

 

75

 

157

 

15

 

72

 

39

 

36

 

44

 

18

 

0

 

16

 

19

 

1

 

0

 

0

 

2

 

1

 

1

 

112

 

148

 

103

 

91

 

188

 

17

 

81

 

45

 

43

 

52

 

22

 

0

 

16

 

22

 

1

 

0

 

PL_D_24 unknown protein

 

ATGTCTTCGGATCCTGACAAAATGATGTCCAAAGCCGACAAAATGACAAAGCTCACGCTTACTAGATGGAGTGCTGATTGGAGAGGTGCTACTGAGTTGTATGAGCAAGCAGCAAATGGGTTTAGAGCATCAAACAAATATGAGAAAGCTAAAGTGGCTCTCGAGAAAGCTTCAAAAGGACAAGAGATGCAAGCTTCTCCTTGGGATGCTGCAAAGCATATGGAGTCTGCTGCTGCCTTAGCACAGAAGCTAAGTATTTGGAATGAAGTTGCTGATTTTTATAGAAAGGCGTCGGAGCTGTATGTTGAGTGTGGAAGGGCACAACCCGCATCAGATGCTCTTGGAAAGGCTGCCCGTGCTTTGGAAGATGTCAAACCAGATGACGCCATCCAACTATACACTGATGCTTGTGAAATTCTTGAAGAGGATGGGAGGGACCAAATGGCCTTTGATCTGTACCGTGCTTGTGCTAATGTCTACATTAAGCTTGAGAAGTTCACAGATGCTGCAACCTTTTTCTTAAGATTGGGTGTAGCTGCTGATAAGTGTGATGCGACAAATAGCCAGTGTAAGGCCTATCTCAGTGCAATCATCTTATATCTGTATGCTCACGACCTGCAGCAGGCAGAAAAATGCTACAATGACTGTTCTCAGATTGATGCCTTTCTGAAGAGTGATCAGAGCCGAAGTGCTAGTAGACTTCTCACCGCCTATAATGAAGGTGACATTGAAGAAATCAAGAAGGTGGCGAGTGCAAGCACTGTCTCGAATTTGGATCATATGATTATCAAGTTGGCTAGGAAGCTACCCACTGGAGATGTTACTGCAATTCAGATGAACACTAATGACGATCTAGACGAGGATGATCTCACTTAA

 

1

 

68417.m02979 gamma-soluble NSF attachment protein / gamma-SNAP identical to gamma-soluble NSF attachment protein; gamma-SNAP [Arabidopsis thaliana] GI:6013206

 

MSSDPDKMMSKADKMTKLTLTRWSADWRGATELYEQAANGFRASNKYEKAKVALEKASKGQEMQASPWDAAKHMESAAALAQKLSIWNEVADFYRKASELYVECGRAQPASDALGKAARALEDVKPDDAIQLYTDACEILEEDGRDQMAFDLYRACANVYIKLEKFTDAATFFLRLGVAADKCDATNSQCKAYLSAIILYLYAHDLQQAEKCYNDCSQIDAFLKSDQSRSASRLLTAYNEGDIEEIKKVASASTVSNLDHMIIKLARKLPTGDVTAIQMNTNDDLDEDDLT*

 

18858

 

AT1G26340

GO:0005575|GO:0006118|GO:0020037|GO:0046914

NULL

b5 #6

Show
AT1G26340

AT1G26340

 

GO:0005575|GO:0006118|GO:0020037|GO:0046914

 

NULL

 

Cytochrome b5

 

Cytochromes b5

 

b5 #6

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

38

 

20

 

24

 

52

 

49

 

2

 

11

 

3

 

3

 

8

 

0

 

0

 

0

 

4

 

0

 

0

 

0

 

4

 

1

 

1

 

45

 

6

 

24

 

38

 

68

 

1

 

6

 

4

 

1

 

0

 

0

 

0

 

0

 

4

 

0

 

0

 

