Contig-U03592-1 |
Contig ID |
Contig-U03592-1 |
Contig update |
2001. 8.29 |
Contig sequence |
|
Gap |
no gap |
Contig length |
1141 |
Chromosome number (1..6, M) |
1 |
Chromosome length |
4919822 |
Start point |
390463 |
End point |
389321 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
2 |
Number of EST |
2 |
Link to clone list |
U03592 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6. 9 |
Homology vs CSM-cDNA |
|
dna update |
2009. 6. 4 |
Homology vs DNA |
Query= Contig-U03592-1 (Contig-U03592-1Q) /CSM_Contig/Contig-U03592-1Q.Seq.d (1141 letters)
Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ400797) Dictyostelium discoideum cDNA clone:dds14i23, 3' ... 1384 0.0 1 (BJ391055) Dictyostelium discoideum cDNA clone:dds14i23, 5' ... 795 0.0 2 (AU075088) Dictyostelium discoideum slug cDNA, clone SSA212. 476 e-129 1 (CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl... 36 1e-04 15 (AL844506) Plasmodium falciparum chromosome 7. 40 2e-04 16 (AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 38 4e-04 17 (EK189733) 1095460014054 Global-Ocean-Sampling_GS-31-01-01-1... 38 5e-04 3 (CP000764) Bacillus cereus subsp. cytotoxis NVH 391-98, comp... 42 0.002 2 (AE017245) Mycoplasma synoviae 53, complete genome. 38 0.002 17 (AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 36 0.004 16 (AC115612) Dictyostelium discoideum chromosome 2 map 6245135... 36 0.004 10 (BM399593) 5009-0-59-H03.t.1 Chilcoat/Turkewitz cDNA (large ... 46 0.004 2 (AL049180) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 40 0.006 11 (CP000102) Methanosphaera stadtmanae DSM 3091, complete genome. 38 0.007 16 (U66912) Dictyostelium discoideum ORF DG1016 gene, partial cds. 46 0.008 4 (AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 38 0.015 10 (CR382401) Plasmodium falciparum chromosome 6, complete sequ... 34 0.015 15 (AE014842) Plasmodium falciparum 3D7 chromosome 11 section 7... 42 0.015 11 (AY220914) Dictyostelium discoideum ComB (comB) gene, comple... 46 0.019 5 (AC123513) Dictyostelium discoideum strain AX4 chromosome 2 ... 36 0.025 7 (AC116960) Dictyostelium discoideum chromosome 2 map complem... 38 0.025 12 (CR382399) Plasmodium falciparum chromosome 6, complete sequ... 38 0.026 13 (AC006279) Plasmodium falciparum chromosome 12 clone PFYAC61... 36 0.035 11 (CP000743) Methanococcus aeolicus Nankai-3, complete genome. 36 0.035 19 (AL844509) Plasmodium falciparum chromosome 13. 40 0.036 16 (Z77665) Caenorhabditis elegans Cosmid K02E11. 46 0.044 3 (CP000013) Borrelia garinii PBi, complete genome. 36 0.047 16 (CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 40 0.061 19 (AF222894) Ureaplasma parvum serovar 3 str. ATCC 700970, com... 40 0.061 19 (CP000016) Candidatus Blochmannia pennsylvanicus str. BPEN, ... 40 0.063 15 (AE017308) Mycoplasma mobile 163K complete genome. 38 0.086 20 (G38820) TA46 Plasmodium falciparum haploid Plasmodium falci... 32 0.10 3 (AE014823) Plasmodium falciparum 3D7 chromosome 14 section 8... 32 0.11 11 (AY216499) Danio rerio renin precursor, gene, complete cds. 36 0.11 5 (AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 32 0.17 12 (AQ008283) CpG0423A CpIOWAgDNA1 Cryptosporidium parvum genom... 