KATANA_ID GO Definiton GeneName

AT1G71880

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0009624|GO:0005886|GO:0008506

NULL

AtSUC1|NULL

Show
AT1G71880

AT1G71880

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0009624|GO:0005886|GO:0008506

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC1|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

3

 

132

 

52

 

0

 

26

 

276

 

69

 

34

 

255

 

369

 

249

 

37

 

303

 

280

 

229

 

43

 

0

 

2

 

1

 

1

 

1

 

139

 

58

 

0

 

26

 

314

 

81

 

38

 

287

 

412

 

267

 

38

 

316

 

305

 

315

 

0

 

F17M19 sucrose transport protein SUC1

 

ATGGGAGCCTATGAAACAGAAAAACCAACTAAAGATGCGGCGGCTCTAGAGACACAGTCGCCGGAAGATTTCGATCAACCATCTCCGCTTCGTAAAATCATCTCCGTCGCTTCCATCGCCGCCGGTGTACAGTTCGGGTGGGCCTTACAGCTCTCTCTTCTTACTCCGTACGTTCAACTCCTCGGAATCCCTCACAAATGGTCATCTCTCATTTGGCTCTGTGGTCCAGTCTCCGGCATGATTGTTCAACCAATCGTCGGTTTCCACAGTGACCGATGTAGGTCCAAATTTGGTCGCCGTCGTCCTTTCATCGCCACCGGAGCCGCACTCGTCGCCGTCGCTGTTTTCCTCATCGGTTACGCTGCGGATTTCGGTTATAAAATGGGAGATAAACTCGAGGAGAAGGTTAAAGTTCGAGCTATAGGGATCTTTGCTCTCGGGTTCTGGATCCTCGACGTAGCCAACAACACCTTACAAGGACCTTGCCGTGCTTTCTTAGCCGACTTAGCCGCCGGTGACGCTAAGAGAACGCGAGTCGCAAACGCGTTTTTCTCTTTTTTTATGGCGGTTGGAAACGTTTTGGGTTATGCGGCTGGTTCGTACACTAACCTCCACAAGATGTTTCCGTTCACAATGACAAAAGCTTGCGATATCTATTGCGCCAATCTCAAGACTTGTTTCTTCTTATCCATCACTCTCCTCCTCATCGTCACCGTCACGTCTCTTTGGTACGTTAATGACAAACAATGGTCTCCGCCGCCGCGAAATGCCGACGACGACGAGAAGACCTCAAGCGTTCCTTTGTTCGGTGAAATCTTTGGAGCATTCAAAGTCATGAAACGTCCCATGTGGATGCTTCTAATCGTCACGGCCTTAAACTGGATCGCTTGGTTCCCATTTCTTTTGTTCGATACTGATTGGATGGGTCGTGAAGTGTTCGGTGGAGATTCAGATGGAAATGAACGATCGAAGAAACTATACAGTCTTGGAGTCCAATCTGGTGCAATGGGATTGATGTTTAACTCTATAGTTCTTGGTTTCATGTCACTTGGTGTTGAATGGATTGGTCGGAAATTAGGAGGAGCTAAACGGCTTTGGGGTATTGTCAATTTCATCCTAGCCGCTGGTTTGGCCATGACGGTTCTCGTTACGAAATTCGCCGAGGATCACCGGAAAACCGCCGGTGATTTAGCCGGACCGAGCGCTAGTGTTAAAGCTGGAGCTTTAAGTCTCTTTGCTGTTCTTGGTATCCCATTAGCTATTACTTTCAGTACTCCTTTTGCTCTAGCATCCATATTCTCAAGCTGCTCCGGTGCAGGCCAAGGACTTTCATTAGGAGTTTTAAATTTGGCGATTGTGATACCACAAATGATAGTCTCACTAGGAGGTGGACCTTTCGACGCCTTGTTCGGCGGTGGAAACTTACCGGCGTTTATCGTTGCAGCAATTGCAGCGGCGATTAGTGGAGTATTAGCGTTAACCGTTTTACCTTCACCACCACCGGACGCACCCAAGGCAACGACCATGGGAGGATTCCACTAG

 

1

 

68414.m08310 sucrose transporter / sucrose-proton symporter (SUC1) identical to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094

 

MGAYETEKPTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYAADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVNDKQWSPPPRNADDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKFAEDHRKTAGDLAGPSASVKAGALSLFAVLGIPLAITFSTPFALASIFSSCSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFIVAAIAAAISGVLALTVLPSPPPDAPKATTMGGFH*

 

6213

 

AT1G22710

GO:0016020|GO:0005886|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0005886|GO:0008506|GO:0009915

NULL

AtSUC2|NULL

Show
AT1G22710

AT1G22710

 

GO:0016020|GO:0005886|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0005886|GO:0008506|GO:0009915

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC2|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

5

 

57

 

48

 

0

 

53

 

61

 

117

 

217

 

176

 

36

 

54

 

210

 

67

 

310

 

113

 

0

 

0

 

4

 

1

 

1

 

5

 

59

 

32

 

0

 

30

 

58

 

116

 

226

 

176

 

35

 

29

 

176

 

67

 

306

 

108

 

0

 

T22J18 putative sucrose transport protein, SUC2

 

ATGGTCAGCCATCCAATGGAGAAAGCTGCAAATGGTGCGTCTGCGTTGGAAACGCAGACGGGTGAGTTAGATCAGCCGGAACGGCTTCGTAAGATCATATCGGTGTCTTCCATTGCCGCCGGTGTACAGTTCGGTTGGGCTTTACAGTTATCTCTGTTGACTCCTTACGTGCAGCTACTCGGAATCCCACATAAATGGGCTTCTCTGATTTGGCTCTGTGGTCCAATCTCCGGTATGCTTGTTCAGCCTATCGTCGGTTACCACAGTGACCGTTGCACCTCAAGATTCGGCCGTCGTCGTCCCTTCATCGTCGCTGGAGCTGGTTTAGTCACCGTTGCTGTTTTCCTTATCGGTTACGCTGCCGATATAGGTCACAGCATGGGCGATCAGCTTGACAAACCGCCGAAAACGCGAGCCATAGCGATATTCGCTCTCGGGTTTTGGATTCTTGACGTGGCTAACAACACCTTACAAGGACCCTGCAGAGCTTTCTTGGCTGATTTATCAGCAGGGAACGCTAAGAAAACGCGAACCGCAAACGCGTTTTTCTCGTTTTTCATGGCGGTTGGAAACGTTTTGGGTTACGCTGCGGGATCTTACAGAAATCTCTACAAAGTTGTGCCTTTCACGATGACTGAGTCATGCGATCTCTACTGCGCAAACCTCAAAACGTGTTTTTTCCTATCCATAACGCTTCTCCTCATAGTCACTTTCGTATCTCTCTGTTACGTGAAGGAGAAGCCATGGACGCCAGAGCCAACAGCCGATGGAAAAGCCTCCAACGTTCCGTTTTTCGGAGAAATCTTCGGAGCTTTCAAGGAACTAAAAAGACCCATGTGGATGCTTCTTATAGTCACTGCACTAAACTGGATCGCTTGGTTCCCTTTCCTTCTCTTCGACACTGATTGGATGGGCCGTGAGGTGTACGGAGGAAACTCAGACGCAACCGCAACCGCAGCCTCTAAGAAGCTTTACAACGACGGAGTCAGAGCTGGTGCTTTGGGGCTTATGCTTAACGCTATTGTTCTTGGTTTCATGTCTCTTGGTGTTGAATGGATTGGTCGGAAATTGGGAGGAGCTAAAAGGCTTTGGGGTATTGTTAACTTCATCCTCGCCATTTGCTTGGCCATGACGGTTGTGGTTACGAAACAAGCTGAGAATCACCGACGAGATCACGGCGGCGCTAAAACAGGTCCACCTGGTAACGTCACAGCTGGTGCTTTAACTCTCTTCGCCATCCTCGGTATCCCCCAAGCCATTACGTTTAGCATTCCTTTTGCACTAGCTTCCATATTTTCAACCAATTCCGGTGCCGGCCAAGGACTTTCCCTAGGTGTTCTGAATCTAGCCATTGTCGTCCCTCAGATGGTAATATCTGTGGGAGGTGGACCATTCGACGAACTATTCGGTGGTGGAAACATTCCAGCATTTGTGTTAGGAGCGATTGCGGCAGCGGTAAGTGGTGTATTGGCGTTGACGGTGTTGCCTTCACCGCCTCCGGATGCTCCTGCCTTCAAAGCTACTATGGGATTTCATTGA

 

1

 

68414.m02838 sucrose transporter / sucrose-proton symporter (SUC2) nearly identical to sucrose-proton symporter SUC2 [Arabidopsis thaliana] GI:407092

 

MVSHPMEKAANGASALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQAITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPDAPAFKATMGFH*

 

2312

 

AT2G02860

GO:0016020|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0005886|GO:0008515|GO:0009611|GO:0015770|GO:0015770|GO:0016020|GO:0015144|GO:0005351

NULL

AtSUC3|NULL

Show
AT2G02860

AT2G02860

 