T1K7 cytochrome b5 like protein

 

ATGCCGACACTCACAAAGCTTTATTCCATGGAAGAAGCCGCAACTCACAACAAGCAAGATGACTGCTGGGTCGTCATCGACGGCAAGGTCTATGATGTATCCTCTTATATGGATGAGCATCCTGGAGGAGATGATGTGCTTCTTGCTGTCGCAGGCAAAGATGCAACGGATGATTTTGAAGACGCAGGGCACAGCAAAGATGCTAGGGAACTTATGGAGAAGTATTTTATTGGCGAGCTAGATGAATCTTCTTTACCGGAAATACCTGAGCTTAAGATCTACAAGAAGGACCAGCCACAAGACTCTGTTCAGAAGCTTTTTGACTTGACAAAGCAGTATTGGGTTGTTCCTGTCTCCATTATCACCATCTCTGTAGCGGTTAGTGTCTTGTTCTCTCGCAAGACTTAA

 

1

 

68414.m03212 cytochrome b5, putative similar to cytochrome b5 GB:BAA74839 GI:4240120 from [Arabidopsis thaliana]

 

MPTLTKLYSMEEAATHNKQDDCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSKDARELMEKYFIGELDESSLPEIPELKIYKKDQPQDSVQKLFDLTKQYWVVPVSIITISVAVSVLFSRKT*

 

2593

 

AT1G60660

GO:0006118|GO:0020037|GO:0046914

NULL

b5 #5

Show
AT1G60660

AT1G60660

 

GO:0006118|GO:0020037|GO:0046914

 

NULL

 

Cytochrome b5

 

Cytochromes b5

 

b5 #5

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

42

 

10

 

30

 

28

 

33

 

7

 

14

 

6

 

2

 

47

 

3

 

13

 

0

 

42

 

5

 

63

 

0

 

2

 

1

 

1

 

49

 

11

 

24

 

30

 

37

 

7

 

15

 

0

 

2

 

57

 

4

 

14

 

0

 

47

 

5

 

77

 

F8A5 Putative Cytochrome B5

 

ATGATAGCTGTGATCGGATTGCTTCTGGGTTTTCTAGTATCAGCATTGTTCTTAATCCAAGGAAAGCGAAGAAGAACAAACGACAATCAAGAGAAGAAGAGATCTAGCAGTGAGCCTGTAGAAGATGTGGTAAGACCAAAAAGTTACAGCAAGAGTGAAGTCGCAGTACATAACAAAAGGAACGATTGTTGGATCATAATCAAAGATAAAGTCTATGATATTACTTCTTATGTTGAAGAACATCCTGGTGGTGACGCTATTCTTGATCATGCTGGTGATGATTCTACTGATGGCTTCTTCGGACCTCAACACGCCACTCGTGTTTTCGACATGATTGAAGATTTCTACATCGGGGAACTTCATTAG

 

1

 

68414.m06829 cytochrome b5 domain-containing protein contains InterPro accession IPR001199: Cytochrome b5

 

MIAVIGLLLGFLVSALFLIQGKRRRTNDNQEKKRSSSEPVEDVVRPKSYSKSEVAVHNKRNDCWIIIKDKVYDITSYVEEHPGGDAILDHAGDDSTDGFFGPQHATRVFDMIEDFYIGELH*

 

5062

 

AT2G32720

GO:0005575|GO:0006118|GO:0020037|GO:0046914

NULL

b5 #4

Show
AT2G32720

AT2G32720

 

GO:0005575|GO:0006118|GO:0020037|GO:0046914

 

NULL

 

Cytochrome b5

 

Cytochromes b5

 

b5 #4

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

55

 

313

 

40

 

120

 

170

 

211

 

187

 

239

 

171

 

113

 

269

 

0

 

12

 

0

 

0

 

42

 

0

 

2

 

1

 

1

 

65

 

361

 

46

 

138

 

199

 

245

 

228

 

284

 

196

 

129

 

318

 