50 0.19 1 (EJ672908) 1092955065940 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.19 1 (EJ654435) 1092955000681 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.19 1 (EJ307930) 1095390117034 Global-Ocean-Sampling_GS-27-01-01-1... 50 0.19 1 (EJ261235) 1095349040489 Global-Ocean-Sampling_GS-27-01-01-1... 50 0.19 1 (EJ164147) 1092344059237 Global-Ocean-Sampling_GS-27-01-01-1... 50 0.19 1 (GE580379) CCPU4601.b1_B24.ab1 CCP(UWX) Globe Artichoke Cyna... 50 0.19 1 (CP000576) Prochlorococcus marinus str. MIT 9301, complete g... 36 0.23 20 (AC181187) Strongylocentrotus purpuratus clone R3-3040G7, WO... 40 0.26 5 (AE014820) Plasmodium falciparum 3D7 chromosome 14 section 5... 36 0.31 11 (CP000001) Bacillus cereus E33L, complete genome. 38 0.34 2 (AE017355) Bacillus thuringiensis serovar konkukian str. 97-... 38 0.34 2 (AE017225) Bacillus anthracis str. Sterne, complete genome. 38 0.34 2 (AE017334) Bacillus anthracis str. 'Ames Ancestor', complete... 38 0.34 2 (AE016879) Bacillus anthracis str. Ames, complete genome. 38 0.34 2 (CP000361) Arcobacter butzleri RM4018, complete genome. 34 0.34 21 (CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 32 0.36 20 (CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 32 0.36 23 (AC116982) Dictyostelium discoideum chromosome 2 map 3622643... 34 0.37 11 (AE014852) Plasmodium falciparum 3D7 chromosome 12, section ... 36 0.38 10 (AC117076) Dictyostelium discoideum chromosome 2 map 3323568... 32 0.40 11 (ER447519) 1092963836631 Global-Ocean-Sampling_GS-35-01-01-1... 36 0.45 3 (CU856340) Zebrafish DNA sequence from clone CH1073-138N7 in... 36 0.45 2 (AC116925) Dictyostelium discoideum chromosome 2 map 4189423... 46 0.47 4 (AL929352) Plasmodium falciparum strain 3D7, chromosome 5, s... 36 0.49 14 (EF039513) Synthetic construct Bacillus anthracis clone FLH2... 38 0.54 2 (BM396430) 5009-0-20-E05.t.1 Chilcoat/Turkewitz cDNA (large ... 38 0.56 2 (AC004062) Homo sapiens chromosome 4 clone B316M24 map 4q25,... 44 0.62 7 (AE014821) Plasmodium falciparum 3D7 chromosome 14 section 6... 40 0.65 9 (FF330645) 280443070 Pea aphid whole body normalized full le... 38 0.67 2 (FF336280) 280461164 Pea aphid whole body normalized full le... 38 0.67 2 (AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 38 0.69 8 (FF335123) 280458594 Pea aphid whole body normalized full le... 38 0.69 2 (CX585454) TTE00022328 Amplicon Express - Conjugative Form T... 38 0.73 2 (EV831654) FMMC204TF Tetrahymena thermophila SB210 cDNA libr... 38 0.74 2 (BM399754) 5009-0-60-H09.t.1 Chilcoat/Turkewitz cDNA (large ... 38 0.74 2 (AL583850) Human DNA sequence from clone RP11-430G6 on chrom... 48 0.75 1 (AC031977) Homo sapiens chromosome 1 clone RP11-288O18, WORK... 48 0.75 1 (FI071565) CHO_OF7323xd20r1.ab1 CHO_OF7 Nicotiana tabacum ge... 48 0.75 1 (FI071487) CHO_OF7323xd20f1.ab1 CHO_OF7 Nicotiana tabacum ge... 48 0.75 1 (FI056899) CHO_OF6605xm22f1.ab1 CHO_OF6 Nicotiana tabacum ge... 48 0.75 1 (DX822698) GH_MBb0018K13r GH_MBb Gossypium hirsutum genomic ... 48 0.75 1 (DX524003) GH_MBb0075N02r GH_MBb Gossypium hirsutum genomic ... 