GO:0016020|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0005886|GO:0008515|GO:0009611|GO:0015770|GO:0015770|GO:0016020|GO:0015144|GO:0005351

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC3|NULL

 

AtSUT2|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

47

 

16

 

40

 

55

 

27

 

2

 

18

 

21

 

11

 

58

 

10

 

29

 

5

 

8

 

4

 

100

 

0

 

2

 

1

 

1

 

56

 

18

 

47

 

60

 

32

 

1

 

22

 

24

 

13

 

64

 

13

 

31

 

5

 

8

 

6

 

141

 

t17m13 Sucrose transporter (suc3)

 

ATGAGTGACTCGGTGTCGATCTCGGTTCCGTATAGGAATTTGAGGAAGGAAATTGAACTTGAGACGGTCACCAAGCATCGTCAAAACGAATCTGGTTCTTCGTCGTTCTCTGAATCTGCTTCTCCTTCGAATCATTCTGATTCGGCTGATGGTGAATCTGTGTCGAAGAATTGTAGTTTAGTGACGTTGGTTCTTAGTTGTACAGTTGCCGCTGGAGTTCAATTTGGTTGGGCATTGCAACTTTCTCTTCTTACTCCTTATATTCAGACCCTTGGAATATCGCATGCTTTTTCTTCGTTTATTTGGCTGTGCGGCCCAATTACAGGCCTTGTGGTCCAGCCTTTTGTTGGCATTTGGAGTGATAAATGTACTTCAAAGTATGGAAGAAGACGACCATTTATTCTAGTTGGATCATTCATGATCTCAATAGCAGTGATAATAATCGGATTTTCTGCAGACATTGGGTATCTGTTAGGAGATTCAAAGGAACATTGCAGTACTTTCAAAGGCACACGAACCAGGGCAGCTGTTGTCTTTATCATTGGGTTTTGGTTGTTGGATCTAGCAAACAATACAGTACAGGGACCTGCTCGTGCTCTTCTAGCTGATCTATCAGGTCCTGATCAGCGGAATACTGCAAATGCTGTGTTCTGCTTGTGGATGGCTATTGGGAACATCCTTGGGTTTTCTGCCGGTGCTAGCGGAAAATGGCAAGAATGGTTCCCTTTTTTAACTAGTAGAGCATGTTGTGCTGCATGTGGAAATCTCAAAGCAGCGTTTCTTCTTGCAGTGGTCTTTCTCACTATATGTACTCTTGTCACAATCTATTTTGCTAAAGAGATTCCTTTTACAAGCAACAAGCCCACCCGCATACAAGATTCTGCACCTTTGTTGGATGATCTCCAGTCCAAAGGCCTTGAGCATTCAAAATTAAATAATGGTACTGCCAATGGAATCAAGTATGAGAGAGTGGAACGTGATACGGATGAACAGTTTGGCAATTCAGAGAATGAGCATCAAGATGAGACCTACGTTGATGGCCCTGGATCTGTTTTAGTGAATTTGCTAACTAGTTTAAGGCATTTGCCACCGGCTATGCACTCAGTTCTTATCGTCATGGCTCTTACATGGTTATCCTGGTTCCCCTTCTTTCTGTTCGATACAGATTGGATGGGAAGAGAAGTTTACCATGGGGATCCAACAGGAGATAGTTTGCATATGGAACTCTATGATCAAGGTGTACGTGAAGGTGCACTTGGTTTGCTACTAAACTCTGTTGTTCTTGGGATCAGCTCATTTCTCATTGAACCAATGTGTCAGCGGATGGGTGCTCGGGTTGTATGGGCTTTGAGCAATTTTACTGTATTTGCCTGCATGGCGGGAACAGCTGTAATCAGCTTGATGTCTCTCAGTGATGACAAAAATGGAATTGAATACATAATGCGTGGAAACGAAACAACAAGAACCGCAGCCGTAATCGTTTTTGCACTCCTTGGTTTTCCCCTAGCTATCACATACAGTGTCCCTTTCTCTGTCACAGCAGAAGTCACTGCTGATTCCGGTGGCGGTCAAGGTTTGGCTATAGGAGTGTTGAATCTCGCAATCGTTATTCCCCAGATGATAGTATCACTTGGAGCGGGTCCATGGGATCAATTGTTTGGAGGAGGAAACTTACCGGCGTTTGTTTTGGCGTCTGTTGCTGCTTTCGCTGCTGGAGTTATTGCATTGCAAAGGCTTCCCACGCTATCGAGTTCTTTCAAGTCCACCGGTTTCCACATCGGCTAA

 

2

 

68415.m00235 sucrose transporter / sucrose-proton symporter (SUC3) identical to sucrose transporter [Arabidopsis thaliana] GI:8052190; similar to sucrose transporters from [Oryza sativa (japonica cultivar-group)] GI:2723471, [Zea mays] GI:5771354, [Triticum aestivum] GI:19548165; contains Pfam profile PF00083: major facilitator superfamily protein

 

MYFKVWKKTTIYSSWIIHDLNSNIGYLLGDSKEHCSTFKGTRTRAAVVFIIGFWLLDLANNTVQGPARALLADLSGPDQRNTANAVFCLWMAIGNILGFSAGASGKWQEWFPFLTSRACCAACGNLKAAFLLAVVFLTICTLVTIYFAKEIPFTSNKPTRIQDSAPLLDDLQSKGLEHSKLNNGTANGIKYERVERDTDEQFGNSENEHQDETYVDGPGSVLVNLLTSLRHLPPAMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPTGDSLHMELYDQGVREGALGLLLNSVVLGISSFLIEPMCQRMGARVVWALSNFTVFACMAGTAVISLMSLSDDKNGIEYIMRGNETTRTAAVIVFALLGFPLAITYSVPFSVTAEVTADSGGGQGLAIGVLNLAIVIPQMIVSLGAGPWDQLFGGGNLPAFVLASVAAFAAGVIALQRLPTLSSSFKSTGFHIG*

 

7332

 

AT1G09960

GO:0016020|GO:0005773|GO:0005773|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0015770|GO:0005886|GO:0008515

NULL

AtSUC4|NULL

Show
AT1G09960

AT1G09960

 

GO:0016020|GO:0005773|GO:0005773|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0015770|GO:0005886|GO:0008515

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC4|NULL

 

AtSUT4|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

35

 

11

 

4

 

13

 

40

 

4

 

3

 

9

 

2

 

0

 

1

 

0

 

0

 

1

 

0

 

0

 

0

 

2

 

1

 

1

 

38

 

14

 

0

 

7

 

47

 

4

 

3

 

7

 

2

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

F21M12 putative sucrose/H+ symporter

 

ATGGCTACTTCCGATCAAGATCGCCGTCACAGAGTCACTCGCAACCGTCCACCAATAGCTCGACCCTCTACTTCTTCATCTCGTCCCGTTGTATCTCCTCCTAGATCAAAAGTTTCGAAGCGTGTGCTTCTCCGTGTAGCTTCCGTCGCATGCGGGATTCAATTCGGATGGGCTCTTCAGCTTTCTCTCCTCACACCTTACGTTCAAGAGCTGGGGATCCCACACGCTTGGGCTAGTGTGATTTGGCTTTGCGGTCCTCTCTCTGGTTTGTTCGTGCAACCGCTCGTTGGGCATAGTAGCGATAGGTGTACTAGTAAGTACGGTCGTCGGAGACCGTTTATTGTCGCCGGAGCTGTGGCGATTTCTATCTCTGTTATGGTTATTGGTCATGCGGCGGATATTGGATGGGCATTTGGGGATAGAGAAGGGAAGATTAAGCCGAGGGCGATTGTTGCTTTTGTTTTAGGGTTTTGGATTCTTGATGTTGCTAATAATATGACTCAAGGTCCTTGTAGAGCTCTCCTTGCTGATCTTACTGAGAATGATAATCGCAGAACCCGAGTTGCAAATGGCTACTTCTCTCTCTTTATGGCTGTTGGCAATGTTCTTGGCTATGCTACTGGATCATACAATGGTTGGTACAAGATCTTCACTTTTACGAAGACAGTTGCATGTAATGTGGAATGTGCCAATCTCAAGTCTGCCTTCTACATAGATGTTGTCTTTATTGCAATAACTACGATCCTAAGCGTCTCAGCGGCTCATGAGGTGCCACTTGCTTCATTGGCTTCTGAAGCACATGGGCAAACCAGTGGAACAGACGAAGCTTTTCTTTCTGAGATATTTGGAACTTTCAGATATTTTCCAGGAAATGTTTGGATAATCTTGCTTGTTACAGCATTGACATGGATTGGTTGGTTTCCATTTATTCTGTTTGATACTGATTGGATGGGTCGAGAGATCTATGGCGGTGAACCGAACATAGGGACTTCATATAGTGCTGGGGTCAGTATGGGTGCACTTGGTTTGATGTTGAATTCTGTTTTTCTTGGAATCACTTCTGTGCTCATGGAGAAACTTTGCAGAAAGTGGGGGGCTGGTTTTGTTTGGGGAATATCAAATATCTTAATGGCTATTTGCTTTCTTGGAATGATAATCACCTCATTTGTTGCGTCTCACCTTGGCTACATTGGCCATGAACAACCTCCTGCCAGCATCGTGTTTGCTGCTGTGTTAATCTTTACAATTCTGGGCATTCCATTGGCGATAACTTACAGCGTCCCATATGCGTTGATTTCCATACGTATTGAATCCCTGGGCTTAGGTCAAGGCTTATCTTTGGGTGTGCTAAATTTGGCGATAGTCATCCCACAGGTAATTGTGTCTGTTGGCAGTGGCCCATGGGATCAACTGTTTGGAGGTGGGAATTCACCGGCACTTGCAGTAGGAGCAGCTACAGGCTTCATTGGCGGAATTGTAGCTATCTTGGCTCTTCCACGGACAAGGATTCAGAAGCCCATCCCTCTCCCATGA

