AT3G05020

AT3G05020

 

GO:0000036|GO:0000036|GO:0006633|GO:0006633|GO:0009507

 

NULL

 

Acyl Lipid Metabolism Family

 

Plastidial Acyl Carrier Protein

 

ACP1

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

127

 

909

 

145

 

492

 

442

 

256

 

291

 

809

 

708

 

253

 

659

 

14

 

0

 

64

 

3

 

0

 

0

 

2

 

1

 

1

 

151

 

1025

 

155

 

571

 

487

 

291

 

347

 

896

 

807

 

290

 

736

 

16

 

0

 

67

 

0

 

0

 

T9J14 acyl carrier protein 1 precursor (ACP)

 

ATGGCGACTCAATTCAGCGCTTCTGTCTCATTGCAAACTTCTTGTCTGGCAACAACAAGGATTAGTTTCCAAAAGCCAGCTTTGATTTCCAACCATGGAAAGACTAATCTATCCTTCAACCTCCGCCGTTCAATCCCATCTCGCCGCCTCTCTGTTTCTTGCGCGGCAAAACAAGAGACGATAGAGAAAGTGTCTGCTATAGTTAAGAAGCAACTATCACTTACACCGGATAAAAAAGTCGTTGCAGAAACCAAATTTGCTGACCTTGGAGCAGATTCTCTCGACACGGTTGAGATAGTAATGGGTTTAGAGGAAGAGTTTAACATCCAAATGGCCGAAGAGAAAGCACAGAAGATTGCCACAGTTGAGCAAGCTGCTGAACTCATTGAAGAGCTCATCAACGAGAAGAAGTAA

 

1

 

68416.m00545 acyl carrier protein 1, chloroplast (ACP-1) identical to SP|P11829 Acyl carrier protein 1, chloroplast precursor (ACP) {Arabidopsis thaliana}

 

MATQFSASVSLQTSCLATTRISFQKPALISNHGKTNLSFNLRRSIPSRRLSVSCAAKQETIEKVSAIVKKQLSLTPDKKVVAETKFADLGADSLDTVEIVMGLEEEFNIQMAEEKAQKIATVEQAAELIEELINEKK*

 

11861