0

 

13

 

0

 

0

 

55

 

f24l7 putative cytochrome b5

 

ATGGGAGACGAAGCAAAGATCTTCACTCTTTCAGAAGTTTCAGAGCATAATCAAGCTCATGACTGTTGGATTGTCATCAATGGAAAGGTGTACAATGTGACCAAGTTTCTTGAAGACCATCCAGGTGGGGACGATGTTCTCTTGTCTTCAACAGGTAAGGATGCAACGGATGATTTTGAGGACGTGGGTCACAGCGAGAGTGCAAGAGAAATGATGGAGCAGTACTACGTAGGAGAGATTGATCCAACAACAATACCAAAGAAAGTCAAATACACACCTCCTAAACAGCCTCACTACAATCAAGACAAGACCTCTGAATTCATAATCAAGCTCCTCCAGTTCCTCGTACCCCTTGCCATTCTTGGTTTAGCAGTCGGAATCCGTATCTACACCAAATCAGGGTAG

 

1

 

68415.m04004 cytochrome b5, putative similar to Cytochrome B5 SP:P49098 from [Nicotiana tabacum]

 

MGDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTKSG*

 

9796

 

AT5G48810

GO:0005783|GO:0006118|GO:0005789|GO:0005789|GO:0005789|GO:0005789|GO:0009055|GO:0006118

NULL

b5 #3

Show
AT5G48810

AT5G48810

 

GO:0005783|GO:0006118|GO:0005789|GO:0005789|GO:0005789|GO:0005789|GO:0009055|GO:0006118

 

NULL

 

Cytochrome b5

 

Cytochromes b5

 

b5 #3

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

140

 

178

 

118

 

81

 

147

 

306

 

197

 

118

 

206

 

753

 

333

 

108

 

54

 

304

 

135

 

405

 

0

 

2

 

1

 

1

 

166

 

201

 

135

 

91

 

169

 

338

 

235

 

138

 

231

 

883

 

367

 

117

 

58

 

336

 

200

 

541

 

K24G6 cytochrome b5 (dbj|BAA74840.1)

 

ATGGGCGGAGACGGAAAAGTTTTCACCTTGTCCGAGGTTTCTCAGCACAGTAGCGCCAAGGATTGTTGGATCGTCATCGACGGCAAGGTTTATGATGTGACAAAGTTCTTGGATGATCATCCTGGTGGTGATGAGGTTATCTTGACTTCTACAGGGAAAGATGCGACCGATGATTTCGAGGATGTGGGACATAGTTCGACTGCGAAAGCCATGCTAGATGAGTACTATGTGGGTGATATTGACACAGCTACTGTGCCGGTTAAAGCTAAGTTTGTGCCTCCTACGTCGACGAAAGCCGTGGCTACTCAGGATAAGAGCTCGGATTTTGTTATTAAGCTCCTTCAGTTCCTTGTTCCACTTCTAATCTTAGGCTTGGCTTTCGGCATTCGGTACTACACTAAGACCAAGGCTCCTTCTTCTTGA

 

1

 

68418.m06039 cytochrome b5 identical to cytochrome b5 [Arabidopsis thaliana] GI:4240122; strong similarity to Cytochrome B5 SP:P49098 from [Nicotiana tabacum]

 

MGGDGKVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFEDVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPLLILGLAFGIRYYTKTKAPSS*

 

25289

 

AT5G53560

GO:0005783|GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0006118|GO:0005789|GO:0005789|GO:0005789|GO:0005789|GO:0009055|GO:0006118

NULL

b5 #2

Show
AT5G53560

AT5G53560

 

GO:0005783|GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0006118|GO:0005789|GO:0005789|GO:0005789|GO:0005789|GO:0009055|GO:0006118

 

NULL

 

Cytochrome b5

 

Cytochromes b5

 

b5 #2

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

760

 

240

 

299

 

1274

 

361

 

143

 

242

 

278

 

112

 

672

 

