KATANA_ID GO Definiton GeneName

AT1G01060

GO:0005634|GO:0003677|GO:0003700|GO:0009651|GO:0009651|GO:0009737|GO:0009733|GO:0009723|GO:0009739|GO:0009753|GO:0009751|GO:0045449|GO:0045449|GO:0045449|GO:0046686|GO:0003700|GO:0042752|GO:0005634|GO:0003677|GO:0003700|GO:0005634|GO:0003677|GO:0005634

-

NULL

Show
AT1G01060

AT1G01060

 

GO:0005634|GO:0003677|GO:0003700|GO:0009651|GO:0009651|GO:0009737|GO:0009733|GO:0009723|GO:0009739|GO:0009753|GO:0009751|GO:0045449|GO:0045449|GO:0045449|GO:0046686|GO:0003700|GO:0042752|GO:0005634|GO:0003677|GO:0003700|GO:0005634|GO:0003677|GO:0005634

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

47

 

0

 

0

 

0

 

15

 

0

 

0

 

115

 

11

 

0

 

0

 

0

 

105

 

1

 

0

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

33

 

0

 

0

 

0

 

0

 

83

 

0

 

0

 

T25K16 DNA-binding protein, putative

 

ATGGATACTAATACATCTGGAGAAGAATTATTAGCTAAGGCAAGAAAGCCATATACAATAACAAAGCAGCGAGAGCGATGGACTGAGGATGAGCATGAGAGGTTTCTAGAAGCCTTGAGGCTTTATGGAAGAGCTTGGCAACGAATTGAAGAACATATTGGGACAAAGACTGCTGTTCAGATCAGAAGTCATGCACAAAAGTTCTTCACAAAGTTGGAGAAAGAGGCTGAAGTTAAAGGCATCCCTGTTTGCCAAGCTTTGGACATAGAAATTCCGCCTCCTCGTCCTAAACGAAAACCCAATACTCCTTATCCTCGAAAGCCTGGGAACAACGGTACATCTTCCTCTCAAGTATCATCAGCAAAAGATGCAAAACTTGTTTCATCGGCCTCTTCTTCACAGTTGAATCAGGCGTTCTTGGATTTGGAAAAAATGCCGTTCTCTGAGAAAACATCAACTGGAAAAGAAAATCAAGATGAGAATTGCTCGGGTGTTTCTACTGTGAACAAGTATCCCTTACCAACGAAACAGGTAAGTGGCGACATTGAAACAAGTAAGACCTCAACTGTGGACAACGCGGTTCAAGATGTTCCCAAGAAGAACAAAGACAAAGATGGTAACGATGGTACTACTGTGCACAGCATGCAAAACTACCCTTGGCATTTCCACGCAGATATTGTGAACGGGAATATAGCAAAATGCCCTCAAAATCATCCCTCAGGTATGGTATCTCAAGACTTCATGTTTCATCCTATGAGAGAAGAAACTCACGGGCACGCAAATCTTCAAGCTACAACAGCATCTGCTACTACTACAGCTTCTCATCAAGCGTTTCCAGCTTGTCATTCACAGGATGATTACCGTTCGTTTCTCCAGATATCATCTACTTTCTCCAATCTTATTATGTCAACTCTCCTACAGAATCCTGCAGCTCATGCTGCAGCTACATTCGCTGCTTCGGTCTGGCCTTATGCGAGTGTCGGGAATTCTGGTGATTCATCAACCCCAATGAGCTCTTCTCCTCCAAGTATAACTGCCATTGCCGCTGCTACAGTAGCTGCTGCAACTGCTTGGTGGGCTTCTCATGGACTTCTTCCTGTATGCGCTCCAGCTCCAATAACATGTGTTCCATTCTCAACTGTTGCAGTTCCAACTCCAGCAATGACTGAAATGGATACCGTTGAAAATACTCAACCGTTTGAGAAACAAAACACAGCTCTGCAAGATCAAAACTTGGCTTCGAAATCTCCAGCTTCATCATCTGATGATTCAGATGAGACTGGAGTAACCAAGCTAAATGCCGACTCAAAAACCAATGATGATAAAATTGAGGAGGTTGTTGTTACTGCCGCTGTGCATGACTCAAACACTGCCCAGAAGAAAAATCTTGTGGACCGCTCATCCTGTGGCTCAAATACACCTTCAGGGAGTGACGCAGAAACTGATGCATTAGATAAAATGGAGAAAGATAAAGAGGATGTGAAGGAGACAGATGAGAATCAGCCAGATGTTATTGAGTTAAATAACCGTAAGATTAAAATGAGAGACAACAACAGCAACAACAATGCAACTACTGATTCGTGGAAGGAAGTCTCCGAAGAGGGTCGTATAGCGTTTCAGGCTCTCTTTGCAAGAGAAAGATTGCCTCAAAGCTTTTCGCCTCCTCAAGTGGCAGAGAATGTGAATAGAAAACAAAGTGACACGTCAATGCCATTGGCTCCTAATTTCAAAAGCCAGGATTCTTGTGCTGCAGACCAAGAAGGAGTAGTAATGATCGGTGTTGGAACATGCAAGAGTCTTAAAACGAGACAGACAGGATTTAAGCCATACAAGAGATGTTCAATGGAAGTGAAAGAGAGCCAAGTTGGGAACATAAACAATCAAAGTGATGAAAAAGTCTGCAAAAGGCTTCGATTGGAAGGAGAAGCTTCTACATGA

 

2

 

68414.m00007 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain; identical to cDNA LATE ELONGATED HYPOCOTYL MYB transcription factor GI:3281845

 

MDTNTSGEELLAKARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEVKGIPVCQALDIEIPPPRPKRKPNTPYPRKPGNNGTSSSQVSSAKDAKLVSSASSSQLNQAFLDLEKMPFSEKTSTGKENQDENCSGVSTVNKYPLPTKQVSGDIETSKTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHADIVNGNIAKCPQNHPSGMVSQDFMFHPMREETHGHANLQATTASATTTASHQAFPACHSQDDYRSFLQISSTFSNLIMSTLLQNPAAHAAATFAASVWPYASVGNSGDSSTPMSSSPPSITAIAAATVAAATAWWASHGLLPVCAPAPITCVPFSTVAVPTPAMTEMDTVENTQPFEKQNTALQDQNLASKSPASSSDDSDETGVTKLNADSKTNDDKIEEVVVTAAVHDSNTAQKKNLVDRSSCGSNTPSGSDAETDALDKMEKDKEDVKETDENQPDVIELNNRKIKMRDNNSNNNATTDSWKEVSEEGRIAFQALFARERLPQSFSPPQVAENVNRKQSDTSMPLAPNFKSQDSCAADQEGVVMIGVGTCKSLKTRQTGFKPYKRCSMEVKESQVGNINNQSDEKVCKRLRLEGEAST*

 

52

 

AT1G09570

GO:0005737|GO:0016604|GO:0016604|GO:0005634|GO:0004673|GO:0004673|GO:0009630|GO:0009638|GO:0009883|GO:0010161|GO:0010161|GO:0010203|GO:0010201|GO:0010218|GO:0008020|GO:0004871|GO:0006355|GO:0006355|GO:0006355|GO:0046685

-

PHYA

Show
AT1G09570

AT1G09570

 

GO:0005737|GO:0016604|GO:0016604|GO:0005634|GO:0004673|GO:0004673|GO:0009630|GO:0009638|GO:0009883|GO:0010161|GO:0010161|GO:0010203|GO:0010201|GO:0010218|GO:0008020|GO:0004871|GO:0006355|GO:0006355|GO:0006355|GO:0046685

 

-

 

NULL

 

Histidine Kinase

 

PHYA

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

83

 

44

 

22

 

38

 

10

 

23

 

38

 

58

 

36

 

103

 

13

 

26

 

6

 

80

 

53

 

193

 

0

 

2

 

1

 

1

 

131

 

50

 

37

 

35

 

17

 

27

 

52

 

55

 

41

 

155

 

13

 

34

 

8

 

91

 

31

 

0

 

F14J9 putative phytochrome A

 