48 0.75 1 (CO123109) GR__Eb05B10.f GR__Eb Gossypium raimondii cDNA clo... 48 0.75 1 (CP000084) Candidatus Pelagibacter ubique HTCC1062, complete... 34 0.75 18 (CU469560) Medicago truncatula chromosome 5 clone mth4-3g17,... 42 0.77 7 (EK275796) 1095462276267 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.79 2 (AM761818) Oopsacas minuta EST, 5' end sequence, clone IL0AF... 34 0.79 3 (DY680387) TTDA725TG Tetrahymena thermophila EST library str... 38 0.83 2 (DY680070) TTDA521TG Tetrahymena thermophila EST library str... 38 0.83 2 (AC201419) Strongylocentrotus purpuratus clone R3-19A2, WORK... 40 0.83 7 (AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 36 0.85 19 (FF572102) TTEC106THB Tetrahymena thermophila conjugation cD... 38 0.85 2 (EK280193) 1095462292011 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.87 2 (AM761904) Oopsacas minuta EST, 5' end sequence, clone IL0AF... 34 0.88 3 (AM481018) Vitis vinifera, whole genome shotgun sequence, co... 42 0.94 4 (AF010546) Plasmodium falciparum microsatellite TA46 sequence. 32 1.1 3 (BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 34 1.1 16 (AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 38 1.2 17 (AC109448) Homo sapiens chromosome 5 clone RP11-141G2, compl... 38 1.2 9 (EU677193) Oedogonium cardiacum strain SAG 575-1b chloroplas... 32 1.3 10 (AL035476) Plasmodium falciparum MAL4P3. 32 1.3 14 (AE014828) Plasmodium falciparum 3D7 chromosome 14 section 1... 34 1.5 12 (AC193517) Gossypium hirsutum chromosome UNKNOWN clone ZMMBB... 40 1.6 5 (AC192541) Spermophilus tridecemlineatus clone VMRC20-206H7,... 42 1.6 3 (CU656003) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 1.7 4 (AL049184) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 34 1.8 13 (EK367013) 1095469402068 Global-Ocean-Sampling_GS-31-01-01-1... 34 1.9 3 (AC179466) Strongylocentrotus purpuratus clone R3-63I4, WORK... 38 2.1 7 (CX572733) TTE00016607 Amplicon Express - Conjugative Form T... 36 2.1 2 (GD810611) 454GmaGlobSeed553260 Soybean Seeds Containing Glo... 32 2.1 2 (AM454733) Vitis vinifera contig VV78X008724.11, whole genom... 38 2.5 3 (AC161481) Mus musculus chromosome 18, clone RP23-336C20, co... 38 2.5 7 (CP000742) Methanococcus vannielii SB, complete genome. 40 2.6 23 (CP000728) Clostridium botulinum F str. Langeland, complete ... 38 2.7 18 (BI936043) PfESToaa25c12.y1 Plasmodium falciparum 3D7 asexua... 32 2.7 3 (AY965679) Eptatretus burgeri variable lymphocyte receptor B... 46 3.0 1 (AL807771) Mouse DNA sequence from clone RP23-141C15 on chro... 46 3.0 1 (AC166827) Mus musculus BAC clone RP23-359M9 from chromosome... 46 3.0 1 (AC116574) Mus musculus BAC clone RP23-234F20 from chromosom... 46 3.0 1 (DQ978200) Cercopithecus nictitans Alu insertion locus CC_PY... 46 3.0 1 (DQ978199) Cercopithecus ascanius Alu insertion locus CC_PY2... 46 3.0 1 (DQ978198) Cercopithecus wolfi Alu insertion locus CC_PY2_11... 46 3.0 1 (DQ978197) Cercopithecus diana Alu insertion locus CC_PY2_11... 46 3.0 1 (FM992689) Candida dubliniensis CD36 chromosome 2, complete ... 46 3.0 1 (EU736109) Pisum sativum SGENod-06 line mutant GRAS family p... 46 3.0 1 (EU736107) Pisum sativum SGE line GRAS family protein (Sym7)... 