AT2G14670

AT2G14670

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0015770|GO:0006810

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC8|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

0

 

t6b13 putative sucrose-proton symporter

 

ATGAGTGACCTCCAAGCAAAAAACGATGTGGTAGCTGTAGATAGACAGTCTTCCTCGTCGTTGGCGGATCTTGATGGACCATCTCCGCTGAGAAAGATGATATCAGTGGCTTCTATTGCCGCCGGTATTCAGTTCGGTTGGGCTCTTCAGCTGTCTCTGCTAACTCCATACGTGCAGCTTCTTGGAGTCCCACACAAATGGTCATCTTTCATATGGCTATGTGGTCCTGTCTCTGGTCTTCTTGTCCAGCCATCCGTCGGTTACTTCAGCGACCGATGCACGTCAAGATTCGGACGTCGTCGTCCTTTCATCGCCACAGGCGCCTTGCTTGTAGCTGTTGCTGTTGTACTAATCGGATACGCAGCTGATTTTGGCCACAGCATGGGAGACAAAATCGACAAACCTGTCAAGATGCGAGCCGTTGTTATCTTCGCTCTCGGTTTCTGGATCCTTGACGTGGCTAACAACACTCTCCAAGGACCTTGTCGCGCTTTCCTCGGTGATTTAGCCGCTGGAGACGCTAAGAAAACGCGAACAGCAAACGCGTTTTTCTCTTTCTTCATGGCTGTTGGGAACGTTTTGGGATACGCGGCAGGATCATACACTAACCTCTACAAGATCTTCCCTTTCACAATGACTAAAGCATGTGACATATATTGCGCAAATCTCAAGAGTTGTTTCTTCCTTTCCATCACTCTCCTCCTAGTCGTCACAATCATAGCTCTTTGGTACGTGGAAGACAAGCAATGGTCGCCTAAAGCAGACTCGGACAACGAGAAAACTCCGTTCTTTGGTGAGATCTTTGGAGCTTTCAAGGTGATGAAACGTCCAATGTGGATGCTATTAATCGTCACGGCCTTGAACTGGATCGCATGGTTCCCTTTTCTTTTATACGATACCGATTGGATGGGTCGTGAAGTGTACGGTGGAGACTCAAAAGGAGATGACAAAATGAAGAAACTATACAACCAAGGGATTCACGTTGGTGCGTTGGGATTGATGCTTAACTCTATCGTTCTTGGAATCGTCTCACTTGGTATTGAAGGTATTAGCAAGAAAATAGGTGGAGCTAAAAGGCTTTGGGGAGCTGTGAATATCATCCTTGCTGTGTGTTTGGCAATGACGGTTTTGGTTACTAAAAAGGCGGAGGAGCACCGGAGAATCGCTGGTCCGATGGCCCTTCCTACCGATGGCATCAGAGCTGGAGCATTGACTCTCTTTGCTCTTCTTGGAATTCCTCTTGCTATTACATTCAGTATTCCGTTTGCACTAGCTTCCATAATCTCAAGTAGTTCCGGCGCCGGTCAAGGACTGTCTCTAGGAGTTTTAAACATGGCAATAGTGATACCACAAATGATTGTATCGTTTGGAGTTGGTCCTATTGATGCGCTTTTTGGAGGTGGAAACTTACCAAGATTTGTGGTCGGAGCTATTGCAGCGGCAATTAGCAGTGTTGTGGCATTTACCGTGTTACCTTAA

 

1

 

68415.m01650 sucrose transporter, putative / sucrose-proton symporter, putative similar to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094, SUC2 [Arabidopsis thaliana] GI:407092, sucrose transporter [Arabidopsis thaliana] GI:12057172; contains Pfam profile PF00083: major facilitator superfamily protein

 

MSDLQAKNDVVAVDRQSSSSLADLDGPSPLRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLLLVVTIIALWYVEDKQWSPKADSDNEKTPFFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLYDTDWMGREVYGGDSKGDDKMKKLYNQGIHVGALGLMLNSIVLGIVSLGIEGISKKIGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRIAGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPRFVVGAIAAAISSVVAFTVLP*

 

7962