AT2G40220

AT2G40220

 

GO:0009414|GO:0009414|GO:0006970|GO:0006970|GO:0005983|GO:0005983|GO:0019433|GO:0019433|GO:0009744|GO:0009737|GO:0009747|GO:0009749|GO:0009738|GO:0048316|GO:0010353|GO:0010353|GO:0005634|GO:0003677|GO:0003700|GO:0003700|GO:0003700|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0006355|GO:0010182

 

NULL

 

NULL

 

AP2-EREBP Transcription Factor Family

 

ABI4

 

NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

0

 

0

 

1

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

t7m7 AP2 domain transcription factor (ABI4:abscisic acid-insensitive 4 )

 

ATGGACCCTTTAGCTTCCCAACATCAACACAACCATCTGGAAGATAATAACCAAACCCTAACCCATAATAATCCTCAATCCGATTCCACCACCGACTCATCAACTTCCTCCGCTCAACGCAAACGCAAAGGCAAAGGTGGTCCGGACAACTCCAAGTTCCGTTACCGTGGCGTTCGACAAAGAAGCTGGGGCAAATGGGTCGCCGAGATCCGAGAGCCACGTAAGCGCACTCGCAAGTGGCTTGGTACTTTCGCAACCGCCGAAGACGCCGCACGTGCCTACGACCGGGCTGCCGTTTACCTATACGGGTCACGTGCTCAGCTCAACTTAACCCCTTCGTCTCCTTCCTCCGTCTCTTCCTCTTCCTCCTCCGTCTCCGCCGCTTCTTCTCCTTCCACCTCCTCTTCCTCCACTCAAACCCTAAGACCTCTCCTCCCTCGCCCCGCCGCCGCCACCGTAGGAGGAGGAGCCAACTTTGGTCCGTACGGTATCCCTTTTAACAACAACATCTTCCTTAATGGTGGGACCTCTATGTTATGCCCTAGTTATGGTTTTTTCCCTCAACAACAACAACAACAAAATCAGATGGTCCAGATGGGACAATTCCAACACCAACAGTATCAGAATCTTCATTCTAATACTAACAATAACAAGATTTCTGACATCGAGCTCACTGATGTTCCGGTAACTAATTCGACTTCGTTTCATCATGAGGTGGCGTTAGGGCAGGAACAAGGAGGAAGTGGGTGTAATAATAATAGTTCGATGGAGGATTTGAACTCTCTAGCTGGTTCGGTGGGTTCGAGTCTATCAATAACTCATCCACCGCCGTTGGTTGATCCGGTATGTTCTATGGGTCTGGATCCGGGTTATATGGTTGGAGATGGATCTTCGACCATTTGGCCTTTTGGAGGAGAAGAAGAATATAGTCATAATTGGGGGAGTATTTGGGATTTTATTGATCCCATCTTGGGGGAATTCTATTAA

 

1

 

68415.m04946 abscisic acid-insensitive 4 (ABI4) identical to AP2 domain transcription factor ABI4 GI:4587996 from [Arabidopsis thaliana]; sucrose uncoupled-6 (sun6) mutation PMID: 10972884

 

MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSSSSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLCPSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVALGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTIWPFGGEEEYSHNWGSIWDFIDPILGEFY*

 

10613