174

 

86

 

116

 

275

 

29

 

374

 

0

 

4

 

1

 

1

 

875

 

283

 

343

 

1461

 

411

 

158

 

276

 

311

 

124

 

747

 

195

 

89

 

130

 

298

 

36

 

432

 

MNC6 cytochrome b5 (dbj|BAA74839.1)

 

ATGTCTTCAGATCGGAAGGTTCTAAGTTTTGAAGAAGTTTCAAAGCACAACAAAACTAAGGATTGTTGGCTTATTATTTCCGGCAAGGTGTATGATGTGACTCCATTCATGGATGATCATCCTGGAGGCGATGAAGTCTTGTTGTCCTCAACAGGGAAAGATGCTACAAATGATTTTGAAGACGTTGGTCACAGCGACACTGCAAGGGACATGATGGACAAATATTTCATTGGTGAGATTGATTCGTCTAGTGTTCCAGCAACTAGGACATACGTTGCACCACAGCAACCAGCCTACAACCAAGACAAGACACCAGAATTCATTATCAAGATTCTTCAGTTCCTTGTTCCGATCTTGATCTTGGGATTGGCTCTTGTCGTCCGTCACTATACCAAGAAAGACTAG

 

1

 

68418.m06655 cytochrome b5 isoform 1 identical to SP|Q42342 Cytochrome b5 isoform 1 [Arabidopsis thaliana]

 

MSSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTKKD*

 

25803

 

AT2G46650

GO:0005575|GO:0006118|GO:0020037|GO:0046914

NULL

b5 #1

Show
AT2G46650

AT2G46650

 

GO:0005575|GO:0006118|GO:0020037|GO:0046914

 

NULL

 

Cytochrome b5

 

Cytochromes b5

 

b5 #1

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

19

 

0

 

0

 

0

 

0

 

1

 

14

 

0

 

2

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

4

 

14

 

0

 

t3a4 putative cytochrome b5

 

ATGGCGAATCTAATTTCGTTTCACGATGTGGCTAAACATAAGTGCAAGAACGATTGTTGGATTCTCATCCATGGAAAGGTCTATGACATCAGCACTTTCATGGACGAACATCCCGGAGGTGACAATGTTCTCCTCGCCGTCACCGGGAAAGACGCGTCGATCGATTTCGAAGATGTGAACCATAGCAAAGATGCCAAGGAGCTAATGAAGAAATACTGTATCGGTGACGTTGACCAGTCAACGGTTCCGGTGACGCAACAGTATATTCCGCCGTGGGAGAAGGAATCTACGGCGGCGGAAACAACTAAAGAAGAATCTGGAAAGAAGCTGCTTATCTACTTAATTCCTCTCTTGATACTCGGCGTTGCTTTCGCTCTCAGATTCTACAACAACAAGTAG

 

1

 

68415.m05820 cytochrome b5, putative similar to cytochome b5 GI:2695711 from [Olea europaea]

 

MANLISFHDVAKHKCKNDCWILIHGKVYDISTFMDEHPGGDNVLLAVTGKDASIDFEDVNHSKDAKELMKKYCIGDVDQSTVPVTQQYIPPWEKESTAAETTKEESGKKLLIYLIPLLILGVAFALRFYNNK*

 

11274

 

AT3G56190

GO:0005794|GO:0005783|GO:0005483|GO:0006886|GO:0006886|GO:0005794|GO:0005783|GO:0005483|GO:0006886|GO:0006886

NULL

alpha-SNAP2

Show
AT3G56190

AT3G56190

 

GO:0005794|GO:0005783|GO:0005483|GO:0006886|GO:0006886|GO:0005794|GO:0005783|GO:0005483|GO:0006886|GO:0006886

 

NULL

 

NSF and SNAP Proteins

 

alpha-SNAP Gene Family

 

alpha-SNAP2

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

155

 

92

 

103

 

183

 

53

 

15

 

35

 

51

 

54

 

72

 