ATGTCAGGCTCTAGGCCGACTCAGTCCTCTGAGGGCTCAAGGCGATCAAGGCACAGCGCTAGGATCATTGCGCAGACCACTGTAGATGCGAAACTCCATGCTGATTTTGAGGAGTCAGGCAGCTCCTTTGATTACTCAACCTCAGTGCGTGTCACTGGCCCGGTTGTGGAGAATCAGCCACCAAGGTCTGACAAAGTTACCACGACTTATCTTCATCATATACAGAAGGGAAAGCTGATTCAGCCCTTCGGTTGTTTACTTGCCTTGGATGAGAAGACCTTCAAAGTTATTGCATACAGCGAGAATGCATCTGAGCTGTTGACAATGGCCAGTCATGCAGTTCCTAGTGTTGGCGAACACCCTGTTCTAGGCATTGGGACAGATATAAGGAGTCTTTTCACTGCTCCTAGTGCGTCTGCATTGCAGAAAGCCCTTGGATTTGGAGATGTCTCTCTTTTGAATCCCATTCTTGTGCACTGCAGGACTTCTGCAAAGCCCTTTTATGCGATTATCCACAGGGTTACAGGGAGCATCATCATCGACTTTGAACCCGTGAAGCCTTATGAAGTCCCCATGACAGCTGCTGGTGCCTTACAATCATACAAGCTCGCTGCCAAAGCAATCACTAGGCTGCAATCTTTACCCAGCGGGAGTATGGAAAGGCTTTGTGATACAATGGTTCAAGAGGTTTTTGAACTCACGGGGTATGACAGGGTGATGGCTTATAAGTTTCATGAAGATGATCACGGTGAGGTTGTCTCCGAGGTTACAAAACCTGGGCTGGAGCCTTATCTTGGGCTGCATTATCCTGCCACCGACATCCCTCAAGCAGCCCGTTTTCTGTTTATGAAGAACAAGGTCCGGATGATAGTTGATTGCAATGCAAAACATGCTAGGGTGCTTCAAGATGAAAAGCTTTCCTTTGACCTTACCTTGTGTGGCTCCACCCTTAGAGCACCGCACAGCTGCCATTTGCAGTACATGGCCAACATGGATTCAATTGCATCTCTGGTTATGGCGGTTGTAGTTAACGAGGAAGATGGAGAAGGGGATGCTCCTGATGCTACTACACAGCCTCAAAAGAGAAAGAGACTATGGGGTTTAGTGGTTTGTCACAATACGACTCCGAGGTTTGTTCCATTTCCTCTCAGGTATGCCTGTGAGTTTCTAGCTCAAGTGTTTGCCATACACGTCAATAAGGAGGTGGAACTCGATAACCAGATGGTGGAGAAGAACATTTTGCGCACGCAGACACTCTTGTGCGATATGCTGATGCGTGATGCTCCACTGGGTATTGTGTCGCAAAGCCCCAACATAATGGACCTTGTGAAATGTGATGGAGCAGCTCTCTTGTATAAAGACAAGATATGGAAACTGGGAACAACTCCAAGTGAGTTCCACCTGCAGGAGATAGCTTCATGGTTGTGTGAATACCACATGGATTCAACGGGTTTGAGCACTGATAGTTTGCATGACGCCGGGTTTCCTAGGGCTCTATCTCTCGGGGATTCGGTATGTGGGATGGCAGCTGTGAGGATATCATCGAAAGACATGATTTTCTGGTTCCGTTCTCATACCGCTGGTGAAGTGAGATGGGGAGGTGCGAAGCATGATCCAGATGATAGGGATGATGCAAGGAGAATGCACCCAAGGTCATCGTTCAAGGCTTTCCTTGAAGTGGTCAAGACAAGGAGTTTACCTTGGAAGGACTATGAGATGGATGCCATACACTCCTTGCAACTTATTTTGAGGAATGCTTTCAAGGATAGTGAAACTACTGATGTGAATACAAAGGTCATTTACTCGAAGCTAAATGATCTCAAAATTGATGGTATACAAGAACTAGAAGCTGTGACCAGTGAGATGGTTCGTTTAATTGAGACTGCTACGGTGCCAATATTGGCGGTTGATTCTGATGGACTGGTTAATGGTTGGAACACGAAAATTGCTGAGCTGACTGGTCTTTCGGTTGATGAAGCAATCGGGAAGCATTTCCTCACACTTGTTGAAGATTCTTCAGTGGAAATCGTTAAAAGGATGCTAGAGAACGCATTAGAAGGAACTGAGGAGCAGAATGTCCAGTTTGAGATCAAGACACATCTGTCCAGGGCTGATGCTGGGCCAATAAGTTTAGTTGTAAATGCATGCGCAAGTAGAGATCTCCATGAAAACGTGGTTGGGGTGTGTTTTGTAGCCCATGATCTTACTGGCCAGAAGACTGTGATGGACAAGTTTACGCGGATTGAAGGTGATTACAAGGCAATCATCCAAAATCCAAACCCGCTGATCCCGCCAATATTTGGTACCGATGAGTTTGGATGGTGCACAGAGTGGAATCCAGCAATGTCAAAGTTAACCGGTTTGAAGCGAGAGGAAGTGATTGACAAAATGCTCTTAGGAGAAGTATTTGGGACGCAGAAGTCATGTTGTCGTCTAAAGAATCAAGAAGCCTTTGTAAACCTTGGGATTGTGCTGAACAATGCTGTGACCAGTCAAGATCCAGAGAAAGTATCGTTTGCTTTCTTTACAAGAGGTGGCAAGTATGTGGAGTGTCTGTTGTGTGTGAGTAAGAAACTGGACAGGGAAGGTGTAGTGACAGGTGTCTTCTGTTTCCTGCAACTTGCCAGCCATGAGCTGCAGCAAGCGCTCCATGTTCAACGTTTAGCTGAGCGAACCGCAGTGAAGAGACTAAAGGCTCTAGCATACATAAAAAGACAGATCAGGAATCCGCTATCTGGGATCATGTTTACAAGGAAAATGATAGAGGGTACTGAATTAGGACCAGAGCAAAGACGGATTTTGCAAACTAGCGCGTTATGTCAGAAGCAACTAAGCAAGATCCTCGATGATTCGGATCTTGAAAGCATCATTGAAGGATGCTTGGATTTGGAAATGAAAGAATTCACCTTAAATGAAGTGTTGACTGCTTCCACAAGTCAAGTAATGATGAAGAGTAACGGAAAGAGTGTTCGGATAACAAATGAGACCGGAGAAGAAGTAATGTCTGACACTTTGTATGGAGACAGTATTAGGCTTCAACAAGTCTTGGCAGATTTCATGCTGATGGCTGTAAACTTTACACCATCCGGAGGTCAGCTAACTGTTTCAGCTTCCCTGAGGAAGGATCAGCTCGGGCGTTCTGTGCATCTTGCTAATCTAGAGATCAGGTTAACGCATACCGGAGCTGGGATACCTGAGTTTTTACTAAACCAAATGTTTGGGACTGAGGAAGATGTGTCAGAAGAAGGATTGAGCTTAATGGTTAGCCGGAAACTGGTGAAGCTGATGAATGGAGATGTTCAGTACTTGAGACAAGCTGGGAAATCAAGTTTCATTATCACTGCGGAACTCGCTGCAGCAAACAAGTAG

 

1

 

68414.m01073 phytochrome A (PHYA) identical to SP|P14712 Phytochrome A {Arabidopsis thaliana}

 

MSGSRPTQSSEGSRRSRHSARIIAQTTVDAKLHADFEESGSSFDYSTSVRVTGPVVENQPPRSDKVTTTYLHHIQKGKLIQPFGCLLALDEKTFKVIAYSENASELLTMASHAVPSVGEHPVLGIGTDIRSLFTAPSASALQKALGFGDVSLLNPILVHCRTSAKPFYAIIHRVTGSIIIDFEPVKPYEVPMTAAGALQSYKLAAKAITRLQSLPSGSMERLCDTMVQEVFELTGYDRVMAYKFHEDDHGEVVSEVTKPGLEPYLGLHYPATDIPQAARFLFMKNKVRMIVDCNAKHARVLQDEKLSFDLTLCGSTLRAPHSCHLQYMANMDSIASLVMAVVVNEEDGEGDAPDATTQPQKRKRLWGLVVCHNTTPRFVPFPLRYACEFLAQVFAIHVNKEVELDNQMVEKNILRTQTLLCDMLMRDAPLGIVSQSPNIMDLVKCDGAALLYKDKIWKLGTTPSEFHLQEIASWLCEYHMDSTGLSTDSLHDAGFPRALSLGDSVCGMAAVRISSKDMIFWFRSHTAGEVRWGGAKHDPDDRDDARRMHPRSSFKAFLEVVKTRSLPWKDYEMDAIHSLQLILRNAFKDSETTDVNTKVIYSKLNDLKIDGIQELEAVTSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDEAIGKHFLTLVEDSSVEIVKRMLENALEGTEEQNVQFEIKTHLSRADAGPISLVVNACASRDLHENVVGVCFVAHDLTGQKTVMDKFTRIEGDYKAIIQNPNPLIPPIFGTDEFGWCTEWNPAMSKLTGLKREEVIDKMLLGEVFGTQKSCCRLKNQEAFVNLGIVLNNAVTSQDPEKVSFAFFTRGGKYVECLLCVSKKLDREGVVTGVFCFLQLASHELQQALHVQRLAERTAVKRLKALAYIKRQIRNPLSGIMFTRKMIEGTELGPEQRRILQTSALCQKQLSKILDDSDLESIIEGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVMSDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASLRKDQLGRSVHLANLEIRLTHTGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAAANK*

 

953

 

AT1G04400

GO:0005634|GO:0005634|GO:0009637|GO:0006338|GO:0009414|GO:0009414|GO:0009638|GO:0009911|GO:0009909|GO:0009882|GO:0010118|GO:0042803

-

NULL

Show
AT1G04400

AT1G04400

 

GO:0005634|GO:0005634|GO:0009637|GO:0006338|GO:0009414|GO:0009414|GO:0009638|GO:0009911|GO:0009909|GO:0009882|GO:0010118|GO:0042803

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

251

 

261

 

162

 

98

 

119

 

19

 

94

 

83

 

55

 

26

 

147

 

51

 

9

 

87

 

0

 

74

 

0

 

4

 

1

 

1

 

266

 

285

 

168

 

94

 

134

 

0

 

96

 

91

 

57

 

26

 

151

 

53

 

10

 

92

 

0

 

83

 

F19P19 cryptochrome 2 apoprotein like protein

 

ATGAAGATGGACAAAAAGACTATAGTTTGGTTTAGAAGAGACCTAAGGATTGAGGATAATCCTGCATTAGCAGCAGCTGCTCACGAAGGATCTGTTTTTCCTGTCTTCATTTGGTGTCCTGAAGAAGAAGGACAGTTTTATCCTGGAAGAGCTTCAAGATGGTGGATGAAACAATCACTTGCTCACTTATCTCAATCCTTGAAGGCTCTTGGATCTGACCTCACTTTAATCAAAACCCACAACACGATTTCAGCGATCTTGGATTGTATCCGCGTTACCGGTGCTACAAAAGTCGTCTTTAACCACCTCTATGATCCTGTTTCGTTAGTTCGGGACCATACCGTAAAGGAGAAGCTGGTGGAACGTGGGATCTCTGTGCAAAGCTACAATGGAGATCTATTGTATGAACCGTGGGAGATATACTGCGAAAAGGGCAAACCTTTTACGAGTTTCAATTCTTACTGGAAGAAATGCTTAGATATGTCGATTGAATCCGTTATGCTTCCTCCTCCTTGGCGGTTGATGCCAATAACTGCAGCGGCTGAAGCGATTTGGGCGTGTTCGATTGAAGAACTAGGGCTGGAGAATGAGGCCGAGAAACCGAGCAATGCGTTGTTAACTAGAGCTTGGTCTCCAGGATGGAGCAATGCTGATAAGTTACTAAATGAGTTCATCGAGAAGCAGTTGATAGATTATGCAAAGAACAGCAAGAAAGTTGTTGGGAATTCTACTTCACTACTTTCTCCGTATCTCCATTTCGGGGAAATAAGCGTCAGACACGTTTTCCAGTGTGCCCGGATGAAACAAATTATATGGGCAAGAGATAAGAACAGTGAAGGAGAAGAAAGTGCAGATCTTTTTCTTAGGGGAATCGGTTTAAGAGAGTATTCTCGGTATATATGTTTCAACTTCCCGTTTACTCACGAGCAATCGTTGTTGAGTCATCTTCGGTTTTTCCCTTGGGATGCTGATGTTGATAAGTTCAAGGCCTGGAGACAAGGCAGGACCGGTTATCCGTTGGTGGATGCCGGAATGAGAGAGCTTTGGGCTACCGGATGGATGCATAACAGAATAAGAGTGATTGTTTCAAGCTTTGCTGTGAAGTTTCTTCTCCTTCCATGGAAATGGGGAATGAAGTATTTCTGGGATACACTTTTGGATGCTGATTTGGAATGTGACATCCTTGGCTGGCAGTATATCTCTGGGAGTATCCCCGATGGCCACGAGCTTGATCGCTTGGACAATCCCGCGTTACAAGGCGCCAAATATGACCCAGAAGGTGAGTACATAAGGCAATGGCTTCCCGAGCTTGCGAGATTGCCAACTGAATGGATCCATCATCCATGGGACGCTCCTTTAACCGTACTCAAAGCTTCTGGTGTGGAACTCGGAACAAACTATGCGAAACCCATTGTAGACATCGACACAGCTCGTGAGCTACTAGCTAAAGCTATTTCAAGAACCCGTGAAGCACAGATCATGATCGGAGCAGCACCTGATGAGATTGTAGCAGATAGCTTCGAGGCCTTAGGGGCTAATACCATTAAAGAACCTGGTCTTTGCCCATCTGTGTCTTCTAATGACCAACAAGTACCTTCGGCTGTTCGTTACAACGGGTCAAAGAGAGTGAAACCTGAGGAAGAAGAAGAGAGAGACATGAAGAAATCTAGGGGATTCGATGAAAGGGAGTTGTTTTCGACTGCTGAATCTTCTTCTTCTTCGAGTGTGTTTTTCGTTTCGCAGTCTTGCTCGTTGGCATCAGAAGGGAAGAATCTGGAAGGTATTCAAGATTCATCTGATCAGATTACTACAAGTTTGGGAAAAAATGGTTGCAAATGA

 

2

 

