AT1G71880

AT1G71880

 

GO:0016020|GO:0015144|GO:0008506|GO:0005351|GO:0009624|GO:0005886|GO:0008506

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC1|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

2

 

1

 

1

 

3

 

132

 

52

 

0

 

26

 

276

 

69

 

34

 

255

 

369

 

249

 

37

 

303

 

280

 

229

 

43

 

0

 

2

 

1

 

1

 

1

 

139

 

58

 

0

 

26

 

314

 

81

 

38

 

287

 

412

 

267

 

38

 

316

 

305

 

315

 

0

 

F17M19 sucrose transport protein SUC1

 

ATGGGAGCCTATGAAACAGAAAAACCAACTAAAGATGCGGCGGCTCTAGAGACACAGTCGCCGGAAGATTTCGATCAACCATCTCCGCTTCGTAAAATCATCTCCGTCGCTTCCATCGCCGCCGGTGTACAGTTCGGGTGGGCCTTACAGCTCTCTCTTCTTACTCCGTACGTTCAACTCCTCGGAATCCCTCACAAATGGTCATCTCTCATTTGGCTCTGTGGTCCAGTCTCCGGCATGATTGTTCAACCAATCGTCGGTTTCCACAGTGACCGATGTAGGTCCAAATTTGGTCGCCGTCGTCCTTTCATCGCCACCGGAGCCGCACTCGTCGCCGTCGCTGTTTTCCTCATCGGTTACGCTGCGGATTTCGGTTATAAAATGGGAGATAAACTCGAGGAGAAGGTTAAAGTTCGAGCTATAGGGATCTTTGCTCTCGGGTTCTGGATCCTCGACGTAGCCAACAACACCTTACAAGGACCTTGCCGTGCTTTCTTAGCCGACTTAGCCGCCGGTGACGCTAAGAGAACGCGAGTCGCAAACGCGTTTTTCTCTTTTTTTATGGCGGTTGGAAACGTTTTGGGTTATGCGGCTGGTTCGTACACTAACCTCCACAAGATGTTTCCGTTCACAATGACAAAAGCTTGCGATATCTATTGCGCCAATCTCAAGACTTGTTTCTTCTTATCCATCACTCTCCTCCTCATCGTCACCGTCACGTCTCTTTGGTACGTTAATGACAAACAATGGTCTCCGCCGCCGCGAAATGCCGACGACGACGAGAAGACCTCAAGCGTTCCTTTGTTCGGTGAAATCTTTGGAGCATTCAAAGTCATGAAACGTCCCATGTGGATGCTTCTAATCGTCACGGCCTTAAACTGGATCGCTTGGTTCCCATTTCTTTTGTTCGATACTGATTGGATGGGTCGTGAAGTGTTCGGTGGAGATTCAGATGGAAATGAACGATCGAAGAAACTATACAGTCTTGGAGTCCAATCTGGTGCAATGGGATTGATGTTTAACTCTATAGTTCTTGGTTTCATGTCACTTGGTGTTGAATGGATTGGTCGGAAATTAGGAGGAGCTAAACGGCTTTGGGGTATTGTCAATTTCATCCTAGCCGCTGGTTTGGCCATGACGGTTCTCGTTACGAAATTCGCCGAGGATCACCGGAAAACCGCCGGTGATTTAGCCGGACCGAGCGCTAGTGTTAAAGCTGGAGCTTTAAGTCTCTTTGCTGTTCTTGGTATCCCATTAGCTATTACTTTCAGTACTCCTTTTGCTCTAGCATCCATATTCTCAAGCTGCTCCGGTGCAGGCCAAGGACTTTCATTAGGAGTTTTAAATTTGGCGATTGTGATACCACAAATGATAGTCTCACTAGGAGGTGGACCTTTCGACGCCTTGTTCGGCGGTGGAAACTTACCGGCGTTTATCGTTGCAGCAATTGCAGCGGCGATTAGTGGAGTATTAGCGTTAACCGTTTTACCTTCACCACCACCGGACGCACCCAAGGCAACGACCATGGGAGGATTCCACTAG

 

1

 

68414.m08310 sucrose transporter / sucrose-proton symporter (SUC1) identical to sucrose-proton symporter SUC1 [Arabidopsis thaliana] GI:407094

 

MGAYETEKPTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYAADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLLLIVTVTSLWYVNDKQWSPPPRNADDDEKTSSVPLFGEIFGAFKVMKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVFGGDSDGNERSKKLYSLGVQSGAMGLMFNSIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKFAEDHRKTAGDLAGPSASVKAGALSLFAVLGIPLAITFSTPFALASIFSSCSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFIVAAIAAAISGVLALTVLPSPPPDAPKATTMGGFH*

 

6213