 

1

 

68414.m01122 sucrose transporter / sucrose-proton symporter (SUT4) nearly identical to sucrose transporter SUT4 [Arabidopsis thaliana] GI:9957053

 

MATSDQDRRHRVTRNRPPIARPSTSSSRPVVSPPRSKVSKRVLLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWASVIWLCGPLSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVAISISVMVIGHAADIGWAFGDREGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTENDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDVVFIAITTILSVSAAHEVPLASLASEAHGQTSGTDEAFLSEIFGTFRYFPGNVWIILLVTALTWIGWFPFILFDTDWMGREIYGGEPNIGTSYSAGVSMGALGLMLNSVFLGITSVLMEKLCRKWGAGFVWGISNILMAICFLGMIITSFVASHLGYIGHEQPPASIVFAAVLIFTILGIPLAITYSVPYALISIRIESLGLGQGLSLGVLNLAIVIPQVIVSVGSGPWDQLFGGGNSPALAVGAATGFIGGIVAILALPRTRIQKPIPLP*

 

999

 

AT1G71890

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0048316

NULL

AtSUC5|NULL

Show
AT1G71890

AT1G71890

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0048316

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC5|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

0

 

2

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

1

 

0

 

0

 

F17M19 putative sucrose transport protein

 

ATGGGAGCCTTGGAAGCAGAAAGAGCCGCCAACAATGCTACGGCGTTAGAGACACAGTCGTCACCGGAAGATCTCGGTCAACCATCTCCTCTGCGTAAGATCATCTCCGTCGCTTCAATCGCCGCCGGTGTACAGTTCGGGTGGGCCTTACAGCTTTCTCTTCTGACTCCTTACATACAACTCCTCGGGATCCCTCACAAATGGTCGTCTTACATGTGGCTTTGTGGTCCTATCTCCGGCATGATTGTTCAACCGATCGTCGGTTACCACAGTGACCGATGCGAGTCCAGATTCGGTCGCCGTCGTCCTTTCATTGCCGCCGGAGTCGCACTCGTAGCCGTCTCGGTTTTCCTTATCGGATTCGCGGCGGATATGGGACATAGTTTTGGAGATAAACTCGAGAACAAGGTAAGGACTCGAGCCATTATAATCTTCCTAACCGGGTTTTGGTTCCTCGACGTGGCTAACAACACCTTACAAGGACCATGCCGTGCTTTCTTAGCCGATTTAGCCGCCGGAGACGCTAAAAAAACGCGAGTCGCAAACGCGTGTTTCTCCTTCTTTATGGCGGTTGGAAACGTTTTGGGTTACGCTGCTGGATCTTACACTAACCTTCACAAAATGTTTCCTTTCACAATGACAAAAGCTTGCGACATCTATTGTGCGAATCTCAAGACTTGTTTCTTCTTATCCATCACTCTCCTCCTTATCGTCACATTCTCGTCTCTATGGTACGTTAAAGACAAACAATGGTCTCCACCTCAAGGAGACAAGGAGGAGAAAACATCAAGTCTTTTTTTCTTTGGAGAAATCTTTGGAGCTGTTAGACACATGAAACGTCCCATGGTGATGCTTCTAATTGTCACGGTCATTAATTGGATCGCTTGGTTTCCATTTATTTTGTATGATACCGATTGGATGGGTCGTGAAGTGTACGGTGGAAACTCAGATGGAGATGAACGATCGAAGAAACTTTACGACCAAGGAGTTCAGGCTGGTGCATTGGGATTGATGTTTAATTCTATACTTCTTGGTTTCGTGTCACTTGGTGTTGAATCGATTGGTCGGAAAATGGGAGGAGCTAAACGACTTTGGGGATGTGTGAATTTCATACTCGCCATAGGTTTGGCCATGACGGTTCTTGTTACTAAATCGGCTGAGCATCACCGGGAAATCGCCGGTCCTTTAGCCGGACCGAGCAGTGGTATTAAAGCCGGAGTATTTAGTCTCTTTACCGTTCTTGGTATCCCATTGGCCATTACTTACAGTATTCCATTTGCACTAGCGTCCATTTTCTCAACCAATTCCGGTGCCGGCCAAGGACTTTCATTAGGCGTTTTAAATATAGCGATTTGTATACCACAAATGATAGTATCATTCTCAAGTGGACCATTGGACGCTCAATTCGGCGGTGGAAACCTACCTTCATTTGTGGTCGGAGCAATTGCCGCGGCGGTTAGTGGAGTCTTAGCGTTAACCGTTTTACCTTCACCGCCTCCGGACGCACCAGCCATGTCAGGGGCTATGGGATTCCATTAG

 

1

 

68414.m08311 sucrose transporter / sucrose-proton symporter (SUC5) nearly identical to sucrose transporter [Arabidopsis thaliana] GI:12057172

 

MGALEAERAANNATALETQSSPEDLGQPSPLRKIISVASIAAGVQFGWALQLSLLTPYIQLLGIPHKWSSYMWLCGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTFSSLWYVKDKQWSPPQGDKEEKTSSLFFFGEIFGAVRHMKRPMVMLLIVTVINWIAWFPFILYDTDWMGREVYGGNSDGDERSKKLYDQGVQAGALGLMFNSILLGFVSLGVESIGRKMGGAKRLWGCVNFILAIGLAMTVLVTKSAEHHREIAGPLAGPSSGIKAGVFSLFTVLGIPLAITYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLPSFVVGAIAAAVSGVLALTVLPSPPPDAPAMSGAMGFH*

 

6214

 

AT5G43610

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810

NULL

AtSUC6|NULL

Show
AT5G43610

AT5G43610

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC6|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

K9D7 sucrose transporter protein

 

ATGAGTGACCTCCAAGCAAACAAAGATGCAGCGGCTGTGAATAGACAGTCTTCCTCGTCGTCGGCGGATCTTAATGGGCCATCTCCGATGAGAAAGATGATATCGGTGGCTTCTATTGCCGCCGGTATTCAGTTCGGTTGGGCTCTTCAGCTGTCTCTGCTAACTCCATACGTGCAGCTTCTTGGAGTCCCACACAAATGGTCATCTTTCATATGGCTCTGTGGTCCTGTCTCCGGCCTGCTTGTCCAGCCATCCGTCGGTTACTTCAGCGACCGATGCAAGTCAAGATTCGGTCGTCGTCGTCCTTTCATCGCTATGGGCGCCTTACTTGTCGCCGTTGCTGTCGTACTAATCGGATACGCGGCTGATTTCGGTCACAGCATGGGAGACAAAGTCGACGAACCTGTCAAGATGCGAGCCGTAGTTATCTTCGCTCTCGGTTTCTGGATCCTTGACGTGGCTAACAACACTCTCCAAGGACCTTGCCGCGCATTCCTTGGTGATTTAGCAGCTGGAGACGCTAAGAAAACACGAACAGCAAACGCATTTTTCTCCTTCTTCATGGCTGTTGGAAATGTTTTGGGATATGCGGCCGGATCGTACACTAACCTCTACAAGATCTTCCCTTTCACAATGACTAAAGCATGCGACATCTATTGCGCAAATCTCAAGAGCTGTTTCTTCCTTTCCATCACTCTCCTCCTAGTCGTCACCATCATAGCTCTTTGGTACGTGGAAGACAAGCAATGGTCGCCTAAGGCAGATTCCGACAACGAGAAAACTCCATTCTTTGGTGAAATCTTTGGAGCTTTCAAGGTGATGAAACGTCCAATGTGGATGCTATTAATCGTCACGGCCTTGAACTGGATCGCATGGTTCCCTTTTCTTTTGTACGATACTGATTGGATGGGTCGTGAGGTGTACGGTGGAGACTCAAAAGGAGATGACAAAATGAAGAAACTATACAACCAAGGAATTCACGTTGGTGGGTTGGGATTGATGCTTAACTCTATCGTTCTTGGATTCATGTCACTTGGTATTGAAGGTATTAGTAGGAAAATGGGAGGAGCTAAAAGGCTTTGGGGAGCTGTGAATATCATCCTCGCCGTGTGTTTGGCAATGACGGTTTTGGTTACTAAAAAGGCAGAGGAGCACCGGAGAATCGCCGGTCCGATGGCCCTTCCTACTGATGGCATCAGAGCTGGAGCATTGACTCTCTTTGCCCTTCTTGGAATTCCTCTTGCTATTACATTTAGTATTCCGTTCGCGCTAGCTTCCATAATCTCTAGCAGCTCCGGTGCCGGTCAAGGACTCTCTCTAGGCGTTTTAAACATGACAATAGTGATACCACAAATGGTTGTATCATTTGGAGTTGGTCCTATTGATGCGTTATTTGGAGGTGGGAATTTACCAGGATTTGTGGTTGGAGCTATTGCAGCGGCAATCAGCAGTGTTGTGGCATTTTCCGTTTTACCATAA