68414.m00431 cryptochrome 2 apoprotein (CRY2) / blue light photoreceptor (PHH1) 97% identical to photolysase (PHH1) (SP:Q96524) and cryptochrome 2 apoprotein (CRY2) (SP:U43397). ESTs gb|W43661 and gb|Z25638 come from this gene; contains Pfam profiles PF03441: FAD binding domain of DNA photolyase and PF00875: deoxyribodipyrimidine photolyase; identical to cDNA Cvi cryptochrome 2 (CRY2) GI:18026275

 

MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGSKRVKPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSDQITTSLGKNGCK*

 

403

 

AT1G09530

GO:0003677|GO:0003677|GO:0003677|GO:0003700|GO:0003700|GO:0007165|GO:0030528|GO:0030528|GO:0031539|GO:0031539|GO:0005634|GO:0005515|GO:0009639|GO:0030528|GO:0010017|GO:0010017|GO:0003677|GO:0003700|GO:0007165|GO:0030528

-

BHLH008|AtbHLH8

Show
AT1G09530

AT1G09530

 

GO:0003677|GO:0003677|GO:0003677|GO:0003700|GO:0003700|GO:0007165|GO:0030528|GO:0030528|GO:0031539|GO:0031539|GO:0005634|GO:0005515|GO:0009639|GO:0030528|GO:0010017|GO:0010017|GO:0003677|GO:0003700|GO:0007165|GO:0030528

 

-

 

Transcription Factor|NULL

 

basic Helix-Loop-Helix (bHLH) Transcription Factor|bHLH Transcription Factor Family

 

BHLH008|AtbHLH8

 

PIF3|PIF3

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

4

 

4

 

31

 

1

 

10

 

2

 

6

 

0

 

2

 

2

 

0

 

1

 

0

 

4

 

0

 

0

 

0

 

2

 

1

 

1

 

5

 

5

 

32

 

2

 

12

 

1

 

8

 

0

 

2

 

2

 

0

 

1

 

0

 

4

 

0

 

0

 

F14J9 putative transcription factor BHLH8

 

ATGCCTCTGTTTGAGCTTTTCAGGCTCACCAAAGCTAAGCTTGAATCTGCTCAAGACAGGAACCCTTCTCCACCTGTAGATGAAGTTGTGGAGCTGGTGTGGGAAAATGGTCAGATATCAACTCAAAGTCAGTCAAGTAGATCGAGGAACATTCCTCCACCACAAGCAAACTCTTCTAGAGCTAGAGAGATTGGAAATGGCTCAAAGACGACTATGGTGGACGAGATCCCTATGTCAGTGCCATCACTAATGACGGGTTTGAGTCAAGACGATGACTTTGTTCCATGGTTGAATCATCATCCCTCCCTTGATGGATATTGCTCTGATTTCTTGCGTGATGTGTCGTCTCCTGTTACTGTCAACGAGCAAGAGAGTGATATGGCGGTAAACCAAACTGCTTTCCCGTTGTTTCAGAGAAGAAAGGATGGCAATGAATCAGCTCCTGCTGCTTCTTCGTCGCAGTATAACGGTTTCCAATCGCATTCTCTGTATGGAAGTGATAGAGCTAGAGATCTTCCTAGCCAACAAACCAATCCGGATCGGTTTACTCAGACGCAGGAACCACTAATTACTAGTAACAAGCCTAGTTTGGTCAACTTTTCACATTTCTTACGCCCTGCAACTTTTGCGAAGACTACTAATAATAACCTTCATGACACTAAAGAAAAGAGTCCTCAAAGCCCGCCAAATGTGTTTCAGACCAGAGTTCTTGGAGCTAAAGACTCTGAAGATAAGGTTCTTAACGAGTCTGTTGCTTCTGCTACGCCTAAAGATAACCAAAAGGCTTGCCTAATATCAGAGGACTCATGTAGAAAAGACCAAGAGAGTGAAAAAGCAGTTGTATGTTCTTCTGTTGGCTCGGGTAATAGTCTCGATGGCCCATCCGAAAGTCCTTCACTTTCTTTAAAGAGAAAGCATTCGAATATTCAAGACATTGACTGTCATAGTGAAGATGTGGAAGAAGAATCAGGAGATGGAAGAAAGGAAGCAGGTCCATCTCGAACGGGTTTGGGTTCAAAGAGAAGCCGCTCTGCAGAAGTGCATAATCTGTCTGAAAGGAGACGGCGTGATAGGATCAACGAGAAGATGCGTGCCCTGCAAGAACTCATTCCAAACTGTAACAAGGTGGACAAAGCTTCGATGCTAGATGAAGCCATCGAGTATCTCAAGTCACTCCAACTTCAAGTGCAGATCATGTCAATGGCGTCTGGTTACTATCTGCCACCGGCGGTTATGTTCCCACCGGGTATGGGGCATTACCCGGCAGCAGCTGCTGCAATGGCAATGGGTATGGGAATGCCTTATGCAATGGGCTTGCCTGATTTGAGCCGTGGTGGTTCATCGGTTAACCACGGACCACAGTTCCAAGTCTCGGGGATGCAACAACAACCAGTGGCGATGGGTATTCCACGTGTCTCTGGTGGTGGTATCTTTGCCGGTTCTTCGACGATTGGCAATGGCTCGACTAGAGATTTATCTGGTTCTAAAGATCAAACAACGACGAATAACAACAGTAACTTGAAACCAATAAAGAGAAAACAGGGGTCTTCTGATCAGTTTTGTGGATCGTCGTGA

 

2

 

68414.m01069 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana]

 

MPLFELFRLTKAKLESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPPPQANSSRAREIGNGSKTTMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPSLDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLFQRRKDGNESAPAASSSQYNGFQSHSLYGSDRARDLPSQQTNPDRFTQTQEPLITSNKPSLVNFSHFLRPATFAKTTNNNLHDTKEKSPQSPPNVFQTRVLGAKDSEDKVLNESVASATPKDNQKACLISEDSCRKDQESEKAVVCSSVGSGNSLDGPSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQIMSMASGYYLPPAVMFPPGMGHYPAAAAAMAMGMGMPYAMGLPDLSRGGSSVNHGPQFQVSGMQQQPVAMGIPRVSGGGIFAGSSTIGNGSTRDLSGSKDQTTTNNNSNLKPIKRKQGSSDQFCGSS*

 

949

 

AT3G29030

GO:0005576|GO:0003674|GO:0003674|GO:0012505|GO:0009826|GO:0009826|GO:0009831|GO:0009831|GO:0009828|GO:0009828

-

AtEXPA5

Show
AT3G29030

AT3G29030

 

GO:0005576|GO:0003674|GO:0003674|GO:0012505|GO:0009826|GO:0009826|GO:0009831|GO:0009831|GO:0009828|GO:0009828

 

-

 

Expansins

 

Alpha-Expansin Gene Family

 

AtEXPA5

 

EXP5

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

0

 

216

 

65

 

0

 

102

 

18

 

15

 

10

 

32

 

0

 

9

 

5

 

0

 

47

 

36

 

0

 

0

 

2

 

1

 

1

 

0

 

255

 

76

 

0

 

120

 

20

 

16

 

13

 

35

 

0

 

12

 

5

 

0

 

52

 

57

 

0

 

K5K13 Expansin (AtEXPA5)

 

ATGGGAGTTTTAGTAATCTCGCTTCTCGTGGTTCATCTCCTAGCTTTTTCCGTCTGCGTTCAGGGCGGCTACCGTCGTGGCGGACACCATCCCGGCGGTCACATGGGACCTTGGATCAACGCTCATGCCACTTTTTACGGCGGCGGTGATGCTTCCGGCACTATGGGTGGAGCATGCGGGTACGGCAATCTGTATAGCCAAGGTTATGGACTGGAGACGGCAGCGCTGAGCACAGCGTTATTCGACCAAGGACTTAGTTGTGGCGCATGTTTTGAGCTGATGTGTGTCAACGATCCTCAATGGTGCATAAAAGGCCGATCCATTGTGGTCACTGCCACTAACTTTTGTCCTCCTGGTGGTGCATGCGACCCTCCCAACCACCATTTCGATCTTTCTCAGCCGATCTACGAGAAAATTGCTCTCTACAAATCCGGTATCATTCCCGTTATGTATAGAAGGGTTCGGTGCAAGAGAAGTGGTGGGATAAGGTTCACGATCAACGGCCACTCATACTTTAACTTGGTGTTGGTCACAAACGTGGGTGGAGCCGGGGACGTACACTCGGTCTCAATGAAAGGGTCGAGGACAAAATGGCAATTAATGTCGAGAAATTGGGGGCAAAATTGGCAAAGCAACTCTTATCTCAATGGTCAAAGTCTGTCGTTTGTTGTTACCACAAGTGATCGTCGAAGTGTCGTCTCTTTTAATGTTGCACCACCCACTTGGTCCTTTGGCCAGACCTACACCGGAGGGCAGTTTCGGTATTAA

 

1

 

68416.m03627 expansin, putative (EXP5) identical to expansin At-EXP5 GB:AAB38071 from [Arabidopsis thaliana]; alpha-expansin gene family, PMID:11641069

 

MGVLVISLLVVHLLAFSVCVQGGYRRGGHHPGGHMGPWINAHATFYGGGDASGTMGGACGYGNLYSQGYGLETAALSTALFDQGLSCGACFELMCVNDPQWCIKGRSIVVTATNFCPPGGACDPPNHHFDLSQPIYEKIALYKSGIIPVMYRRVRCKRSGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSMKGSRTKWQLMSRNWGQNWQSNSYLNGQSLSFVVTTSDRRSVVSFNVAPPTWSFGQTYTGGQFRY*

 

14409

 

AT1G22770

GO:0005654|GO:0005654|GO:0005634|GO:0003674|GO:0009637|GO:0007623|GO:0009409|GO:0009409|GO:0009908|GO:0045449|GO:0045449|GO:0045449|GO:0042542|GO:0042752|GO:0048578|GO:0048578|GO:0010378

-

NULL

Show
AT1G22770

AT1G22770

 

GO:0005654|GO:0005654|GO:0005634|GO:0003674|GO:0009637|GO:0007623|GO:0009409|GO:0009409|GO:0009908|GO:0045449|GO:0045449|GO:0045449|GO:0042542|GO:0042752|GO:0048578|GO:0048578|GO:0010378

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

23

 

0

 

0

 

0

 

4

 

62

 

97

 

94

 

11

 

38

 

75

 

184

 

43

 

18

 

8

 

160

 

0

 

2

 

1

 

1

 

28

 

0

 

0

 

0

 

2

 

68

 

100

 

91

 

5

 

39

 

87

 

186

 

44

 

5

 

4

 

208

 

T22J18 GIGANTEA (GI)

 

