AT2G40660

AT2G40660

 

GO:0000049|GO:0006418|GO:0006418|GO:0006418

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

48

 

27

 

19

 

29

 

36

 

118

 

97

 

60

 

73

 

123

 

61

 

33

 

26

 

51

 

60

 

118

 

0

 

4

 

1

 

1

 

50

 

29

 

22

 

29

 

39

 

122

 

110

 

64

 

80

 

131

 

65

 

36

 

28

 

56

 

69

 

118

 

t7d17 putative methionyl-tRNA synthetase

 

ATGGAGATAACGCCGTTAGTTGGAAGTCCGTTAGGACCGTTAGTTACATCAAGCAAAAACCCTATCGAAGAAATTGCAGTGTGTTTTCTTACAGCGAAGAGCCCCAAAGAGAAGAACAAAATTTCGAAAATAGAGAAAGAGAAGAAGTTGACGATGGATTCAAAGGCGAAGCAGATGATTCTTTCAGCTCTCTGCAAACACTTCTCTTTGGATCCTGAACCTTTTGTGGGCGGAGCGGGTGAAAGTGATATCAAGACACTTTATTCTAATGTATTGAAGGCATCTGGAAAGGAAGTATCTGCACAAAACAACGATGTTTTGAAGTGGCTAGATTTTGCGGAAGGTTTCTCTTCAGATTCAAAGGATTGGTTTTCAGCTCTTGAAAAGTTGAATTTAGAGTTAGCTACCAAGTCAGTGCTCTTGGGAAACGGATTGACGCCATCGGCAGCTGATGTTGCTGTGTTTTCAGCTCTGCATTCTTCAGTGCTTGGCCTCTCAGATTCAGACAAGGAGAAAGTACCACATGTCATAAGATGGGTGAATTACATCCAGAATAAAGAAGAGTTGTCGACATTATTTGCACCAATACCTGTGAAGCTACCAGAATTTAGCTTCGAGGTACCAAAACCTGCCATTAAGGTGGAAACAAATTCTAATTCAAAAAAAGCTGCAGAAGGTGTAAAGCCTGTTGACAAGCCAGATGTGCAGCCGCAGCTGGGCACAAAGAAAACTGAGCCAGAGGAACCAAAGAAAAATGCAGCAAAAGAGAAGGATGCCAAAAAGGAAAAGAAGAAGCCTGCTGAACCAGAACCAGCTAAGAAAGAGGCAGAGCTTAGTGTCAGTTTGCTTAACATTCAGGTTGGTCTAATTCGTAAAGCATGGAAGCACCCATCGGCGGATAGTTTGCTGGTGGAAGAAATAGATGTCGGGGAGGATAAAGTGAGACAAGTAGTTAGTGGCTTAGCAAAGTTCTGCAGTCCTGAGGATCTAACGAACCGCCTCGTTGCACTCATCACAAATGTCAAACCTGGAAAGCTAAGAGATGTAATGTCACAAGGACTGGTTCTTTGTGCTTCAAGTGAAGATCACTCGGTGGTAGAGCCGTTGCTACCACCTGCTGGTGCTAAACCAGGAGAGCGTGTTTCATTTTCAGGGATTGAAGGAAAGCCAGAAGATGTACTGAACCCAAAAAAGAAGCAACTAGAGAAGATAACACCGGGTCTCTACACTGATGAAAATGGCGTAGCCACATACAAAGGCATACAATTCATGACCTCGGCTGGACCTTGCACTTCCAGCATCCCCAAGGCGACCATCAAGTAG

 

1

 

68415.m05017 tRNA-binding region domain-containing protein similar to SP|Q12904 Multisynthetase complex auxiliary component p43 [Contains: Endothelial-monocyte activating polypeptide II (EMAP-II) (Small inducible cytokine subfamily E member 1)] {Homo sapiens}; contains Pfam profile PF01588: Putative tRNA binding domain

 

MDSKAKQMILSALCKHFSLDPEPFVGGAGESDIKTLYSNVLKASGKEVSAQNNDVLKWLDFAEGFSSDSKDWFSALEKLNLELATKSVLLGNGLTPSAADVAVFSALHSSVLGLSDSDKEKVPHVIRWVNYIQNKEELSTLFAPIPVKLPEFSFEVPKPAIKVETNSNSKKAAEGVKPVDKPDVQPQLGTKKTEPEEPKKNAAKEKDAKKEKKKPAEPEPAKKEAELSVSLLNIQVGLIRKAWKHPSADSLLVEEIDVGEDKVRQVVSGLAKFCSPEDLTNRLVALITNVKPGKLRDVMSQGLVLCASSEDHSVVEPLLPPAGAKPGERVSFSGIEGKPEDVLNPKKKQLEKITPGLYTDENGVATYKGIQFMTSAGPCTSSIPKATIK*

 

10658