 

1

 

68418.m05331 sucrose transporter-related / sucrose-proton symporter-related similar to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094, sucrose transporter [Arabidopsis thaliana] GI:12057172; contains Pfam profile PF00083: major facilitator superfamily protein

 

MSDLQANKDAAAVNRQSSSSSADLNGPSPMRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCKSRFGRRRPFIAMGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGGLGLMLNSIVLGFMSLGIEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRIAGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMTIVIPQMVVSFGVGPIDALFGGGNLPGFVVGAIAAAISSVVAFSVLP*

 

24707

 

AT1G66570

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810|GO:0016020|GO:0015144|GO:0005351|GO:0015770|GO:0006810|GO:0016020|GO:0015144|GO:0005351|GO:0015770|GO:0006810

NULL

AtSUC7|NULL

Show
AT1G66570

AT1G66570

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810|GO:0016020|GO:0015144|GO:0005351|GO:0015770|GO:0006810|GO:0016020|GO:0015144|GO:0005351|GO:0015770|GO:0006810

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC7|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

T12I7 hypothetical protein

 

ATGAGTGACCTCCAAGCAAACAAAGATGAGACGACTGTGGATAGACAGTCTTCCTCGTCGGTGGATCTTGATGGGCCATCTCCGCTGAGAAAGATGATATCGGTGGCTTCTATTGCTGCCGGTATTCAGTTTGGTTGGGCTCTTCAACTGTCTCTGCTTACTCCATACGTGCAGCTTCTTGGAGTCCCACACAAATGGCCATCTTTCATTTGGCTTTGCGGTCCTGTCTCCGGCTTGCTTGTCCAGCCATCAGTCGGTTACTTCAGCGACCGATGCACGTCAAGATTCGGACGTCGTCGTCCTTTCATCGCCACGGGTGCTTTGCTGGTCGCTGTTTCTGTTGTACTAATCGGATATGCGGCTGATTTCGGCCACAGCATGGGAGACAAAATCGACAAACCTGTCAAGATGCGAGCCGTTGTTATCTTCGCTCTCGGGTTCTGGATCCTTGACGTGGCTAACAACACTCTCCAAGGACCATGCCGTGCTTTTCTTGGTGATTTAGCAGCTGGAGACGCTCAGAAAACGCGAACGGCAAACGCGTTTTTCTCTTTCTTCATGGCCGTTGGAAACGTTTTGGGATATGCGGCAGGATCGTACACTAACCTCTACAAGATCTTCCCTTTCACAATGACTAAAGCGTGCGACATATATTGCGCAAATCTCAAGAGTTGTTTCTTCCTTTCCATCACTCTCCTCCTAGTCGTCACCATCATAGCTCTATGGTACGTGGAAGACAAGCAATGGTCGCCTAAGGCAGACTCCGACAACGAGAAAACTCCGTTCTTCGGTGAGATCTTTGGAGCTTTCAAGGTAATGAAACGTCCAATGTGGATGCTACTAATCGTCACGGCCTTGAACTGGATCGCATGGTTCCCTTTTCTTTTATACGATACTGATTGGATGGGTCGTGAAGTGTATGGTGGAGACTCAAAAGGAGATGACAAAATGAAGAAACTATACAACCAAGGAATTCATGTTGGTGCATTGGGATTGATGCTTAACTCTATCGTTCTTGGAGTCATGTCACTTGGTATTGAAGGTATTAGTAGGAAGATGGGAGGAGCTAAAAGGCTTTGGGGAGCTGTGAATATTATTCTCGCCGTGTGTTTGGCAATGACGGTTTTGGTTACTAAAAAGGCGGAGGAGCACCGGAGAATCGCCGGTCCAATGGCCCTTCCTACCGATGGCATCAGAGCTGGAGCATTGACTCTCTTTGCTCTTCTTGGAATTCCTCTTGCTATTACATTCAGTATTCCGTTCGCACTAGCTTCTATAATATCAAGCAGCTCCGGCGCCGGTCAAAGACTTTCTCTAGGAGTTTTAAACATGGCAATTGTCATACCACAAATGATTGTATCGTTTGGAGTTGGTCCTATTGATGCGTTATTTGGAGATGGAAACTTACCAGGATTTGTGGTCGGAGCTATTGCAGCGGCAGTCAGCAGTATTGTGGCATTTACCGTTTTACCTTAA

 

1

 

68414.m07564 sucrose transporter, putative / sucrose-proton symporter, putative similar to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094, sucrose transporter [Arabidopsis thaliana] GI:12057172; contains Pfam profile PF00083: major facilitator superfamily protein

 

MSDLQANKDETTVDRQSSSSVDLDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGVMSLGIEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRIAGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQRLSLGVLNMAIVIPQMIVSFGVGPIDALFGDGNLPGFVVGAIAAAVSSIVAFTVLP*

 

5670

 

AT2G14670

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810

NULL

AtSUC8|NULL

Show
AT2G14670

AT2G14670

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC8|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

t6b13 putative sucrose-proton symporter

 

ATGAGTGACCTCCAAGCAAAAAACGATGTGGTAGCTGTAGATAGACAGTCTTCCTCGTCGTTGGCGGATCTTGATGGACCATCTCCGCTGAGAAAGATGATATCAGTGGCTTCTATTGCCGCCGGTATTCAGTTCGGTTGGGCTCTTCAGCTGTCTCTGCTAACTCCATACGTGCAGCTTCTTGGAGTCCCACACAAATGGTCATCTTTCATATGGCTATGTGGTCCTGTCTCTGGTCTTCTTGTCCAGCCATCCGTCGGTTACTTCAGCGACCGATGCACGTCAAGATTCGGACGTCGTCGTCCTTTCATCGCCACAGGCGCCTTGCTTGTAGCTGTTGCTGTTGTACTAATCGGATACGCAGCTGATTTTGGCCACAGCATGGGAGACAAAATCGACAAACCTGTCAAGATGCGAGCCGTTGTTATCTTCGCTCTCGGTTTCTGGATCCTTGACGTGGCTAACAACACTCTCCAAGGACCTTGTCGCGCTTTCCTCGGTGATTTAGCCGCTGGAGACGCTAAGAAAACGCGAACAGCAAACGCGTTTTTCTCTTTCTTCATGGCTGTTGGGAACGTTTTGGGATACGCGGCAGGATCATACACTAACCTCTACAAGATCTTCCCTTTCACAATGACTAAAGCATGTGACATATATTGCGCAAATCTCAAGAGTTGTTTCTTCCTTTCCATCACTCTCCTCCTAGTCGTCACAATCATAGCTCTTTGGTACGTGGAAGACAAGCAATGGTCGCCTAAAGCAGACTCGGACAACGAGAAAACTCCGTTCTTTGGTGAGATCTTTGGAGCTTTCAAGGTGATGAAACGTCCAATGTGGATGCTATTAATCGTCACGGCCTTGAACTGGATCGCATGGTTCCCTTTTCTTTTATACGATACCGATTGGATGGGTCGTGAAGTGTACGGTGGAGACTCAAAAGGAGATGACAAAATGAAGAAACTATACAACCAAGGGATTCACGTTGGTGCGTTGGGATTGATGCTTAACTCTATCGTTCTTGGAATCGTCTCACTTGGTATTGAAGGTATTAGCAAGAAAATAGGTGGAGCTAAAAGGCTTTGGGGAGCTGTGAATATCATCCTTGCTGTGTGTTTGGCAATGACGGTTTTGGTTACTAAAAAGGCGGAGGAGCACCGGAGAATCGCTGGTCCGATGGCCCTTCCTACCGATGGCATCAGAGCTGGAGCATTGACTCTCTTTGCTCTTCTTGGAATTCCTCTTGCTATTACATTCAGTATTCCGTTTGCACTAGCTTCCATAATCTCAAGTAGTTCCGGCGCCGGTCAAGGACTGTCTCTAGGAGTTTTAAACATGGCAATAGTGATACCACAAATGATTGTATCGTTTGGAGTTGGTCCTATTGATGCGCTTTTTGGAGGTGGAAACTTACCAAGATTTGTGGTCGGAGCTATTGCAGCGGCAATTAGCAGTGTTGTGGCATTTACCGTGTTACCTTAA

 

1

 

68415.m01650 sucrose transporter, putative / sucrose-proton symporter, putative similar to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094, SUC2 [Arabidopsis thaliana] GI:407092, sucrose transporter [Arabidopsis thaliana] GI:12057172; contains Pfam profile PF00083: major facilitator superfamily protein