ATGGCTAGTTCATCTTCATCTGAGAGATGGATCGATGGTCTTCAGTTCTCTTCCTTGTTATGGCCTCCGCCACGAGATCCTCAACAACATAAGGATCAAGTCGTTGCTTATGTTGAATATTTTGGTCAATTTACATCAGAGCAATTCCCAGATGACATTGCTGAGTTGGTCCGGCATCAGTATCCATCAACTGAGAAGCGACTTTTAGACGATGTGCTGGCGATGTTTGTCCTTCATCATCCGGAGCATGGTCATGCAGTCATTCTTCCAATCATTTCATGTCTTATTGATGGCTCGTTGGTGTACAGCAAGGAAGCTCATCCGTTTGCCTCTTTCATATCTTTAGTTTGCCCAAGTAGTGAGAATGACTATTCGGAGCAATGGGCTTTGGCATGTGGAGAAATCCTTCGCATTTTGACTCATTACAACCGTCCCATTTATAAAACTGAGCAGCAAAATGGAGATACAGAGAGAAATTGTCTGAGCAAAGCTACAACTAGTGGTTCTCCGACTTCAGAGCCTAAGGCTGGATCACCAACACAGCATGAAAGGAAACCTTTAAGGCCTTTGTCTCCATGGATCAGTGATATACTACTTGCTGCTCCTCTTGGTATAAGAAGTGACTATTTCCGATGGTGTAGTGGTGTAATGGGTAAATATGCTGCTGGAGAGCTCAAGCCGCCAACCATTGCTTCTCGAGGATCTGGTAAACATCCTCAACTGATGCCTTCAACCCCAAGATGGGCTGTTGCTAATGGAGCTGGTGTCATACTGAGTGTTTGTGATGATGAAGTTGCTCGATATGAGACTGCTACGCTGACAGCGGTCGCTGTCCCTGCACTTCTTCTTCCTCCGCCAACGACATCCTTAGATGAGCATCTAGTTGCTGGCCTTCCAGCTCTTGAACCATATGCACGTTTGTTTCATAGATACTATGCCATTGCAACTCCAAGTGCTACGCAGAGACTTCTTCTTGGACTCTTAGAAGCACCACCGTCGTGGGCTCCAGATGCACTTGATGCTGCTGTACAGCTTGTGGAACTCCTTCGAGCTGCTGAAGATTATGCATCTGGTGTAAGGCTACCCAGGAACTGGATGCATTTGCACTTCTTGCGGGCTATAGGAATTGCTATGTCTATGAGGGCAGGTGTTGCTGCTGATGCTGCAGCCGCTTTGCTTTTCCGCATACTCTCACAGCCGGCACTGCTTTTTCCTCCGCTAAGTCAAGTTGAGGGAGTAGAAATTCAGCACGCGCCTATTGGTGGCTACAGTTCAAATTACAGAAAACAGATAGAAGTTCCTGCAGCAGAAGCAACCATTGAAGCCACTGCCCAAGGAATTGCCTCAATGCTTTGTGCTCATGGTCCTGAAGTTGAGTGGAGAATTTGCACTATATGGGAAGCTGCTTATGGTTTGATCCCTTTAAATTCTTCGGCGGTTGATCTTCCCGAAATCATAGTTGCTACCCCACTGCAACCTCCTATCTTGTCATGGAATTTATACATTCCACTCCTCAAAGTACTTGAATATCTTCCACGGGGGAGTCCTTCGGAAGCATGCTTGATGAAAATATTTGTTGCCACTGTGGAAACAATACTCAGTAGAACTTTTCCGCCTGAATCTTCCAGGGAACTAACCAGAAAAGCTAGATCGAGTTTTACCACAAGATCAGCGACCAAAAATCTTGCTATGTCTGAGCTTCGTGCTATGGTCCATGCTCTCTTTTTAGAATCATGCGCTGGTGTGGAATTAGCTTCACGCCTACTTTTTGTTGTGTTGACTGTATGTGTTAGCCATGAAGCACAGTCTAGTGGTAGCAAGAGACCGAGAAGTGAATATGCTAGTACTACTGAAAATATTGAGGCGAATCAACCTGTATCTAACAATCAAACTGCTAACCGTAAAAGTAGGAATGTCAAGGGACAGGGACCTGTGGCAGCATTTGATTCATACGTTCTTGCTGCTGTTTGTGCTCTTGCCTGTGAGGTTCAGCTGTATCCTATGATCTCTGGTGGGGGGAACTTTTCCAATTCTGCCGTGGCTGGAACTATTACAAAGCCTGTAAAGATAAATGGGTCATCTAAAGAGTATGGAGCTGGGATTGACTCGGCAATTAGTCATACGCGCCGAATTTTGGCAATCCTAGAGGCACTCTTTTCATTAAAACCATCTTCTGTGGGGACTCCATGGAGTTACAGTTCTAGTGAGATAGTTGCTGCGGCCATGGTTGCAGCTCATATTTCCGAACTGTTCAGACGTTCAAAGGCCTTGACGCATGCATTGTCTGGGTTGATGAGATGTAAGTGGGATAAGGAAATTCATAAAAGAGCATCATCATTATATAACCTCATAGATGTTCACAGCAAAGTTGTTGCCTCCATTGTTGACAAAGCTGAACCCTTGGAAGCCTACCTTAAGAATACACCGGTTCAGAAGGATTCTGTGACCTGTTTAAACTGGAAACAAGAGAACACATGTGCAAGCACCACATGCTTTGATACAGCGGTGACATCCGCCTCAAGGACTGAAATGAATCCAAGAGGAAACCATAAGTATGCTAGACATTCAGATGAAGGCTCAGGGAGACCCTCAGAGAAGGGTATCAAAGATTTCCTCTTGGATGCTTCTGATCTTGCGAATTTCCTCACAGCTGATAGACTCGCAGGGTTCTATTGTGGTACACAAAAGCTTTTGAGGTCAGTGCTTGCAGAGAAACCGGAGCTGTCTTTCTCCGTTGTTTCACTGTTATGGCACAAACTGATTGCTGCTCCTGAAATCCAGCCCACCGCAGAAAGCACCTCTGCGCAACAAGGATGGAGACAGGTTGTTGATGCGCTATGCAATGTCGTATCTGCAACGCCAGCGAAAGCAGCAGCAGCAGTTGTCCTTCAGGCTGAAAGGGAGTTGCAGCCTTGGATCGCCAAAGATGATGAAGAAGGCCAAAAAATGTGGAAAATCAACCAACGGATAGTCAAAGTGTTGGTGGAACTCATGCGCAATCATGACAGGCCTGAGTCACTGGTGATTCTCGCAAGTGCATCAGATCTTCTTCTGCGGGCAACTGATGGAATGCTTGTTGATGGAGAAGCTTGTACATTACCTCAACTTGAGCTACTTGAAGCCACGGCAAGAGCAATACAGCCGGTGCTAGCTTGGGGGCCATCTGGACTAGCAGTGGTCGACGGTTTATCCAATCTATTGAAGTGTCGTCTACCAGCAACAATACGGTGCCTTTCACACCCAAGTGCACACGTACGTGCCTTAAGCACGTCAGTACTACGTGATATCATGAACCAAAGCTCCATACCCATCAAAGTAACTCCAAAACTGCCAACAACAGAGAAGAACGGAATGAATAGTCCGTCCTATCGATTCTTCAACGCCGCCTCAATAGACTGGAAAGCCGATATCCAAAACTGTTTAAACTGGGAAGCTCACAGCTTGCTCTCCACAACTATGCCTACTCAGTTTCTCGACACTGCGGCTCGGGAACTCGGCTGTACTATATCCTTGTCCCAATAA

 

1

 

68414.m02845 gigantea protein (GI) identical to gigantea protein SP:Q9SQI2 from [Arabidopsis thaliana]

 

MASSSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASRGSGKHPQLMPSTPRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIAMSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEWRICTIWEAAYGLIPLNSSAVDLPEIIVATPLQPPILSWNLYIPLLKVLEYLPRGSPSEACLMKIFVATVETILSRTFPPESSRELTRKARSSFTTRSATKNLAMSELRAMVHALFLESCAGVELASRLLFVVLTVCVSHEAQSSGSKRPRSEYASTTENIEANQPVSNNQTANRKSRNVKGQGPVAAFDSYVLAAVCALACEVQLYPMISGGGNFSNSAVAGTITKPVKINGSSKEYGAGIDSAISHTRRILAILEALFSLKPSSVGTPWSYSSSEIVAAAMVAAHISELFRRSKALTHALSGLMRCKWDKEIHKRASSLYNLIDVHSKVVASIVDKAEPLEAYLKNTPVQKDSVTCLNWKQENTCASTTCFDTAVTSASRTEMNPRGNHKYARHSDEGSGRPSEKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRSVLAEKPELSFSVVSLLWHKLIAAPEIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAAVVLQAERELQPWIAKDDEEGQKMWKINQRIVKVLVELMRNHDRPESLVILASASDLLLRATDGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHPSAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFNAASIDWKADIQNCLNWEAHSLLSTTMPTQFLDTAARELGCTISLSQ*

 

2318

 

AT3G50000

GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0012505|GO:0016301

-

NULL

Show
AT3G50000

AT3G50000

 

GO:0016301|GO:0006468|GO:0006468|GO:0006468|GO:0012505|GO:0016301

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

1

 

1

 

0

 

1

 

3

 

0

 

0

 

0

 

2

 

27

 

0

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

1

 

2

 

0

 

1

 

4

 

0

 

0

 

0

 

1

 

31

 

0

 

PO_C_21 CASEIN KINASE II, ALPHA CHAIN 2 (CK II)

 

ATGTCGAAAGCTCGTGTTTATACCGATGTTAACGTGATCCGACCTAAGGATTATTGGGATTACGAATCTCTCAATGTTCAGTGGGGGGAGCAAGATGATTACGAGGTAGTGAGGAAGGTGGGGAGAGGGAAATACAGTGAGGTTTTTGAGGGGATTAACATGAATAACAATGAGAAGTGTATTATCAAGATTCTCAAGCCTGTTAAGAAGAAGAAGATTAGAAGGGAGATTAAAATACTTCAGAATCTTTGTGGAGGGCCAAATATTGTAAAGCTGCTTGATGTTGTCAGAGATCAACACTCAAAAACGCCAAGCTTGATATTTGAGTATGTAAACAGCACAGACTTTAAGGTTCTGTATCCAACATTGACTGATTATGACATTCGCTACTACATCTATGAGCTGTTGAAGGCTTTGGACTTCTGCCACTCACAAGGAATAATGCACAGAGATGTCAAGCCACACAATGTCATGATCGACCATGAGCTGCGCAAACTTCGCCTAATAGATTGGGGTCTCGCTGAGTTTTATCATCCTGGAAAAGAGTACAACGTCCGTGTGGCCTCAAGATACTTCAAAGGTCCCGAACTTCTAGTTGATTTACAGGACTATGACTATTCCTTGGACATGTGGAGCCTCGGTTGCATGTTTGCTGGGATGATATTCCGCAAGGAACCTTTCTTCTATGGCCATGACAACCAGGATCAGCTCGTCAAAATTGCCAAGGTACTCGGAACTGATGAATTGAATGCATATCTGAATAAGTATCAGTTAGAACTTGATACTCAACTAGAGGCACTTGTTGGGAGACATAGCAGGAAGCCTTGGTCCAAATTCATCAACGCTGACAATAGGCATTTGGTCTCACCTGAGGCGATTGATTATTTGGACAAGCTGCTCCGGTATGATCATCAAGACAGATTAACTGCAAAAGAAGCAATGGCTCATCCCTATTTCGCTCAAGTCAGGGCAGCAGAAAGCAGCAGAATGAGGACTCAATAG

 

1

 

68416.m05467 casein kinase II alpha chain 2 identical to casein kinase II, alpha chain 2 (CK II) [Arabidopsis thaliana] SWISS-PROT:Q08466

 

