AT1G22710

AT1G22710

 

GO:0016020|GO:0005886|GO:0015144|GO:0008515|GO:0008506|GO:0005351|GO:0005886|GO:0008506|GO:0009915

 

NULL

 

NULL|Organic Solute Cotransporters

 

Sucrose-H+ symporters|Sucrose-proton symporter family

 

AtSUC2|NULL

 

NULL|NULL

 

NULL

 

NULL

 

NULL

 

0

 

4

 

1

 

1

 

5

 

57

 

48

 

0

 

53

 

61

 

117

 

217

 

176

 

36

 

54

 

210

 

67

 

310

 

113

 

0

 

0

 

4

 

1

 

1

 

5

 

59

 

32

 

0

 

30

 

58

 

116

 

226

 

176

 

35

 

29

 

176

 

67

 

306

 

108

 

0

 

T22J18 putative sucrose transport protein, SUC2

 

ATGGTCAGCCATCCAATGGAGAAAGCTGCAAATGGTGCGTCTGCGTTGGAAACGCAGACGGGTGAGTTAGATCAGCCGGAACGGCTTCGTAAGATCATATCGGTGTCTTCCATTGCCGCCGGTGTACAGTTCGGTTGGGCTTTACAGTTATCTCTGTTGACTCCTTACGTGCAGCTACTCGGAATCCCACATAAATGGGCTTCTCTGATTTGGCTCTGTGGTCCAATCTCCGGTATGCTTGTTCAGCCTATCGTCGGTTACCACAGTGACCGTTGCACCTCAAGATTCGGCCGTCGTCGTCCCTTCATCGTCGCTGGAGCTGGTTTAGTCACCGTTGCTGTTTTCCTTATCGGTTACGCTGCCGATATAGGTCACAGCATGGGCGATCAGCTTGACAAACCGCCGAAAACGCGAGCCATAGCGATATTCGCTCTCGGGTTTTGGATTCTTGACGTGGCTAACAACACCTTACAAGGACCCTGCAGAGCTTTCTTGGCTGATTTATCAGCAGGGAACGCTAAGAAAACGCGAACCGCAAACGCGTTTTTCTCGTTTTTCATGGCGGTTGGAAACGTTTTGGGTTACGCTGCGGGATCTTACAGAAATCTCTACAAAGTTGTGCCTTTCACGATGACTGAGTCATGCGATCTCTACTGCGCAAACCTCAAAACGTGTTTTTTCCTATCCATAACGCTTCTCCTCATAGTCACTTTCGTATCTCTCTGTTACGTGAAGGAGAAGCCATGGACGCCAGAGCCAACAGCCGATGGAAAAGCCTCCAACGTTCCGTTTTTCGGAGAAATCTTCGGAGCTTTCAAGGAACTAAAAAGACCCATGTGGATGCTTCTTATAGTCACTGCACTAAACTGGATCGCTTGGTTCCCTTTCCTTCTCTTCGACACTGATTGGATGGGCCGTGAGGTGTACGGAGGAAACTCAGACGCAACCGCAACCGCAGCCTCTAAGAAGCTTTACAACGACGGAGTCAGAGCTGGTGCTTTGGGGCTTATGCTTAACGCTATTGTTCTTGGTTTCATGTCTCTTGGTGTTGAATGGATTGGTCGGAAATTGGGAGGAGCTAAAAGGCTTTGGGGTATTGTTAACTTCATCCTCGCCATTTGCTTGGCCATGACGGTTGTGGTTACGAAACAAGCTGAGAATCACCGACGAGATCACGGCGGCGCTAAAACAGGTCCACCTGGTAACGTCACAGCTGGTGCTTTAACTCTCTTCGCCATCCTCGGTATCCCCCAAGCCATTACGTTTAGCATTCCTTTTGCACTAGCTTCCATATTTTCAACCAATTCCGGTGCCGGCCAAGGACTTTCCCTAGGTGTTCTGAATCTAGCCATTGTCGTCCCTCAGATGGTAATATCTGTGGGAGGTGGACCATTCGACGAACTATTCGGTGGTGGAAACATTCCAGCATTTGTGTTAGGAGCGATTGCGGCAGCGGTAAGTGGTGTATTGGCGTTGACGGTGTTGCCTTCACCGCCTCCGGATGCTCCTGCCTTCAAAGCTACTATGGGATTTCATTGA

 

1

 

68414.m02838 sucrose transporter / sucrose-proton symporter (SUC2) nearly identical to sucrose-proton symporter SUC2 [Arabidopsis thaliana] GI:407092

 

MVSHPMEKAANGASALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLLLIVTFVSLCYVKEKPWTPEPTADGKASNVPFFGEIFGAFKELKRPMWMLLIVTALNWIAWFPFLLFDTDWMGREVYGGNSDATATAASKKLYNDGVRAGALGLMLNAIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQAITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPDAPAFKATMGFH*

 

2312