 

MSDLQAKNDVVAVDRQSSSSLADLDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGIVSLGIEGISKKIGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRIAGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPRFVVGAIAAAISSVVAFTVLP*

 

7962

 

AT5G06170

GO:0016020|GO:0005886|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0009908|GO:0042946

NULL

AtSUC9|NULL

Show
AT5G06170

AT5G06170

 

GO:0016020|GO:0005886|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0009908|GO:0042946

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC9|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

21

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

1

 

1

 

23

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

MBL20 sucrose transporter protein

 

ATGAGTGACATCCAAGCAAAAGAAGATGCGGCGCCTGTTGATAGACAGTCTTCTTCGTCGGTTGTGGTTCCTGATGAGCCGTCACCTCTAAGAAAGATGATATCAGTGGCTTCTATCGCAGCCGGTATACAGTTTGGTTGGGCTCTTCAGCTTTCTCTCCTAACCCCATACGTTCAGCTTCTCGGAGTCCCACACAAATGGTCATCTTTCATATGGCTATGTGGTCCTATCTCCGGTCTGCTCGTCCAGCCAACCGTCGGTTACTTCAGCGACCGATGCAAGTCAAGATTCGGTCGTCGTCGACCTTTCATCGCCACTGGTGCCTTGCTTGTTGCCCTTGCTGTTATACTAATTGGATTTGCGGCTGACTTCGGCCACACCATGGGAGATAAACTCGACGAAGCTGTCAAGATAAGAGCCGTTGGTTTCTTCGTTGTCGGTTTCTGGATCCTTGACGTGGCTAACAACACTCTTCAAGGACCTTGCCGTGCTTTTCTTGGTGATTTAGCAGCCGGAGATGCTAAGAAAACTCGAACTGCCAACGCGATTTTCTCTTTCTTCATGGCCGTTGGAAACGTTTTGGGATACGCTGCGGGATCGTACACTAACCTCCACAAGATTTTCCCTTTCACAGTGACTAAAGCATGCGACATCTATTGTGCAAATCTCAAGAGCTGTTTCATTATTTCCATCACTCTCCTCATAGTCCTCACAATCATAGCTCTTTGGTACGTGGAAGACAAGCAATGGTCGCCTAATGCAGATTCCGACAATGAGAAAACTCCCTTCTTTGGCGAGATCTTTGGAGCTTTCAAGGTGATGAAACGTCCAATGTGGATGCTTCTAGCCGTCACGGCCTTGAACTGGATCGCATGGTTTCCTTTTCTTTTATACGATACCGATTGGATGGGTCGTGAAGTGTATGGTGGAGACTCAGCAGGAGATGACAAAATGAAGAAACTATACAACCACGGAATCCAAGTTGGTTCGTTGGGGTTGATGCTTAACTCTATCGTTCTTGGAGTCATGTCCCTTGTTATTGGAGTGATTAGTAAGAAAATTGGAGCTAAAAGGCTTTGGGGAGCTGTGAACATAATCCTCGCGGTGTGTTTGGCAATGACAGTTTTGGTTACTAAAAAGGCTGAGGAGCACCGGAAGATCGCTGGTCGGATGGCCCTTCCTACCAATGCCATCAGAGATGGAGCATTGAGTCTCTTTGCTATTCTTGGAATTCCTCTTGCTATTACATTTAGTATTCCATTTGCATTAGCTTCCATTATTTCAAGCAGTTCCGGTGCCGGTCAAGGACTCTCTCTAGGAGTTTTAAACATGGCAATAGTGATACCACAAATGATTGTATCGTTTGGAGTTGGTCCAATTGATGCGTTATTTGGAGGTGGAAACTTACCTGGATTTGTGGTTGGAGCTATAGCAGCTCTAATCAGCAGTGTTGTGGCACTTACCGTTTTACCTTAA

 

1

 

68418.m00688 sucrose transporter, putative / sucrose-proton symporter, putative similar to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094, sucrose transporter [Arabidopsis thaliana] GI:12057172; contains Pfam profile PF00083: major facilitator superfamily protein

 

MSDIQAKEDAAPVDRQSSSSVVVPDEPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQPTVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKACDIYCANLKSCFIISITLLIVLTIIALWYVEDKQWSPNADSDNEKTPFFGEIFGAFKVMKRPMWMLLAVTALNWIAWFPFLLYDTDWMGREVYGGDSAGDDKMKKLYNHGIQVGSLGLMLNSIVLGVMSLVIGVISKKIGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRKIAGRMALPTNAIRDGALSLFAILGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPGFVVGAIAALISSVVALTVLP*

 

21500

 

AT3G02280

GO:0016491|GO:0006118

NULL

(putative) ATR3

Show
AT3G02280

AT3G02280

 

GO:0016491|GO:0006118

 

NULL

 

NADPH P450 reductases

 

NADPH P450 reductases

 

(putative) ATR3

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

3

 

0

 

0

 

3

 

0

 

2

 

0

 

5

 

0

 

0

 

2

 

0

 

0

 

0

 

0

 

0

 

0

 

2

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

9

 

0

 

0

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

F14P3 unknown

 

ATGGGAGAAAAACAAAGGAAGCTGCTTGTGTTGTATGCCTCTCAGACCGGAAACGCTCTTGATGCGGCGGAGCGTATTGGCCGCGAAGCAGAACGCCGTGGACTGCCAGCTTCTGTCGTCTCCACCGACGAATTCGACACGAGTTCCTTACCTCATCATGAGGAGGCTGTTGTTTTTGTTGTCTCCACTACAGGGCAAGGAGACTCTCCTGATTCCTTTAAGGCATTTTGGAGGTTTCTTCTTCAAAGAAATCTGGGAAACTATTGGTTGCAACAAGTTCGCTATGCAGTGTTTGGACTAGGTGATTCTGGTTACCAGAAGTACAACTTTGTAGCAAAGAAGCTAGACAAAAGATTATCAGATCTTGGGGCCACAACCATCATTGAAAAAGGTCTAGGAGATGATCAACACCCATCAGGGTATGAAGGAACTCTTGATCCGTGGATGCTTTCTTTGTGGAGGACATTATATCAGATCAATCCAAAATACTTTCCTAAAGGTCCAGATGTGAAAATTCCTCAAGATGAAGTAATTGATAAGCCTAAATATAGGATTTTATTTCATAAGCAGGAGAAATTGGAGCCTAAATTATTGTCAGATTCAGATATCATACAAAGAGCCCGTGGAATGTCCCCAGGAAAATTATTCAAGGACAAAAGTAAACCAGACTGCTTTCTCAAGATGACCCGCAATGAAGTCTTGACTAAAGCTGAAAGCACAAAGGATGTCCGCCACTTTGAGTTCCAGTTTGTTTCTTCTACTATCGAATATGAAGTTGGCGATGTTGTTGAGCTTCTTCCAAGCCAAAATTCTTCAGTGGTAGATGCGTTTATAGAACGCTGCGGTTTAGACCCAGAATCATTCATTACAGTTGGTCCGCGAGAGACAGAGAATAGTAGTTTTAGTGAAGAAATGATTACACAGATCCCTATTAAGCTTAAGACTTTTGTTGAATTAACAATGGATGTTACATCCGCTTCACCTCGACGATACTTCTTTGAGATTATGAGCTTCTATGCAACAGCTGAACATGAGAAGGAAAGACTTCAATACTTTGCCTCACCCGAGGGGCGGGATGATCTCTACAATTACAATCAGAAGGAAAGAAGAAGCATTCTTGAGGTGCTAGAGGATTTTCCTTCCGTACAAATCCCTTTTGATTGGCTAGTACAGTTAGTCCCACCGCTAAAACCAAGAGCTTTTTCGATATCTTCGTCTCCTTTGGCCCACCCTGCCGCAGTACATTTGACTGTAAGCATAGTATCATGGATCACGCCTTATAAGAGAACTCGGAAAGGTCTGTGCTCCTCTTGGCTTGCAAGCCTCGCACCTGAACAAGAGGTAAACATACCGGTTTGGTTTCACAAAGGCTCCCTTCCTGCTCCATCTCAGTCGCTTCCGCTCATCTTAGTGGGACCCGGAACCGGATGTGCGCCATTCCGTGGATTCATAGCTGAGAGAGCCGTACAAGCTCAGTCTAGCCCGGTTGCCCCCGTCATGTTCTTCTTTGGTTGCAGAAACAAAGACACAGACTTTCTATACCGCGATTTCTGGGAGTCTCACGCAAGAGAAGGAGGCATGCTCTCTGAAGGAAAAGGCGGTGGCTTTTACACAGCGTTCTCTAGAGACCAACCAAAGAAGGTTTACGTGCAACATAAGATCCGCGAAATGAGCAAGAGAGTTTGGGATTTACTCTGTGATGGAGCCGCTGTTTACGTGGCGGGCTCGTCGACGAAAATGCCTTGTGATGTGATGTCGGCTTTCGAAGATATTGTGTCGGAGGAGACAGGAGGAGGATCAAAGGAGGTAGCTTCACGGTGGCTTAAGGCTTTGGAGAAGACAGGGAGGTACAATGTTGAAGCTTGGTCTTAA