MHLIFFFSYFLRRYLLLLCAILILRAPLAHSLIPPLTCVNTGTVESDVTGIRFDRCLDTDSLAKISLSTVMSKARVYTDVNVIRPKDYWDYESLNVQWGEQDDYEVVRKVGRGKYSEVFEGINMNNNEKCIIKILKPVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTPSLIFEYVNSTDFKVLYPTLTDYDIRYYIYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNQDQLVKIAKVLGTDELNAYLNKYQLELDTQLEALVGRHSRKPWSKFINADNRHLVSPEAIDYLDKLLRYDHQDRLTAKEAMAHPYFAQVRAAESSRMRTQ*

 

15438

 

AT1G30040

GO:0009639|GO:0045487|GO:0045487|GO:0045543|GO:0010114|GO:0045487|GO:0045487|GO:0045543

-

NULL

Show
AT1G30040

AT1G30040

 

GO:0009639|GO:0045487|GO:0045487|GO:0045543|GO:0010114|GO:0045487|GO:0045487|GO:0045543

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation|gibberellin inactivation

 

1.14.11.-|1.14.11.-|1.14.11.-|1.14.11.-|1.14.11.-|1.14.11.-|1.14.11.-|1.14.11.-|1.14.11.13|1.14.11.-|1.14.11.-

 

gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase|gibberellin 2-oxidase

 

0

 

4

 

1

 

1

 

333

 

22

 

3

 

3

 

52

 

4

 

4

 

5

 

0

 

0

 

1

 

0

 

0

 

6

 

0

 

81

 

0

 

4

 

1

 

1

 

353

 

25

 

3

 

4

 

54

 

3

 

5

 

5

 

0

 

0

 

1

 

0

 

0

 

3

 

0

 

94

 

T1P2 unknown protein

 

ATGGTGGTTTTGCCACAGCCAGTCACTTTAGATAACCACATCTCCCTAATCCCCACATACAAACCGGTTCCGGTTCTCACTTCCCATTCAATCCCCGTCGTCAACCTAGCCGATCCGGAAGCGAAAACCCGAATCGTAAAAGCCTGCGAGGAGTTCGGGTTCTTCAAGGTCGTAAACCACGGAGTCCGACCCGAACTCATGACTCGGTTAGAGCAGGAGGCTATTGGCTTCTTCGGCTTGCCTCAGTCTCTTAAAAACCGGGCCGGTCCACCTGAACCGTACGGTTATGGTAATAAACGGATTGGACCAAACGGTGACGTTGGTTGGATTGAGTATCTCCTCCTCAATGCTAATCCTCAGCTCTCCTCTCCTAAAACCTCCGCCGTTTTCCGTCAAACCCCTCAAATTTTCCGTGAGTCGGTGGAGGAGTACATGAAGGAGATTAAGGAAGTGTCGTACAAGGTGTTGGAGATGGTTGCCGAAGAACTAGGGATAGAGCCAAGGGACACTCTGAGTAAAATGCTGAGAGATGAGAAGAGTGACTCGTGCCTGAGACTAAACCATTATCCGGCGGCGGAGGAAGAGGCGGAGAAGATGGTGAAGGTGGGGTTTGGGGAACACACAGACCCACAGATAATCTCAGTGCTAAGATCTAATAACACGGCGGGTCTTCAAATCTGTGTGAAAGATGGAAGTTGGGTCGCTGTCCCTCCTGATCACTCTTCTTTCTTCATTAATGTTGGAGATGCTCTTCAGGTTATGACTAACGGGAGGTTCAAGAGTGTTAAACACAGGGTCTTAGCCGATACAAGGAGATCGAGGATTTCAATGATATATTTCGGCGGACCGCCATTGAGCCAGAAGATCGCACCATTGCCATGCCTTGTCCCTGAGCAAGATGATTGGCTTTACAAAGAATTCACTTGGTCTCAATACAAATCTTCTGCTTACAAGTCTAAGCTTGGTGATTATAGACTTGGTCTCTTTGAGAAACAACCTCTTCTCAATCATAAAACCCTTGTATGA

 

1

 

68414.m03673 gibberellin 2-oxidase / GA2-oxidase (GA2OX2) identical to GI:4678368 ga2ox2

 

MVVLPQPVTLDNHISLIPTYKPVPVLTSHSIPVVNLADPEAKTRIVKACEEFGFFKVVNHGVRPELMTRLEQEAIGFFGLPQSLKNRAGPPEPYGYGNKRIGPNGDVGWIEYLLLNANPQLSSPKTSAVFRQTPQIFRESVEEYMKEIKEVSYKVLEMVAEELGIEPRDTLSKMLRDEKSDSCLRLNHYPAAEEEAEKMVKVGFGEHTDPQIISVLRSNNTAGLQICVKDGSWVAVPPDHSSFFINVGDALQVMTNGRFKSVKHRVLADTRRSRISMIYFGGPPLSQKIAPLPCLVPEQDDWLYKEFTWSQYKSSAYKSKLGDYRLGLFEKQPLLNHKTLV*

 

2974

 

AT3G54890

GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0016168|GO:0015979|GO:0030076|GO:0009768|GO:0009768|GO:0010287|GO:0010287|GO:0010287|GO:0010287|GO:0015979|GO:0030076|GO:0015979|GO:0030076

-

NULL

Show
AT3G54890

AT3G54890

 

GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0009535|GO:0016168|GO:0015979|GO:0030076|GO:0009768|GO:0009768|GO:0010287|GO:0010287|GO:0010287|GO:0010287|GO:0015979|GO:0030076|GO:0015979|GO:0030076

 

-

 

Chloroplast and Mitochondria gene families

 

Chlorophyll a/b-binding protein family

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

149

 

663

 

0

 

428

 

925

 

1102

 

329

 

118

 

13

 

487

 

3466

 

1668

 

1115

 

374

 

3

 

0

 

4

 

1

 

1

 

0

 

172

 

735

 

0

 

481

 

1005

 

1235

 

366

 

128

 

16

 

529

 

3726

 

1832

 

1199

 

451

 

2

 

GE_C_20 chlorophyll a/b-binding protein

 

ATGGCGTCGAACTCGCTTATGAGCTGTGGCATAGCCGCCGTGTACCCTTCGCTTCTCTCTTCTTCCAAGTCTAAATTCGTATCCGCCGGAGTTCCACTCCCAAACGCCGGGAATGTTGGTCGTATCAGAATGGCTGCTCACTGGATGCCTGGCGAGCCACGACCAGCTTACCTTGACGGTTCTGCTCCTGGTGACTTTGGGTTTGACCCACTTGGACTTGGAGAAGTTCCAGCGAACCTTGAGAGATACAAAGAGTCAGAGCTCATCCACTGTAGATGGGCTATGCTCGCTGTTCCTGGGATTTTGGTACCAGAAGCATTAGGATATGGAAACTGGGTTAAGGCTCAGGAATGGGCAGCACTACCAGGGGGTCAAGCCACTTACTTGGGAAACCCAGTCCCGTGGGGTACTTTGCCCACAATCTTGGCCATTGAGTTCTTAGCCATTGCATTTGTTGAGCACCAGAGAAGTATGGAGAAAGACCCTGAGAAGAAGAAGTACCCGGGAGGCGCATTTGACCCTCTTGGATACTCGAAGGACCCCAAGAAGCTCGAGGAATTGAAAGTTAAAGAGATCAAGAACGGGCGGCTTGCGCTGTTGGCGTTTGTAGGATTCTGTGTGCAACAGTCGGCTTACCCGGGGACAGGACCATTGGAGAACTTGGCAACTCACTTGGCGGATCCATGGCACAACAACATTGGCGATATTGTTATCCCTTTCAACTAA

 

3

 

68416.m06083 chlorophyll A-B binding protein / LHCI type I (CAB) identical to chlorophyll A/B-binding protein [Arabidopsis thaliana] GI:16207; contains Pfam profile: PF00504 chlorophyll A-B binding protein

 

MASNSLMSCGIAAVYPSLLSSSKSKFVSAGVPLPNAGNVGRIRMAAHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAHLTLLDTRRTPRSSRN*

 

15942

 

AT1G69530

GO:0009505|GO:0003674|GO:0003674|GO:0009826|GO:0009826|GO:0009828|GO:0009828|GO:0003674|GO:0003674|GO:0009826|GO:0009826|GO:0009828|GO:0009828|GO:0003674|GO:0003674|GO:0009826|GO:0009826|GO:0009828|GO:0009828|GO:0006949|GO:0009739|GO:0010114

-

AtEXPA1

Show
AT1G69530

AT1G69530

 

GO:0009505|GO:0003674|GO:0003674|GO:0009826|GO:0009826|GO:0009828|GO:0009828|GO:0003674|GO:0003674|GO:0009826|GO:0009826|GO:0009828|GO:0009828|GO:0003674|GO:0003674|GO:0009826|GO:0009826|GO:0009828|GO:0009828|GO:0006949|GO:0009739|GO:0010114

 

-

 

Expansins

 

Alpha-Expansin Gene Family

 

AtEXPA1

 

EXP1

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

273

 

31

 

43

 

9

 

0

 

84

 

23

 

191

 

533

 

106

 

39

 

17

 

22

 

247

 

105

 

790

 

0

 

2

 

1

 

1

 

293

 

0

 

46

 

6

 

0

 

98

 

27

 

221

 

591

 

115

 

48

 

20

 

25

 

271

 

154

 

1102

 

F10D13 expansin-like protein (AtEXPA1)

 

ATGGCTCTTGTCACCTTCTTGTTTATTGCTACCCTTGGAGCAATGACGTCACATGTCAATGGTTACGCCGGAGGAGGTTGGGTCAACGCACACGCCACATTCTACGGTGGTGGTGATGCTTCCGGCACAATGGGAGGTGCTTGTGGATACGGAAACCTATATAGCCAAGGCTATGGAACCAACACGGCGGCGCTAAGCACGGCTCTATTCAATAATGGTCTAAGTTGTGGTGCTTGCTTCGAGATAAGATGTCAAAACGATGGAAAATGGTGTCTTCCTGGCTCAATTGTCGTCACAGCCACAAACTTTTGCCCTCCTAACAACGCCTTACCGAACAACGCAGGAGGTTGGTGTAACCCTCCTCAGCAGCATTTTGATCTCTCTCAGCCCGTATTTCAACGCATCGCTCAATACAGAGCCGGCATTGTCCCCGTCGCTTACCGAAGAGTGCCGTGCGTGAGAAGAGGAGGAATAAGGTTTACGATAAACGGACACTCTTACTTCAACCTAGTTCTGATCACTAACGTCGGAGGAGCCGGAGATGTTCACTCAGCGATGGTTAAAGGTTCAAGAACTGGATGGCAAGCGATGTCAAGAAACTGGGGACAGAACTGGCAGAGTAACTCTTACCTTAACGGACAATCTCTCTCATTCAAAGTTACAACAAGCGATGGCCAAACCATTGTCTCTAACAACGTTGCTAACGCAGGCTGGTCTTTCGGCCAGACCTTCACAGGTGCGCAGCTACGTTAG

 

3

 

68414.m07995 expansin, putative (EXP1) identical to expansin (At-EXP1) [Arabidopsis thaliana] GI:1041702; alpha-expansin gene family, PMID:11641069

 

MALVTFLFIATLGAMTSHVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCQNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGWSFGQTFTVEAVRERGMIVIWSFLSIEVNLKRSGASSA*

 

5982

 