70

 

56

 

54

 

47

 

1

 

151

 

0

 

2

 

1

 

1

 

183

 

109

 

120

 

215

 

64

 

17

 

41

 

65

 

62

 

80

 

89

 

63

 

60

 

52

 

1

 

202

 

bs_c_26 alpha-soluble NSF attachment protein

 

ATGGGGGATCATCTGGTGAGAGCTGAGGAATTCGAGAAGAAAGCTGAGAAAAAGCTCAATGGATGGGGAATATTCGGATCTAAGTACGAGGATGCTGCTGATCTGCTCGAAAAAGCAGCTAATTCCTATAAGCTCGCCAAATCATGGGATCAAGCTGGAAAAGCTTATCTAAAACTTGCCGACTGTCACTTAAAGTCAGATAGCAAACATGATGCTGCTAACGCCTATGCTGAGGCTGCTAAATGCTACAAGAAAGTTGACACTAATGAGGCTGCGTCTTGCCTAGAGCGAGCGGTGAATATATTTTGTGAGATAGGAAGGCTCAACATGGCTGCAAGATATTACAAGGAAATTGCTGAGTATTATGAATCTGATCAGAAGTTCGAGCAGGCTATTGCTTACTTTGAAAAGGCAGCTGAATTCTTTCAGAATGAAGAAGTGACCACTTCTGCAAACCAGTGCAATCTAAAGGTTGCGCAATATGCCGCCCAGCTGGAGCAGTATGAGAAGGCAATCAAGATTTATGAAGACATAGCACGCCATTCACTCAACAATAACTTGCTCAAGTATGGAGTTAAGGGCCATCTTCTCACTGCTGGCATGTGCCACTTATGCAAAGCCGATGTTGTTTCCATCACTAACGCTCTGGAGAAGTATCAGGATCTGGATCCAACTTTTACTGGAACACGGGAATGCAAGTTCTTAGCGGACCTTGCTTCTGCTATCGATGAAGAAGACATCGCAAAGTTCACAGATGTTGTCAAGGAGTTTGATAGCATGACTCCACTGGATTCATGGAAGACAACCATGTTGTTGAGGGTGAAGGAGAAGCTCAAGGCCAAGGAGCTAGAGGAGGATGACCTTACATAG

 

1

 

68416.m06245 alpha-soluble NSF attachment protein 2 / alpha-SNAP2 / ASNAP2 identical to alpha-soluble NSF attachment protein 2 / alpha-SNAP2 SP:Q9SPE6 from [Arabidopsis thaliana]

 

MGDHLVRAEEFEKKAEKKLNGWGIFGSKYEDAADLLEKAANSYKLAKSWDQAGKAYLKLADCHLKSDSKHDAANAYAEAAKCYKKVDTNEAASCLERAVNIFCEIGRLNMAARYYKEIAEYYESDQKFEQAIAYFEKAAEFFQNEEVTTSANQCNLKVAQYAAQLEQYEKAIKIYEDIARHSLNNNLLKYGVKGHLLTAGMCHLCKADVVSITNALEKYQDLDPTFTGTRECKFLADLASAIDEEDIAKFTDVVKEFDSMTPLDSWKTTMLLRVKEKLKAKELEEDDLT*

 

16076

 

AT3G56450

GO:0005794|GO:0005783|GO:0005483|GO:0006886|GO:0006886

NULL

alpha-SNAP1

Show
AT3G56450

AT3G56450

 

GO:0005794|GO:0005783|GO:0005483|GO:0006886|GO:0006886

 

NULL

 

NSF and SNAP Proteins

 

alpha-SNAP Gene Family

 

alpha-SNAP1

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

15

 

0

 

6

 

3

 

1

 

2

 

22

 

1

 

3

 

21

 

0

 

1

 

0

 

3

 

0

 

55

 

0

 

4

 

1

 

1

 

15

 

0

 

5

 

3

 

1

 

3

 

24

 

2

 