 

1

 

68416.m00209 flavodoxin family protein low similarity to SP|Q05001 NADPH-cytochrome P450 reductase (EC 1.6.2.4) {Catharanthus roseus}, similar to NADPH-dependent FMN and FAD containing oxidoreductase [Homo sapiens] GI:6694369; contains Pfam profiles PF00258: flavodoxin, PF00667: FAD binding domain, PF00175: Oxidoreductase NAD-binding domain

 

MGEKQRKLLVLYASQTGNALDAAERIGREAERRGLPASVVSTDEFDTSSLPHHEEAVVFVVSTTGQGDSPDSFKAFWRFLLQRNLGNYWLQQVRYAVFGLGDSGYQKYNFVAKKLDKRLSDLGATTIIEKGLGDDQHPSGYEGTLDPWMLSLWRTLYQINPKYFPKGPDVKIPQDEVIDKPKYRILFHKQEKLEPKLLSDSDIIQRARGMSPGKLFKDKSKPDCFLKMTRNEVLTKAESTKDVRHFEFQFVSSTIEYEVGDVVELLPSQNSSVVDAFIERCGLDPESFITVGPRETENSSFSEEMITQIPIKLKTFVELTMDVTSASPRRYFFEIMSFYATAEHEKERLQYFASPEGRDDLYNYNQKERRSILEVLEDFPSVQIPFDWLVQLVPPLKPRAFSISSSPLAHPAAVHLTVSIVSWITPYKRTRKGLCSSWLASLAPEQEVNIPVWFHKGSLPAPSQSLPLILVGPGTGCAPFRGFIAERAVQAQSSPVAPVMFFFGCRNKDTDFLYRDFWESHAREGGMLSEGKGGGFYTAFSRDQPKKVYVQHKIREMSKRVWDLLCDGAAVYVAGSSTKMPCDVMSAFEDIVSEETGGGSKEVASRWLKALEKTGRYNVEAWS*

 

11570

 

AT4G38710

GO:0003743

NULL

4B-3?

Show
AT4G38710

AT4G38710

 

GO:0003743

 

NULL

 

Protein synthesis factors

 

eIF4B - eukaryotic initiation factor 4B

 

4B-3?

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

1

 

0

 

0

 

44

 

46

 

51

 

61

 

31

 

12

 

82

 

19

 

69

 

21

 

103

 

0

 

4

 

1

 

1

 

0

 

0

 

2

 

0

 

0

 

47

 

51

 

57

 

67

 

33

 

13

 

93

 

19

 

73

 

23

 

122

 

WT_D_31 unknown protein

 

ATGGCGGCTGCTGTATCATCTGTTTGGGCAAAGCCTGGTGCTTGGGCTCTTGAAGCCGAGGAACATGAAGCTGAGCTCAAACAACAACCCTCTCCCACCAACCAGAAATCCTCTGCCGAAGATTCCTCCGATTTCCCTTCCTTAGCCGCTGCAGCGACCACCAAAACGAAGAAGAAGAAGGGCCAAACCATCTCTCTTGCTGAATTCGCTACCTACGGTACTGCTAAGGCAAAGCCGGCTCCACAGACGGAGCGTCTCACTCAGGCTGAGCTGGTCGCTCTTCCGACCGGTCCACGTGAACGCTCTGCTGAGGAGCTTGATAGATCTAAGCTTGGAGGTGGTTTCCGGAGCTATGGTGGTGGTCGTTATGGAGATGAGTCGTCCAGCTCGAGGTGGGGTTCGTCTAGGGTTTCGGAGGATGGGGAAAGGAGAGGCGGTGGATTCAACCGGGATAGGGAACCTAGCAGGGATTCGGGTCCGTCGCGTGCGGATGAGGATGATAACTGGGCCGCCGCCAAGAAACCAATTAGCGGAAACGGATTCGAGAGAAGAGAGAGAGGCAGCGGCGGAGGATTCTTCGAATCTCAGTCTCAGTCCAAGGCTGATGAAGTCGATAGCTGGGTCTCCACTAAGCCATCGGAGCCCCGGAGATTCGTTTCTAGCAACGGCGGCGGCGGTGACAGATTTGAGAAAAGGGGAAGTTTTGAATCCTTGTCTAGAAACCGGGATTCTCAATACGGTGGTGGTGGTGGTTCTGAATCGGATACCTGGGGAAGAAGAAGAGAAGAAAGCGGTGCTGCTAATGGCTCGCCACCACCGAGCGGTGGTTCACGCCCAAGATTGGTGTTACAGCCACGTACACTTCCCGTGGCCGTTGTGGAGGTCGTGAAGCCGGAGAGTCCGGTCTTGGTCATTGTGGAGAAACCTAAAGGTGCTAATCCTTTTGGGAACGCAAGACCTAGAGAGGAAGTTCTGGCTGAGAAAGGCCAGGATTGGAAAGAGATTGACGAGAAGCTCGAGGCTGAAAAGCTTAAGGACATTGCTGCAGCCATGGAGAAGCCTAATGAGAAATCTACAGGGAAGATGGGCTTTGGTCTTGGCAATGGCCGTAAAGACGAGGAACGTATTGAAAGAAGTTGGAGGAAAAGCACGGAGCATTCTGAGGAGGATGCTCAAGAGGAGGAACCAGCTGTAGAAGGGGCAAAGAAGGAAGAGACTGAGGACAAACCGGCTGTAGAAGAGGCTAAGAAGGAAGAAACTGAGGGTGAACAGGCTGTAGAAGAGGCTAAGAAGGAAGAGACTGGTGGCGAACCGGCTGTAGAAGAGGCAAAGAAGGAAGAGACGGAGGACAAAATCTAA

 

1

 

68417.m05483 glycine-rich protein cylicin II - bovine, PIR2:I46014

 

MAAAVSSVWAKPGAWALEAEEHEAELKQQPSPTNQKSSAEDSSDFPSLAAAATTKTKKKKGQTISLAEFATYGTAKAKPAPQTERLTQAELVALPTGPRERSAEELDRSKLGGGFRSYGGGRYGDESSSSRWGSSRVSEDGERRGGGFNRDREPSRDSGPSRADEDDNWAAAKKPISGNGFERRERGSGGGFFESQSQSKADEVDSWVSTKPSEPRRFVSSNGGGGDRFEKRGSFESLSRNRDSQYGGGGGSESDTWGRRREESGAANGSPPPSGGSRPRLVLQPRTLPVAVVEVVKPESPVLVIVEKPKGANPFGNARPREEVLAEKGQDWKEIDEKLEAEKLKDIAAAMEKPNEKSTGKMGFGLGNGRKDEERIERSWRKSTEHSEEDAQEEEPAVEGAKKEETEDKPAVEEAKKEETEGEQAVEEAKKEETGGEPAVEEAKKEETEDKI*

 

20796

 

AT4G26080

GO:0004722|GO:0009409|GO:0009409|GO:0009409|GO:0009409|GO:0009408|GO:0009408|GO:0009737|GO:0009788|GO:0009788|GO:0010119|GO:0008287|GO:0005509|GO:0005509|GO:0004722|GO:0004722|GO:0006470|GO:0006470|GO:0006470

NULL

ABI1|ABI1

Show
AT4G26080

AT4G26080

 

GO:0004722|GO:0009409|GO:0009409|GO:0009409|GO:0009409|GO:0009408|GO:0009408|GO:0009737|GO:0009788|GO:0009788|GO:0010119|GO:0008287|GO:0005509|GO:0005509|GO:0004722|GO:0004722|GO:0006470|GO:0006470|GO:0006470

 

NULL

 

PP2C-type phosphatases|NULL

 

Group A|EF-hand containing proteins:Group VI

 

ABI1|ABI1

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

124

 

98

 

90

 

72

 

163

 

109

 

62

 

260

 

89

 

143

 

128

 

187

 

259

 

99

 

98

 

228

 

0

 

2

 

1

 

1

 

147

 

114

 

106

 

86

 

194

 

122

 

75

 

311

 

97

 

169

 

159

 

207

 

291

 

107

 

149

 

287

 

EN_D_24 abscisic acid insensitive protein (ABI1)

 