AT4G08920

GO:0005737|GO:0005634|GO:0005524|GO:0004672|GO:0004672|GO:0009637|GO:0009637|GO:0007623|GO:0009414|GO:0009414|GO:0006118|GO:0009640|GO:0009640|GO:0009882|GO:0009826|GO:0009785|GO:0046283|GO:0046283|GO:0046777|GO:0046777|GO:0046777|GO:0010118|GO:0042803|GO:0042803|GO:0010343|GO:0005634

-

NULL

Show
AT4G08920

AT4G08920

 

GO:0005737|GO:0005634|GO:0005524|GO:0004672|GO:0004672|GO:0009637|GO:0009637|GO:0007623|GO:0009414|GO:0009414|GO:0006118|GO:0009640|GO:0009640|GO:0009882|GO:0009826|GO:0009785|GO:0046283|GO:0046283|GO:0046777|GO:0046777|GO:0046777|GO:0010118|GO:0042803|GO:0042803|GO:0010343|GO:0005634

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

16

 

0

 

0

 

91

 

78

 

60

 

108

 

26

 

21

 

84

 

54

 

279

 

43

 

46

 

0

 

4

 

1

 

1

 

0

 

0

 

14

 

0

 

0

 

88

 

90

 

49

 

112

 

25

 

11

 

75

 

55

 

269

 

36

 

43

 

T3H13 flavin-type blue-light photoreceptor (HY4)

 

ATGTCTGGTTCTGTATCTGGTTGTGGTTCTGGTGGTTGTAGTATTGTATGGTTTAGAAGAGATCTTAGGGTTGAAGATAATCCAGCTTTAGCAGCAGCAGTAAGAGCTGGTCCAGTGATTGCTCTGTTTGTTTGGGCACCAGAAGAAGAAGGACACTATCATCCAGGTAGGGTTTCTAGGTGGTGGCTCAAGAACAGTTTGGCTCAGCTTGATTCTTCTCTTAGAAGTCTTGGTACTTGTCTTATCACCAAGAGATCTACTGATAGTGTTGCTTCTCTTCTTGATGTTGTTAAATCCACTGGTGCTTCTCAGATCTTCTTCAACCATTTGTATGATCCATTGTCTTTGGTGCGTGATCACCGAGCTAAAGATGTTTTGACGGCGCAAGGCATAGCGGTTCGATCATTCAACGCAGACTTGCTTTATGAGCCATGGGAAGTGACTGATGAATTAGGCCGTCCTTTCTCTATGTTTGCTGCGTTTTGGGAGAGATGTCTTAGTATGCCTTATGACCCTGAGTCTCCTCTTCTTCCACCTAAGAAGATCATTTCAGGGGATGTGTCTAAATGTGTTGCGGATCCATTGGTGTTTGAGGATGACTCTGAGAAAGGAAGCAATGCACTTCTGGCTCGTGCTTGGTCTCCTGGATGGAGTAATGGTGATAAAGCTCTCACAACGTTTATAAACGGTCCATTGCTTGAATACTCTAAGAACCGCAGAAAAGCCGATAGTGCTACAACCTCGTTTCTTTCTCCACACTTGCATTTTGGGGAAGTGAGTGTGAGAAAAGTTTTTCATCTTGTTCGGATCAAACAGGTCGCGTGGGCAAACGAAGGAAACGAGGCCGGGGAAGAAAGCGTGAATCTTTTCCTGAAATCTATTGGTCTCAGGGAGTATTCTAGGTACATAAGTTTTAACCATCCATATTCCCATGAAAGACCACTTCTTGGCCATCTAAAGTTCTTCCCTTGGGCTGTGGATGAGAACTATTTCAAGGCATGGAGGCAAGGCCGGACTGGATATCCGTTGGTCGATGCCGGGATGAGAGAGTTATGGGCTACTGGTTGGTTGCATGATCGCATAAGAGTAGTTGTTTCAAGCTTCTTTGTTAAAGTGCTTCAATTACCATGGAGATGGGGGATGAAGTATTTCTGGGACACACTTCTTGATGCGGATTTAGAAAGCGATGCTCTTGGTTGGCAATACATTACCGGTACTCTCCCGGATAGCCGGGAGTTTGATCGCATAGATAACCCTCAGTTTGAAGGGTACAAGTTTGATCCAAATGGTGAATACGTAAGGCGATGGCTTCCTGAACTCTCTAGACTCCCGACAGACTGGATACATCATCCGTGGAACGCACCTGAGTCCGTTCTTCAAGCTGCTGGTATCGAGCTTGGATCAAACTATCCTCTACCAATTGTAGGATTAGACGAAGCAAAAGCACGGCTTCATGAAGCGCTTTCACAGATGTGGCAACTAGAAGCTGCTTCAAGAGCTGCAATAGAGAACGGATCCGAAGAAGGACTTGGAGATTCTGCTGAGGTAGAGGAAGCTCCTATAGAGTTCCCAAGGGACATTACAATGGAAGAGACTGAACCAACCAGACTCAACCCAAACAGGAGATATGAGGATCAGATGGTTCCAAGCATTACTTCTTCTTTGATCAGACCTGAAGAAGACGAAGAGTCGTCTCTTAATTTGAGAAATTCAGTAGGAGATAGCAGAGCAGAGGTTCCAAGGAACATGGTTAACACCAACCAAGCTCAGCAGCGGAGAGCAGAACCGGCTTCAAACCAAGTCACTGCTATGATTCCAGAATTTAATATCAGAATTGTTGCAGAGAGCACTGAAGACTCAACAGCGGAATCTTCCAGCAGCGGAAGGAGAGAAAGAAGCGGAGGCATAGTCCCCGAGTGGTCTCCAGGGTACTCAGAGCAGTTCCCTAGTGAAGAAAATGGTATTGGAGGAGGAAGTACAACGTCTAGCTACTTGCAGAATCACCATGAAATACTGAACTGGAGACGGCTTTCACAAACCGGGTAA

 

1

 

68417.m01469 cryptochrome 1 apoprotein (CRY1) / flavin-type blue-light photoreceptor (HY4) contains Pfam PF03441: FAD binding domain of DNA photolyase; member of Pfam PF00875: deoxyribodipyrimidine photolyase superfamily; 99% identical to Cryptochrome 1 apoprotein (Blue light photoreceptor) (flavin-type blue-light photoreceptor) (SP:Q43125) [Arabidopsis thaliana]

 

MSGSVSGCGSGGCSIVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPPKKIISGDVSKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYSRYISFNHPYSHERPLLGHLKFFPWAVDENYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGTLPDSREFDRIDNPQFEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEAKARLHEALSQMWQLEAASRAAIENGSEEGLGDSAEVEEAPIEFPRDITMEETEPTRLNPNRRYEDQMVPSITSSLIRPEEDEESSLNLRNSVGDSRAEVPRNMVNTNQAQQRRAEPASNQVTAMIPEFNIRIVAESTEDSTAESSSSGRRERSGGIVPEWSPGYSEQFPSEENGIGGGSTTSSYLQNHHEILNWRRLSQTG*

 

17585

 

AT1G68050

GO:0004842|GO:0007623|GO:0007623|GO:0006511|GO:0006511|GO:0006511|GO:0005575|GO:0009637|GO:0007623|GO:0009911|GO:0045449|GO:0045449|GO:0045449

-

NULL

Show
AT1G68050

AT1G68050

 

GO:0004842|GO:0007623|GO:0007623|GO:0006511|GO:0006511|GO:0006511|GO:0005575|GO:0009637|GO:0007623|GO:0009911|GO:0045449|GO:0045449|GO:0045449

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

4

 

3

 

1

 

3

 

0

 

3

 

0

 

1

 

0

 

6

 

0

 

0

 

0

 

0

 

4

 

1

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

23

 

0

 

0

 

T23K23 unknown protein

 

ATGGCGAGAGAACATGCGATCGGAGAAGCCACCGGAAAACGAAAGAAACGCGGCAGAGTTGAAGAAGCAGAAGAATACTGTAACGATGGAATCGAAGAACAAGTAGAGGATGAGAAGCTTCCGTTAGAGGTTGGGATGTTCTATTACCCAATGACTCCGCCTTCGTTCATTGTTTCCGATGCTCTGGAGCCAGATTTTCCTTTGATCTATGTCAACAGAGTCTTCGAAGTCTTCACTGGCTATCGTGCCGATGAAGTTCTTGGTCGTAACTGTCGATTCCTACAGTACAGAGATCCTCGAGCTCAAAGGCGTCACCCATTGGTTGATCCTGTGGTTGTATCTGAGATTAGGAGATGTCTTGAAGAAGGTATTGAATTCCAAGGAGAGCTTCTTAATTTCAGAAAAGATGGTACTCCTTTGGTTAACAGACTACGGCTTGCTCCAATACGTGACGATGATGGAACCATTACACACGTAATTGGGATACAGGTCTTCTCTGAAACGACTATAGACCTTGACCGTGTCTCGTATCCTGTGTTCAAACATAAACAACAGCTTGATCAAACATCTGAGTGCTTGTTTCCAAGTGGAAGCCCGAGGTTTAAGGAGCATCATGAAGATTTCTGTGGGATATTGCAGCTATCTGATGAAGTTTTGGCTCATAACATCTTATCTCGGTTAACTCCAAGGGACGTTGCTTCAATTGGTTCTGCTTGCAGGAGGTTGAGGCAGTTGACGAAGAACGAGAGTGTGAGGAAGATGGTATGTCAGAATGCGTGGGGAAAAGAGATAACTGGAACACTGGAGATTATGACTAAGAAGCTAAGATGGGGTCGGTTAGCTAGAGAGCTCACCACTCTTGAAGCTGTGTGTTGGCGTAAATTTACTGTTGGAGGGATTGTACAACCTTCCCGCTGCAATTTCAGCGCGTGTGCTGTTGGGAACCGGCTTGTGCTATTTGGTGGGGAAGGGGTTAACATGCAGCCATTGGATGATACTTTTGTTCTCAATCTTGATGCAGAGTGTCCTGAGTGGCAGCGTGTGAGGGTGACGTCGTCGCCTCCAGGACGTTGGGGACACACACTCTCGTGTCTCAACGGGTCGTGGTTGGTAGTCTTTGGAGGGTGTGGAAGACAAGGATTGCTTAATGATGTATTTGTGCTTGATCTAGACGCTAAGCATCCCACATGGAAGGAAGTAGCAGGAGGAACTCCTCCATTGCCAAGATCTTGGCACAGCTCGTGCACCATTGAGGGCTCTAAACTGGTTGTCTCAGGTGGCTGCACAGACGCTGGAGTGCTTCTCAGCGACACCTTCTTGTTGGATCTGACAACAGATAAACCGACATGGAAAGAGATCCCGACATCATGGGCTCCTCCTTCTAGACTTGGGCATTCTTTATCGGTCTTTGGTCGGACTAAAATCCTAATGTTTGGCGGGCTTGCAAATAGTGGTCATCTAAAGCTAAGGTCAGGGGAGGCATACACTATAGACTTGGAGGATGAAGAACCAAGATGGAGAGAGCTTGAGTGTAGCGCATTCCCAGGCGTGGTTGTACCGCCTCCAAGACTAGACCATGTGGCTGTGAGCATGCCGTGTGGTAGGGTCATCATCTTTGGAGGGTCGATTGCAGGGCTTCACTCTCCTTCGCAACTGTTTCTAATAGATCCTGCAGAAGAGAAACCGTCATGGAGGATCCTGAATGTCCCCGGGAAACCGCCTAAGTTAGCTTGGGGACATAGCACATGCGTTGTTGGAGGAACTAGAGTATTGGTCCTTGGTGGTCACACTGGTGAGGAATGGATACTCAATGAATTACATGAACTCTGCTTGGCTAGCCGGCAAGACTCGGATCTGTAA