4

 

23

 

0

 

0

 

0

 

3

 

0

 

57

 

bs_c_28 alpha-soluble NSF attachment like protein

 

ATGTTTTTTGTAAAAGGTGAGGGTTTTTTTTACCCACTTTTCATAGAGCTGAGGAACTTGATAAGATATCAAACAACAAGAGTCTCCAACTCAAGCAGAGACTTCAATCTCTCACAACAACACTGCAGCTGTTTCAGGCCCAAAAGGAGACACGAAGCCCATCTCTCATTCATCGGAACTCTGCAATACTCAAAACAGAGAACCATCACGCGAGCCGCTTCAGCTACCATCGCTCGCCGCCAACTCTTGTTGTTGTTTGATATCACTTTCTCTTCTTCAAGCAGTTGCTACTACTTTCAGAAGAAAGCTGAGAAGAAGCTTAACAGACGGAGAAGATTCGACACTAAGTACGAGGATGCTGCTGATCTGCTCGAGAAAGCACGTGATTCCTATAAGCTTGCCAAATCATGGGATCAAGCTGGAATAGCTTATCTAAAACTTGCCGATTGTCACTTAAAGGCAAATTCTTTGGCAAACACATATATGATAATGGACGAATGTATGGATCATGAAATTGCTGAGTATTATGAATCTGATGAGATGTTCGAGCAAGCTATTGCTTACTATGAAACGGCAGCTGAATTCTTTCAAATAGAAGAAGTGACCACCTCTGCAAACCAGTGCAATCTAAAGGTTGCACAATATGCTTCCCAGCTAGAGCAGCAATCCAGATTTATGAAGACACAGGCACGCCATTCACTCAACAATAAGTTGCTTAAGTATGGAGTTAAAGGCCATCTTCTCACTGCTGGCATGTGCCACTTATGCAAAGCTGATGTTGTTTCCATCACTAATGCACTGGAGAAATATCAGGATCTGGATCCGACTTTTTCAGGAACACGGGAATGCAAGTTCTTAGCGGACCTTGCTTCTGCTATCGATGAAGAAGACATTGCAAAGTTCACAGACGTTTCCAAGGAAATTGATAGCGTGAGTCCACTGGTATGGGCAGTAAACCACATGCAACTATTTGGATGTAAACTCTGTCTGGTTCTTGATCATGACAACAATGTTGTTGAGGGTAAAAGAGAAGTTCAAGGCCAGGGAGCTGGAGGAGGATGCAAGCTTTACTTGATTGAAGGAAAATGTATTCTTGATTGGAACAATGTATATACAAAAAGGATTTATAACTACACTAATTTCTAG

 

1

 

68416.m06278 alpha-soluble NSF attachment protein 1 / alpha-SNAP1 (ASNAP1) identical to alpha-soluble NSF attachment protein 1 (Alpha-SNAP1) (N- ethylmaleimide-sensitive factor attachment protein, alpha 1) (Swiss-Prot:Q9LXZ5) [Arabidopsis thaliana]

 

MFFVKGEGFFYPLFIELRNLIRYQTTRVSNSSRDFNLSQQHCSCFRPKRRHEAHLSFIGTLQYSKQRTITRAASATIARRQLLLLFDITFSSSSSCYYFQKKAEKKLNRRRRFDTKYEDAADLLEKARDSYKLAKSWDQAGIAYLKLADCHLKANSLANTYMIMDECMDHEIAEYYESDEMFEQAIAYYETAAEFFQIEEVTTSANQCNLKVAQYASQLEQQSRFMKTQARHSLNNKLLKYGVKGHLLTAGMCHLCKADVVSITNALEKYQDLDPTFSGTRECKFLADLASAIDEEDIAKFTDVSKEIDSVSPLVWAVNHMQLFGCKLCLVLDHDNNVVEGKREVQGQGAGGGCKLYLIEGKCILDWNNVYTKRIYNYTNF*

 

16100