ATGGAGGAAGTATCTCCGGCGATCGCAGGTCCTTTCAGGCCATTCTCCGAAACCCAGATGGATTTCACCGGGATCAGATTGGGTAAAGGTTACTGCAATAACCAATACTCAAATCAAGATTCCGAGAACGGAGATCTAATGGTTTCGTTACCGGAGACTTCATCATGCTCTGTTTCTGGGTCACATGGTTCTGAATCTAGGAAAGTTTTGATTTCTCGGATCAATTCTCCTAATTTAAACATGAAGGAATCAGCAGCTGCTGATATAGTCGTCGTTGATATCTCCGCCGGAGATGAGATCAACGGCTCAGATATTACTAGCGAGAAGAAGATGATCAGCAGAACAGAGAGTAGGAGTTTGTTTGAATTCAAGAGTGTGCCTTTGTATGGTTTTACTTCGATTTGTGGAAGAAGACCTGAGATGGAAGATGCTGTTTCGACTATACCAAGATTCCTTCAATCTTCCTCTGGTTCGATGTTAGATGGTCGGTTTGATCCTCAATCCGCCGCTCATTTCTTCGGTGTTTACGACGGCCATGGCGGTTCTCAGGTAGCGAACTATTGTAGAGAGAGGATGCATTTGGCTTTGGCGGAGGAGATAGCTAAGGAGAAACCGATGCTCTGCGATGGTGATACGTGGCTGGAGAAGTGGAAGAAAGCTCTTTTCAACTCGTTCCTGAGAGTTGACTCGGAGATTGAGTCAGTTGCGCCGGAGACGGTTGGGTCAACGTCGGTGGTTGCCGTTGTTTTCCCGTCTCACATCTTCGTCGCTAACTGCGGTGACTCTAGAGCCGTTCTTTGCCGCGGCAAAACTGCACTTCCATTATCCGTTGACCATAAACCGGATAGAGAAGATGAAGCTGCGAGGATTGAAGCCGCAGGAGGGAAAGTGATTCAGTGGAATGGAGCTCGTGTTTTCGGTGTTCTCGCCATGTCGAGATCCATTGGCGATAGATACTTGAAACCATCCATCATTCCTGATCCGGAAGTGACGGCTGTGAAGAGAGTAAAAGAAGATGATTGTCTGATTTTGGCGAGTGACGGGGTTTGGGATGTAATGACGGATGAAGAAGCGTGTGAGATGGCAAGGAAGCGGATTCTCTTGTGGCACAAGAAAAACGCGGTGGCTGGGGATGCATCGTTGCTCGCGGATGAGCGGAGAAAGGAAGGGAAAGATCCTGCGGCGATGTCCGCGGCTGAGTATTTGTCAAAGCTGGCGATACAGAGAGGAAGCAAAGACAACATAAGTGTGGTGGTGGTTGATTTGAAGCCTCGGAGGAAACTCAAGAGCAAACCCTTGAACTGA

 

1

 

68417.m03755 protein phosphatase 2C ABI1 / PP2C ABI1 / abscisic acid-insensitive 1 (ABI1) nearly identical to SP|P49597 Protein phosphatase 2C ABI1 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 1) {Arabidopsis thaliana}

 

MEEVSPAIAGPFRPFSETQMDFTGIRLGKGYCNNQYSNQDSENGDLMVSLPETSSCSVSGSHGSESRKVLISRINSPNLNMKESAAADIVVVDISAGDEINGSDITSEKKMISRTESRSLFEFKSVPLYGFTSICGRRPEMEDAVSTIPRFLQSSSGSMLDGRFDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDTWLEKWKKALFNSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHKPDREDEAARIEAAGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKEDDCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAAEYLSKLAIQRGSKDNISVVVVDLKPRRKLKSKPLN*

 

19459

 

AT5G57050

GO:0004722|GO:0009414|GO:0009414|GO:0009408|GO:0009408|GO:0006970|GO:0006970|GO:0009737|GO:0009788|GO:0009788|GO:0010205|GO:0010205|GO:0010205|GO:0010205|GO:0008287|GO:0004722|GO:0004722|GO:0004722|GO:0006470|GO:0006470|GO:0006470

NULL

ABI2

Show
AT5G57050

AT5G57050

 

GO:0004722|GO:0009414|GO:0009414|GO:0009408|GO:0009408|GO:0006970|GO:0006970|GO:0009737|GO:0009788|GO:0009788|GO:0010205|GO:0010205|GO:0010205|GO:0010205|GO:0008287|GO:0004722|GO:0004722|GO:0004722|GO:0006470|GO:0006470|GO:0006470

 

NULL

 

PP2C-type phosphatases

 

Group A

 

ABI2

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

29

 

34

 

18

 

16

 

61

 

15

 

14

 

96

 

14

 

35

 

48

 

33

 

45

 

3

 

0

 

138

 

0

 

2

 

1

 

1

 

35

 

40

 

20

 

19

 

72

 

17

 

17

 

116

 

17

 

42

 

54

 

35

 

52

 

3

 

0

 

178

 

MHM17 protein phosphatase 2C ABI2 (PP2C) (sp|O04719)

 

ATGGACGAAGTTTCTCCTGCAGTCGCTGTTCCATTCAGACCATTCACTGACCCTCACGCCGGACTTAGAGGCTATTGCAACGGTGAATCTAGGGTTACTTTACCGGAAAGTTCTTGTTCTGGCGACGGAGCTATGAAAGATTCTTCCTTTGAGATCAATACAAGACAAGATTCATTGACATCATCATCATCTGCTATGGCAGGTGTGGATATCTCCGCCGGAGATGAAATCAACGGTTCAGATGAGTTTGATCCGAGATCGATGAATCAGAGTGAGAAGAAAGTACTTAGTAGAACAGAGAGTAGAAGTCTGTTTGAGTTCAAGTGTGTTCCTTTATATGGAGTGACTTCGATTTGTGGTAGACGACCAGAGATGGAAGATTCTGTCTCAACGATTCCTAGATTCCTTCAAGTTTCTTCTAGTTCGTTGCTTGATGGTCGAGTCACTAATGGATTTAATCCTCACTTGAGTGCTCATTTCTTTGGTGTTTACGATGGCCATGGCGGTTCTCAGGTAGCGAATTATTGTCGTGAGAGGATGCATCTGGCTTTGACGGAGGAGATAGTGAAGGAGAAACCGGAGTTTTGTGACGGTGACACGTGGCAAGAGAAGTGGAAGAAGGCTTTGTTCAACTCTTTTATGAGAGTTGACTCGGAGATTGAAACTGTGGCTCATGCTCCGGAAACTGTTGGGTCTACCTCGGTGGTTGCGGTTGTCTTTCCGACTCACATCTTTGTCGCGAATTGCGGCGACTCTAGGGCGGTTTTGTGTCGCGGCAAAACGCCACTCGCGTTGTCGGTTGATCACAAACCGGATAGGGATGATGAAGCGGCGAGGATAGAAGCTGCCGGTGGGAAAGTAATCCGGTGGAACGGGGCTCGTGTATTTGGTGTTCTCGCAATGTCAAGATCCATTGGCGATAGATACCTTAAACCGTCAGTAATTCCGGATCCAGAAGTGACTTCAGTGCGGCGAGTAAAAGAAGATGATTGTCTCATCTTAGCAAGTGATGGTCTTTGGGATGTAATGACAAACGAAGAAGTGTGCGATTTGGCTCGGAAACGGATTTTACTATGGCATAAGAAGAACGCGATGGCCGGAGAGGCTTTGCTTCCGGCGGAGAAAAGAGGAGAAGGAAAAGATCCTGCAGCAATGTCCGCGGCAGAGTATTTGTCGAAGATGGCTTTGCAAAAAGGAAGCAAAGACAATATAAGTGTGGTAGTGGTTGATTTGAAGGGAATAAGGAAATTCAAGAGCAAATCCTTGAATTGA

 

1

 

68418.m07121 protein phosphatase 2C ABI2 / PP2C ABI2 / abscisic acid-insensitive 2 (ABI2) identical to SP|O04719 Protein phosphatase 2C ABI2 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 2) {Arabidopsis thaliana}

 

MDEVSPAVAVPFRPFTDPHAGLRGYCNGESRVTLPESSCSGDGAMKDSSFEINTRQDSLTSSSSAMAGVDISAGDEINGSDEFDPRSMNQSEKKVLSRTESRSLFEFKCVPLYGVTSICGRRPEMEDSVSTIPRFLQVSSSSLLDGRVTNGFNPHLSAHFFGVYDGHGGSQVANYCRERMHLALTEEIVKEKPEFCDGDTWQEKWKKALFNSFMRVDSEIETVAHAPETVGSTSVVAVVFPTHIFVANCGDSRAVLCRGKTPLALSVDHKPDRDDEAARIEAAGGKVIRWNGARVFGVLAMSRSIGDRYLKPSVIPDPEVTSVRRVKEDDCLILASDGLWDVMTNEEVCDLARKRILLWHKKNAMAGEALLPAEKRGEGKDPAAMSAAEYLSKMALQKGSKDNISVVVVDLKGIRKFKSKSLN*

 

26184

 

AT3G24650

GO:0003677|GO:0003700|GO:0016563|GO:0009657|GO:0017163|GO:0009737|GO:0009733|GO:0009790|GO:0003677|GO:0003700|GO:0003700|GO:0016563|GO:0016563|GO:0006355|GO:0006355|GO:0006355

NULL

ABI3

Show
AT3G24650

AT3G24650

 

GO:0003677|GO:0003700|GO:0016563|GO:0009657|GO:0017163|GO:0009737|GO:0009733|GO:0009790|GO:0003677|GO:0003700|GO:0003700|GO:0016563|GO:0016563|GO:0006355|GO:0006355|GO:0006355

 

NULL

 

NULL

 

ABI3VP1 Transcription Factor Family

 

ABI3

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

MSD24 abscisic acid-insensitive protein 3

 

