AT2G44620

AT2G44620

 

GO:0000036|GO:0006633|GO:0006633|GO:0005759|GO:0005759|GO:0005759|GO:0005739|GO:0006633|GO:0006633

 

mtACP-1; mtACP-1 (MITOCHONDRIAL ACYL CARRIER PROTEIN 1); acyl carrier [EC:1.6.5.3 1.6.99.3] [SP:ACPM_ARATH]

 

Acyl Lipid Metabolism Family

 

Mitochondrial Acyl Carrier Protein

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

87

 

149

 

84

 

283

 

156

 

95

 

155

 

212

 

79

 

298

 

127

 

105

 

121

 

158

 

249

 

93

 

0

 

4

 

1

 

1

 

102

 

176

 

94

 

321

 

174

 

104

 

175

 

236

 

88

 

332

 

145

 

113

 

114

 

170

 

306

 

98

 

f16b22 acyl carrier protein

 

ATGGCACTGAGAAATGCAATTCTTCGTCACCTGAGGGTTCCGGTGCAAACCCTAGGATTGAATCAGTCTAAAATTGGGTTCCTTGGTACGATCCGGTCATTTTCTTCGCACGATGATCATCTTAGCAGAGAAGCTGTCGTCGATAGAGTACTCGATGTTGTCAAGAGCTTCCCCAAAGTCGATCCCTCTAAGGTGACTCCTGAGGTTCATTTCCAAAACGATTTGGGATTAGATAGTTTGGACACAGTGGAGATAGTGATGGCTATTGAAGAGGAATTCAAGCTGGAAATTCCAGACAAAGAAGCTGACAAGATCGATTCTTGCTCTCTCGCCATTGAATACGTTTACAATCATCCAATGTCTAGCTAA

 

1

 

68415.m05554 acyl carrier protein, mitochondrial / ACP / NADH-ubiquinone oxidoreductase 9.6 kDa subunit identical to SP|P53665 Acyl carrier protein, mitochondrial precursor (ACP) (NADH-ubiquinone oxidoreductase 9.6 kDa subunit) (MtACP-1) {Arabidopsis thaliana}; identical to cDNA acyl carrier protein precursor GI:468265

 

MALRNAILRHLRVPVQTLGLNQSKIGFLGTIRSFSSHDDHLSREAVVDRVLDVVKSFPKVDPSKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKEADKIDSCSLAIEYVYNHPMSS*

 

11070