 

1

 

68414.m07774 F-box family protein (FKF1) / adagio 3 (ADO3) E3 ubiquitin ligase SCF complex F-box subunit; identical to FKF1 GI:6960305 and Adagio 3 GI:13487072 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif, PF00785: PAC motif and PF00646: F-box domain; contains TIGRfam profile TIGR00229: PAS domain S-boxidentical to cDNA Adagio 3 (ADO3) GI:13487071

 

MAREHAIGEATGKRKKRGRVEEAEEYCNDGIEEQVEDEKLPLEVGMFYYPMTPPSFIVSDALEPDFPLIYVNRVFEVFTGYRADEVLGRNCRFLQYRDPRAQRRHPLVDPVVVSEIRRCLEEGIEFQGELLNFRKDGTPLVNRLRLAPIRDDDGTITHVIGIQVFSETTIDLDRVSYPVFKHKQQLDQTSECLFPSGSPRFKEHHEDFCGILQLSDEVLAHNILSRLTPRDVASIGSACRRLRQLTKNESVRKMVCQNAWGKEITGTLEIMTKKLRWGRLARELTTLEAVCWRKFTVGGIVQPSRCNFSACAVGNRLVLFGGEGVNMQPLDDTFVLNLDAECPEWQRVRVTSSPPGRWGHTLSCLNGSWLVVFGGCGRQGLLNDVFVLDLDAKHPTWKEVAGGTPPLPRSWHSSCTIEGSKLVVSGGCTDAGVLLSDTFLLDLTTDKPTWKEIPTSWAPPSRLGHSLSVFGRTKILMFGGLANSGHLKLRSGEAYTIDLEDEEPRWRELECSAFPGVVVPPPRLDHVAVSMPCGRVIIFGGSIAGLHSPSQLFLIDPAEEKPSWRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELHELCLASRQDSDL*

 

5821

 

AT4G16250

GO:0005634|GO:0009883|GO:0010017|GO:0010017|GO:0008020|GO:0004871|GO:0006355|GO:0006355|GO:0006355

-

PHYD

Show
AT4G16250

AT4G16250

 

GO:0005634|GO:0009883|GO:0010017|GO:0010017|GO:0008020|GO:0004871|GO:0006355|GO:0006355|GO:0006355

 

-

 

NULL

 

Histidine Kinase

 

PHYD

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

2

 

0

 

2

 

0

 

0

 

0

 

12

 

4

 

14

 

1

 

1

 

0

 

2

 

6

 

13

 

50

 

0

 

4

 

1

 

1

 

2

 

0

 

2

 

0

 

0

 

0

 

12

 

5

 

14

 

0

 

1

 

0

 

0

 

7

 

11

 

58

 

fca_all phytochrome D

 

ATGGTCTCCGGAGGTGGTAGCAAAACCAGCGGTGGAGAGGCAGCTTCCTCAGGCCATCGCCGAAGTCGTCACACCAGCGCTGCAGAACAAGCTCAGTCGTCAGCAAACAAAGCCCTAAGGTCACAGAATCAGCAGCCACAAAACCACGGTGGCGGAACAGAGTCCACAAACAAAGCTATTCAACAGTACACTGTCGACGCGAGACTCCACGCCGTCTTCGAACAATCCGGAGAGTCAGGTAAGTCGTTTGATTACTCACAGTCTCTTAAAACGGCGCCGTACGATTCCTCCGTACCAGAGCAGCAGATCACAGCTTATCTCTCCCGGATCCAACGCGGTGGCTATACCCAGCCTTTTGGCTGCTTGATCGCCGTCGAAGAATCCACTTTCACAATCATCGGTTACAGTGAAAATGCGCGGGAAATGCTAGGGCTCATGTCTCAATCTGTACCAAGCATCGAGGACAAATCAGAGGTTTTAACGATTGGTACGGATTTGCGATCTCTCTTCAAGTCATCGAGCTACCTTCTCCTCGAGCGCGCGTTCGTGGCTCGAGAGATCACGCTTCTGAATCCTATTTGGATTCACTCTAACAACACTGGTAAACCTTTCTACGCGATTCTCCACAGGGTTGATGTTGGAATTTTGATCGATTTAGAGCCGGCTCGAACCGAAGATCCGGCACTTTCAATCGCCGGAGCAGTCCAATCGCAGAAACTTGCGGTACGTGCGATTTCTCATTTACAATCGTTGCCTAGCGGCGACATTAAGCTTCTATGTGACACTGTTGTGGAAAGCGTTAGAGATCTTACTGGCTACGACCGCGTTATGGTGTACAAGTTTCATGAAGATGAACATGGTGAAGTCGTAGCCGAGAGTAAACGGAACGATTTAGAGCCTTACATTGGTCTGCATTATCCCGCTACTGATATTCCTCAGGCATCTCGGTTCTTGTTCAAGCAAAACCGTGTTAGGATGATAGTAGATTGCTATGCGTCACCGGTTCGTGTGGTTCAAGACGATAGGCTCACGCAGTTTATATGCTTGGTGGGTTCGACTTTGCGAGCTCCTCATGGCTGTCATGCTCAATACATGACTAACATGGGCTCTATTGCGTCGTTAGCTATGGCAGTTATAATAAATGGAAACGAAGAAGATGGTAATGGGGTTAATACTGGAGGAAGAAACTCGATGAGGCTTTGGGGTTTAGTTGTTTGCCATCACACATCAGCTCGTTGCATACCTTTTCCTTTGAGGTACGCTTGTGAGTTTCTTATGCAGGCCTTTGGCTTACAGCTAAACATGGAGTTGCAGTTAGCCTTGCAGGTGTCTGAAAAACGCGTTCTGAGAATGCAGACACTATTATGTGATATGCTTCTACGTGACTCACCAGCGGGGATTGTCACGCAGAGGCCTAGTATCATGGATTTAGTAAAATGTAATGGTGCGGCATTTCTTTACCAAGGGAAGTATTATCCGTTGGGTGTGACTCCAACTGATTCTCAGATTAATGACATTGTGGAGTGGTTGGTTGCTAACCATTCTGATTCTACCGGGTTAAGCACAGATAGTTTAGGCGATGCGGGTTATCCTCGGGCAGCTGCTTTGGGAGATGCTGTGTGCGGTATGGCAGTCGCGTGTATCACAAAAAGGGACTTCCTTTTCTGGTTTCGGTCTCATACTGAGAAAGAAATCAAATGGGGAGGGGCTAAGCACCATCCTGAGGACAAAGATGATGGTCAGCGGATGAATCCGCGTTCTTCGTTCCAGACTTTTCTCGAAGTTGTTAAGAGCCGATGTCAGCCATGGGAAACTGCTGAAATGGACGCCATTCACTCGCTCCAGCTTATTCTAAGAGACTCTTTCAAAGAGTCTGAAGCGATGGACTCTAAAGCTGCTGCAGCTGGGGCGGTTCAGCCACATGGAGATGATATGGTACAGCAAGGGATGCAGGAGATAGGTGCAGTTGCAAGAGAGATGGTTAGGCTCATTGAGACTGCGACGGTTCCTATATTTGCTGTGGACATAGACGGTTGCATCAATGGGTGGAACGCCAAGATCGCAGAGCTGACCGGTCTTTCTGTTGAAGACGCTATGGGAAAGTCGCTGGTTCGCGAATTGATATACAAAGAGTACAAAGAAACAGTTGATAGGCTTCTTTCTTGTGCTCTCAAAGGGGATGAAGGCAAGAATGTGGAGGTCAAGCTGAAAACTTTTGGTTCCGAGCTACAAGGAAAAGCAATGTTTGTGGTTGTCAACGCATGTTCAAGCAAGGACTACTTAAACAACATCGTTGGAGTCTGCTTTGTTGGACAAGATGTAACTGGTCATAAAATTGTTATGGACAAGTTCATCAACATACAAGGTGATTACAAGGCCATCATCCATAGCCCGAACCCTCTGATCCCTCCAATCTTTGCAGCGGATGAGAATACGTGCTGCCTTGAGTGGAACACTGCAATGGAAAAGCTCACAGGCTGGCCTCGCAGCGAAGTGATTGGAAAATTACTTGTTAGGGAAGTATTTGGGAGCTATTGCAGACTAAAGGGTCCTGATGCGTTAACTAAGTTCATGATCGTCTTGCATAACGCGATCGGTGGCCAAGATACTGATAAATTCCCATTCCCGTTCTTTGATCGCAAAGGGGAATTCATTCAGGCTCTCCTGACTTTGAACAAACGGGTCAGCATCGATGGCAAAATCATTGGGGCTTTCTGTTTTTTGCAGATACCGAGTCCCGAGCTGCAGCAAGCTCTAGAAGTTCAGAGGAGGCAGGAGAGTGAATATTTCTCAAGGAGGAAAGAGTTGGCTTACATTTTCCAAGTTATAAAGAATCCATTGAGTGGATTGCGTTTCACAAATTCATTGCTGGAAGACATGGATTTAAACGAGGATCAGAAGCAGCTTCTTGAAACGAGTGTTTCATGTGAGAAGCAGATCTCAAAGATTGTAGGAGACATGGACGTCAAAAGCATAGATGACGGTTCATTTCTGCTAGAGAGAACAGAGTTCTTCATTGGCAATGTCACAAATGCAGTGGTAAGCCAAGTCATGTTGGTGGTGAGAGAGAGAAATCTCCAGCTGATCCGTAACATTCCCACGGAGGTCAAATCCATGGCTGTCTACGGTGACCAGATAAGGCTCCAACAGGTTCTCGCAGAATTTCTGCTAAGTATTGTCCGTTATGCACCCATGGAAGGCTCGGTAGAGCTCCATCTATGCCCGACTCTGAACCAAATGGCTGACGGATTCTCCGCTGTACGTTTGGAGTTCAGAATGGCGTGTGCAGGGGAAGGTGTGCCGCCAGAGAAAGTGCAAGACATGTTCCATAGTAGCCGATGGACAAGTCCAGAAGGATTAGGACTAAGCGTTTGCAGAAAGATTTTGAAGCTGATGAACGGAGGGGTTCAGTACATAAGAGAATTCGAACGCTCTTATTTCCTAATCGTTATCGAACTCCCGGTTCCTCTAATGATGATGATGCCCTCTTCATGA

 

1

 

68417.m02465 phytochrome D (PHYD) nearly identical to SP|P42497 Phytochrome D {Arabidopsis thaliana}

 