ATGAAAAGCTTGCATGTGGCGGCCAACGCCGGAGATCTGGCTGAGGATTGTGGAATACTCGGTGGAGACGCTGATGATACTGTTTTGATGGATGGAATTGATGAAGTTGGTAGAGAGATCTGGTTAGATGACCATGGAGGAGATAATAATCATGTTCATGGTCATCAAGATGATGATTTGATTGTTCATCATGACCCTTCAATCTTCTATGGAGATCTCCCAACGCTTCCTGATTTCCCATGCATGTCGTCTTCATCATCGTCTTCAACATCTCCAGCTCCTGTCAACGCAATCGTCTCCTCAGCCTCTTCTTCTTCGGCAGCTTCTTCCTCCACTTCCTCAGCTGCTTCTTGGGCTATATTGAGATCAGATGGAGAAGATCCGACTCCAAACCAAAACCAATACGCATCAGGAAACTGTGACGACTCTTCTGGTGCATTGCAATCCACAGCTTCCATGGAGATTCCATTAGACAGCAGTCAAGGTTTTGGTTGCGGCGAAGGCGGTGGTGATTGCATTGATATGATGGAGACTTTCGGGTACATGGATCTACTTGATAGCAACGAGTTCTTTGACACCTCAGCTATATTTAGCCAAGACGACGACACGCAAAACCCTAACTTGATGGACCAAACCCTTGAGAGACAAGAAGACCAGGTCGTTGTTCCGATGATGGAGAATAACAGTGGTGGAGACATGCAAATGATGAATTCTTCCTTGGAACAGGACGATGATCTCGCTGCTGTGTTTTTGGAGTGGCTAAAGAACAACAAGGAGACTGTGTCGGCTGAGGATTTGAGGAAAGTAAAGATAAAGAAAGCTACGATTGAATCAGCGGCAAGAAGACTAGGCGGTGGTAAAGAAGCGATGAAGCAGCTTTTAAAGCTGATTCTTGAATGGGTCCAAACTAATCACTTACAAAGAAGACGCACCACCACCACCACCACCAACCTCTCTTATCAACAATCATTCCAACAAGATCCATTTCAAAACCCTAACCCTAATAACAACAACCTAATCCCACCGTCCGACCAAACCTGTTTCTCACCTTCAACATGGGTTCCTCCACCACCACAACAACAAGCTTTTGTCTCGGACCCGGGTTTTGGATACATGCCTGCTCCAAACTATCCGCCACAGCCAGAGTTCCTTCCTTTACTTGAATCTCCACCGTCATGGCCACCACCACCACAGTCTGGTCCCATGCCACATCAACAATTCCCCATGCCGCCAACCTCGCAGTATAATCAATTTGGAGATCCAACAGGTTTCAATGGATACAACATGAATCCGTACCAATATCCTTATGTTCCTGCAGGACAAATGAGAGATCAGAGATTACTCCGTTTGTGTTCCTCAGCAACTAAAGAGGCAAGAAAGAAACGGATGGCGAGACAGAGGAGGTTCTTGTCTCATCACCACAGACATAACAACAACAACAACAACAACAACAATAATCAGCAGAACCAAACCCAAATCGGAGAAACCTGTGCCGCGGTGGCTCCACAACTTAACCCCGTGGCCACAACCGCCACGGGAGGGACCTGGATGTATTGGCCTAATGTCCCGGCAGTGCCGCCTCAATTACCGCCAGTGATGGAGACTCAGTTACCTACCATGGACCGAGCTGGCTCAGCTTCTGCTATGCCACGTCAGCAGGTGGTACCAGATCGCCGGCAGGGATGGAAACCAGAAAAGAATTTGCGGTTTCTCTTGCAGAAAGTCTTGAAGCAAAGCGACGTGGGTAACCTCGGAAGGATCGTTTTGCCAAAAAAAGAAGCTGAGACACACTTGCCGGAGCTAGAGGCAAGAGACGGCATCTCTCTGGCCATGGAAGACATCGGAACCTCTCGTGTTTGGAACATGCGCTACAGGTTTTGGCCTAACAACAAAAGCAGGATGTATCTCCTCGAGAACACCGGCGATTTTGTGAAAACCAATGGGCTCCAAGAAGGTGATTTCATAGTCATATACTCCGACGTCAAATGTGGCAAATATTTGATACGAGGGGTTAAAGTAAGACAACCGAGCGGACAAAAGCCGGAGGCCCCACCGTCGTCAGCAGCTACGAAGAGACAAAACAAGTCGCAAAGGAACATAAACAATAACTCTCCGTCGGCGAATGTGGTGGTCGCTTCACCAACTTCTCAAACTGTTAAATGA

 

1

 

68416.m03095 abscisic acid-insensitive protein 3 (ABI3) identical to abscisic acid-insensitive protein 3 GI:16146 SP:Q01593 from [Arabidopsis thaliana], (Plant Cell 4 (10), 1251-1261 (1992))

 

MKSLHVAANAGDLAEDCGILGGDADDTVLMDGIDEVGREIWLDDHGGDNNHVHGHQDDDLIVHHDPSIFYGDLPTLPDFPCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGEDPTPNQNQYASGNCDDSSGALQSTASMEIPLDSSQGFGCGEGGGDCIDMMETFGYMDLLDSNEFFDTSAIFSQDDDTQNPNLMDQTLERQEDQVVVPMMENNSGGDMQMMNSSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILEWVQTNHLQRRRTTTTTTNLSYQQSFQQDPFQNPNPNNNNLIPPSDQTCFSPSTWVPPPPQQQAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMPHQQFPMPPTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRDQRLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAVPPQLPPVMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPSGQKPEAPPSSAATKRQNKSQRNINNNSPSANVVVASPTSQTVK*

 

13955

 

AT2G40220

GO:0009414|GO:0009414|GO:0006970|GO:0006970|GO:0005983|GO:0005983|GO:0019433|GO:0019433|GO:0009744|GO:0009737|GO:0009747|GO:0009749|GO:0009738|GO:0048316|GO:0010353|GO:0010353|GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0003700|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0010182

NULL

ABI4

Show
AT2G40220

AT2G40220

 

GO:0009414|GO:0009414|GO:0006970|GO:0006970|GO:0005983|GO:0005983|GO:0019433|GO:0019433|GO:0009744|GO:0009737|GO:0009747|GO:0009749|GO:0009738|GO:0048316|GO:0010353|GO:0010353|GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0003700|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0010182

 

NULL

 

NULL

 

AP2-EREBP Transcription Factor Family

 

ABI4

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

0

 

0

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

t7m7 AP2 domain transcription factor (ABI4:abscisic acid-insensitive 4 )

 

ATGGACCCTTTAGCTTCCCAACATCAACACAACCATCTGGAAGATAATAACCAAACCCTAACCCATAATAATCCTCAATCCGATTCCACCACCGACTCATCAACTTCCTCCGCTCAACGCAAACGCAAAGGCAAAGGTGGTCCGGACAACTCCAAGTTCCGTTACCGTGGCGTTCGACAAAGAAGCTGGGGCAAATGGGTCGCCGAGATCCGAGAGCCACGTAAGCGCACTCGCAAGTGGCTTGGTACTTTCGCAACCGCCGAAGACGCCGCACGTGCCTACGACCGGGCTGCCGTTTACCTATACGGGTCACGTGCTCAGCTCAACTTAACCCCTTCGTCTCCTTCCTCCGTCTCTTCCTCTTCCTCCTCCGTCTCCGCCGCTTCTTCTCCTTCCACCTCCTCTTCCTCCACTCAAACCCTAAGACCTCTCCTCCCTCGCCCCGCCGCCGCCACCGTAGGAGGAGGAGCCAACTTTGGTCCGTACGGTATCCCTTTTAACAACAACATCTTCCTTAATGGTGGGACCTCTATGTTATGCCCTAGTTATGGTTTTTTCCCTCAACAACAACAACAACAAAATCAGATGGTCCAGATGGGACAATTCCAACACCAACAGTATCAGAATCTTCATTCTAATACTAACAATAACAAGATTTCTGACATCGAGCTCACTGATGTTCCGGTAACTAATTCGACTTCGTTTCATCATGAGGTGGCGTTAGGGCAGGAACAAGGAGGAAGTGGGTGTAATAATAATAGTTCGATGGAGGATTTGAACTCTCTAGCTGGTTCGGTGGGTTCGAGTCTATCAATAACTCATCCACCGCCGTTGGTTGATCCGGTATGTTCTATGGGTCTGGATCCGGGTTATATGGTTGGAGATGGATCTTCGACCATTTGGCCTTTTGGAGGAGAAGAAGAATATAGTCATAATTGGGGGAGTATTTGGGATTTTATTGATCCCATCTTGGGGGAATTCTATTAA

 

1

 

68415.m04946 abscisic acid-insensitive 4 (ABI4) identical to AP2 domain transcription factor ABI4 GI:4587996 from [Arabidopsis thaliana]; sucrose uncoupled-6 (sun6) mutation PMID: 10972884

 

MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSSSSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLCPSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVALGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTIWPFGGEEEYSHNWGSIWDFIDPILGEFY*

 

10613