MVSGGGSKTSGGEAASSGHRRSRHTSAAEQAQSSANKALRSQNQQPQNHGGGTESTNKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTAPYDSSVPEQQITAYLSRIQRGGYTQPFGCLIAVEESTFTIIGYSENAREMLGLMSQSVPSIEDKSEVLTIGTDLRSLFKSSSYLLLERAFVAREITLLNPIWIHSNNTGKPFYAILHRVDVGILIDLEPARTEDPALSIAGAVQSQKLAVRAISHLQSLPSGDIKLLCDTVVESVRDLTGYDRVMVYKFHEDEHGEVVAESKRNDLEPYIGLHYPATDIPQASRFLFKQNRVRMIVDCYASPVRVVQDDRLTQFICLVGSTLRAPHGCHAQYMTNMGSIASLAMAVIINGNEEDGNGVNTGGRNSMRLWGLVVCHHTSARCIPFPLRYACEFLMQAFGLQLNMELQLALQVSEKRVLRMQTLLCDMLLRDSPAGIVTQRPSIMDLVKCNGAAFLYQGKYYPLGVTPTDSQINDIVEWLVANHSDSTGLSTDSLGDAGYPRAAALGDAVCGMAVACITKRDFLFWFRSHTEKEIKWGGAKHHPEDKDDGQRMNPRSSFQTFLEVVKSRCQPWETAEMDAIHSLQLILRDSFKESEAMDSKAAAAGAVQPHGDDMVQQGMQEIGAVAREMVRLIETATVPIFAVDIDGCINGWNAKIAELTGLSVEDAMGKSLVRELIYKEYKETVDRLLSCALKGDEGKNVEVKLKTFGSELQGKAMFVVVNACSSKDYLNNIVGVCFVGQDVTGHKIVMDKFINIQGDYKAIIHSPNPLIPPIFAADENTCCLEWNTAMEKLTGWPRSEVIGKLLVREVFGSYCRLKGPDALTKFMIVLHNAIGGQDTDKFPFPFFDRKGEFIQALLTLNKRVSIDGKIIGAFCFLQIPSPELQQALEVQRRQESEYFSRRKELAYIFQVIKNPLSGLRFTNSLLEDMDLNEDQKQLLETSVSCEKQISKIVGDMDVKSIDDGSFLLERTEFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRYAPMEGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGLGLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPLMMMMPSS*

 

18400

 

AT5G02810

GO:0005739|GO:0007623|GO:0030528|GO:0005634|GO:0000156|GO:0000156|GO:0007623|GO:0009266|GO:0010017|GO:0010017

-

APRR7

Show
AT5G02810

AT5G02810

 

GO:0005739|GO:0007623|GO:0030528|GO:0005634|GO:0000156|GO:0000156|GO:0007623|GO:0009266|GO:0010017|GO:0010017

 

-

 

Response Regulator

 

Response Regulator: Pseudo

 

APRR7

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

33

 

6

 

0

 

0

 

2

 

99

 

115

 

28

 

4

 

0

 

10

 

107

 

49

 

61

 

0

 

132

 

0

 

4

 

1

 

1

 

35

 

8

 

0

 

0

 

2

 

101

 

126

 

29

 

5

 

0

 

8

 

112

 

50

 

67

 

0

 

150

 

tn_e_21 unknown protein

 

ATGAATGCTAATGAGGAGGGGGAGGGTTCACGTTACCCAATCACTGATCGAAAGACCGGAGAGACGAAATTCGATAGGGTTGAGAGTCGGACAGAGAAGCATAGTGAAGAAGAGAAAACTAATGGAATTACTATGGATGTGAGAAATGGGAGTTCAGGTGGACTGCAAATTCCATTGTCGCAACAAACAGCGGCAACTGTCTGTTGGGAAAGGTTTCTTCATGTGAGAACCATTAGAGTTCTGCTTGTCGAAAATGACGACTGCACTCGTTATATCGTTACTGCACTTCTTCGCAATTGTAGCTATGAAGTTGTTGAGGCGTCAAATGGGATACAAGCTTGGAAGGTGTTAGAAGATCTAAACAATCATATTGATATTGTGCTAACAGAGGTGATCATGCCTTACTTATCTGGTATCGGTCTCTTGTGCAAGATTTTGAACCACAAATCTCGTCGGAACATCCCTGTCATCATGATGTCATCTCATGACTCAATGGGGCTGGTCTTTAAGTGCTTATCGAAAGGAGCTGTTGACTTTCTTGTTAAGCCAATAAGAAAAAATGAGCTTAAGATCCTTTGGCAGCATGTTTGGAGAAGATGCCAAAGTTCTAGTGGTAGTGGAAGTGAGAGCGGAACGCATCAAACTCAAAAGTCTGTGAAATCGAAAAGTATTAAAAAATCTGATCAAGATTCAGGAAGCAGTGATGAGAATGAAAATGGGAGCATTGGCCTGAATGCTAGTGATGGAAGTAGTGATGGGAGTGGCGCTCAGAGCTCTTGGACGAAAAAAGCTGTGGATGTTGATGACAGTCCACGAGCGGTATCTCTATGGGACCGAGTTGATAGCACTTGCGCCCAAGTGGTACATTCTAACCCTGAGTTTCCAAGTAATCAGTTGGTTGCACCACCTGCTGAGAAGGAGACTCAAGAACATGATGATAAATTTGAAGATGTCACAATGGGTAGAGACTTGGAGATTAGCATTCGTAGAAACTGTGATCTGGCCCTGGAGCCAAAAGATGAACCCCTATCTAAAACTACTGGCATTATGAGACAGGATAATTCGTTTGAAAAGAGCTCTAGTAAATGGAAAATGAAAGTTGGAAAAGGACCATTGGACCTCAGTAGCGAAAGTCCTTCAAGTAAACAAATGCATGAAGATGGAGGCTCGAGTTTCAAAGCTATGTCTAGCCACCTTCAAGATAACAGAGAACCTGAGGCGCCTAACACTCACTTGAAAACTTTAGATACAAATGAAGCTTCTGTTAAAATTTCTGAAGAGCTAATGCACGTGGAACATAGTTCAAAGAGGCATAGAGGAACTAAAGATGATGGGACACTAGTTAGGGATGATCGGAATGTGCTGAGGCGTTCAGAGGGCTCAGCTTTCTCAAGGTATAATCCAGCCTCAAATGCCAATAAGATTTCTGGTGGGAACTTAGGAAGCACTTCGCTTCAGGATAATAATAGTCAGGATCTTATAAAAAAGACTGAAGCAGCATATGATTGTCACTCGAACATGAATGAGAGTCTCCCCCATAATCATCGCTCACATGTCGGTAGCAATAACTTTGATATGAGTTCCACGACTGAGAACAACGCTTTCACAAAACCAGGAGCTCCAAAAGTAAGCTCAGCAGGATCTTCATCAGTGAAGCATTCATCGTTTCAGCCTTTACCCTGTGATCATCATAATAATCATGCCTCCTATAACCTTGTCCATGTCGCTGAGAGGAAGAAGCTACCGCCACAATGTGGATCCTCAAATGTGTACAACGAAACGATTGAAGGTAACAACAACACAGTGAATTACAGTGTGAATGGAAGTGTATCAGGTAGTGGTCATGGAAGTAATGGGCCATATGGAAGCAGTAACGGTATGAATGCTGGAGGAATGAATATGGGAAGTGATAATGGTGCTGGCAAAAATGGAAATGGCGATGGTAGTGGAAGCGGAAGTGGAAGTGGTAGCGGAAACTTGGCGGATGAAAATAAGATCTCTCAAAGGGAAGCTGCTTTGACAAAGTTCCGTCAGAAGAGAAAAGAGAGGTGCTTCCGAAAGAAGGTACGATACCAAAGCCGGAAAAAACTAGCAGAACAACGCCCTCGAGTGCGAGGCCAATTTGTGCGTAAAACAGCCGCTGCAACTGATGATAACGACATAAAAAACATTGAGGATAGCTAA

 

1

 

68418.m00223 pseudo-response regulator 7 (APRR7) identical to pseudo-response regulator 7 GI:10281004 from [Arabidopsis thaliana]

 

MNANEEGEGSRYPITDRKTGETKFDRVESRTEKHSEEEKTNGITMDVRNGSSGGLQIPLSQQTAATVCWERFLHVRTIRVLLVENDDCTRYIVTALLRNCSYEVVEASNGIQAWKVLEDLNNHIDIVLTEVIMPYLSGIGLLCKILNHKSRRNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQTQKSVKSKSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWDRVDSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTMGRDLEISIRRNCDLALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHEDGGSSFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGTLVRDDRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKKTEAAYDCHSNMNESLPHNHRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVKHSSFQPLPCDHHNNHASYNLVHVAERKKLPPQCGSSNVYNETIEGNNNTVNYSVNGSVSGSGHGSNGPYGSSNGMNAGGMNMGSDNGAGKNGNGDGSGSGSGSGSGNLADENKISQREAALTKFRQKRKERCFRKKVRYQSRKKLAEQRPRVRGQFVRKTAAATDDNDIKNIEDS*

 

21145

 

AT4G17640

GO:0005956|GO:0008605|GO:0006468|GO:0006468|GO:0006468

-

NULL

Show
AT4G17640

AT4G17640

 

GO:0005956|GO:0008605|GO:0006468|GO:0006468|GO:0006468

 

-

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

104

 

53

 

44

 

33

 

48

 

8

 

40

 

21

 

45

 

63

 

87

 

0

 

4

 

6

 

4

 

0

 

0

 

2

 

1

 

1

 

126

 

56

 

51

 

36

 

54

 

9

 

49

 

24

 

51

 

74

 

105

 

0

 

5

 

4

 

6

 

0

 

fca_all casein kinase II beta chain CKB2

 

ATGTATAGGGAGAGAGGTATGGTTGGATCGAAGTCGGAGGTGGTCGATCGGAAACGAATAAACGAGATTCACGATAACAGGCCTTCGCATTCGATGTCTCAGCCTGTCAATGGAAAAGGCAAGGTAACATCGACCTCCGTTTTGATGGGGAAGCAGCAATTGCATGATAAGGAATCTTCACGTTCTGGTTCTATCTCTAAGACTAACATTTCCGACGCTGTGGATATATCAGACACAGACAGCGAAGAATCAGAGGTCAGTGGTTCTGATGGAGAGGACACCTCGTGGATATCTTGGTTCTGCAACCTTCGTGGGAACGAGTTCTTCTGTGAAGTTGATGATGATTACATCCAGGATGACTTTAACTTGTGTGGACTCAGCCATCAAGTTCCTTACTACGACTATGCCCTTGATTTGATTTTGGATGTGGAGTCTTCGCATGGTGAGATGTTTACAGAGGAACAGAATGAATTGATCGAGTCAGCAGCAGAGATGCTATATGGAATGATTCATGCTCGTTTCATATTGACTAGCAAAGGGCTGGCTTCTATGTTAGACAAATACAAAAACTATGACTTTGGAAGATGCCCAAGAGTTTATTGTTGTGGCCAACCTTGTTTACCAGTTGGTCAATCCGATATCCCTAGAGCAAGCACCGTAAAGATATACTGCCCAAAATGTGAAGATGTCTATTACCCACGATCAAAATACCAAGGAAACATAGATGGAGCTTACTTTGGGACAACGTTTCCACATCTGTTCTTGATGACGTACGGGCATCTGAAGCCACAAAAGGCATCACAAAGCTACACTCAAAGAGTGTTTGGGTTCAAGCTACACAAGCCGTGA

 

1

 

68417.m02637 casein kinase II beta chain, putative similar to casein kinase II beta' chain (CK II) [Arabidopsis thaliana] SWISS-PROT:P40229

 

MYRERGMVGSKSEVVDRKRINEIHDNRPSHSMSQPVNGKGKVTSTSVLMGKQQLHDKESSRSGSISKTNISDAVDISDTDSEESEVSGSDGEDTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSHQVPYYDYALDLILDVESSHGEMFTEEQNELIESAAEMLYGMIHARFILTSKGLASMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRASTVKIYCPKCEDVYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQKASQSYTQRVFGFKLHKP*

 

18552