46 3.0 1 (AP008207) Oryza sativa (japonica cultivar-group) genomic DN... 46 3.0 1 (AP003516) Oryza sativa Japonica Group genomic DNA, chromoso... 46 3.0 1 (AL112309) Botrytis cinerea strain T4 cDNA library. 46 3.0 1 (AC214995) Populus trichocarpa clone POP004-B08, complete se... 46 3.0 1 (DL267825) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS. 46 3.0 1 (DJ134274) Method for identification of useful proteins deri... 46 3.0 1 (AR548552) Sequence 3683 from patent US 6747137. 46 3.0 1 (AR279259) Sequence 2 from patent US 6514697. 46 3.0 1 (AR279258) Sequence 1 from patent US 6514697. 46 3.0 1 (AR097040) Sequence 2 from patent US 6071518. 46 3.0 1 (AR097039) Sequence 1 from patent US 6071518. 46 3.0 1 (AF068065) Cryptosporidium parvum GP900 gene, complete cds. 46 3.0 1 (AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 46 3.0 1 (AC151058) Bos taurus clone CH240-113H9, WORKING DRAFT SEQUE... 46 3.0 1 (AC144746) Bos taurus clone CH240-113H9, WORKING DRAFT SEQUE... 46 3.0 1 (AC133846) Rattus norvegicus clone CH230-7M18, *** SEQUENCIN... 46 3.0 1 (AC120234) Rattus norvegicus clone CH230-31F17, *** SEQUENCI... 46 3.0 1 (AC119022) Rattus norvegicus clone CH230-449N5, WORKING DRAF... 46 3.0 1 (AC113650) Rattus norvegicus clone CH230-45C16, *** SEQUENCI... 46 3.0 1 (AC098260) Rattus norvegicus clone CH230-1L9, *** SEQUENCING... 46 3.0 1 (AC097439) Rattus norvegicus clone CH230-150M9, WORKING DRAF... 46 3.0 1 (AC094854) Rattus norvegicus clone CH230-5P8, *** SEQUENCING... 46 3.0 1 (CU915274) Mouse DNA sequence *** SEQUENCING IN PROGRESS ***... 46 3.0 1 (AC093466) Mus musculus clone RP23-4M7, WORKING DRAFT SEQUEN... 46 3.0 1 (AC217334) Solanum lycopersicum chromosome 12 clone SL_MboI-... 46 3.0 1 (AC217248) Solanum lycopersicum chromosome 12 clone LE_HBa-3... 46 3.0 1 (AC178628) Strongylocentrotus purpuratus clone R3-3007P6, WO... 46 3.0 1 (FI087586) CHO_OF7094xd24f1.ab1 CHO_OF7 Nicotiana tabacum ge... 46 3.0 1 (ER285632) 1092343568109 Global-Ocean-Sampling_GS-34-01-01-1... 46 3.0 1 (EK236026) 1095460200021 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.0 1 (EK155635) 1095458004004 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.0 1 (EJ705022) 1092956050327 Global-Ocean-Sampling_GS-30-02-01-1... 46 3.0 1 (EJ385020) 1092963800621 Global-Ocean-Sampling_GS-28-01-01-1... 46 3.0 1 (EI000119) MUGQ_CH252P170C24Sp6_CN218_094 CHORI-252 Vervet M... 46 3.0 1 (EF900954) Mus musculus C57BL/6N IST11750F1BBF1 gene trap em... 46 3.0 1 (DX554957) GH_MBb0033J18f GH_MBb Gossypium hirsutum genomic ... 46 3.0 1 (DH646063) Rattus norvegicus DNA, BAC clone: RNB1-187G12, 3'... 46 3.0 1 (DH495319) Monosiga ovata DNA, fosmid clone: MOF-059D18, gen... 46 3.0 1 (DH483166) Monosiga ovata DNA, fosmid clone: MOF-038A15, gen... 46 3.0 1 (DH481246) Monosiga ovata DNA, fosmid clone: MOF-034K15, gen... 46 3.0 1 (DH477498) Monosiga ovata DNA, fosmid clone: MOF-028A24, gen... 46 3.0 1 (DH474816) Monosiga ovata DNA, fosmid clone: MOF-023G08, gen... 46 3.0 1 (CZ281246) cp15h07.f Candida parapsilosis Random Genomic Lib... 46 3.0 1 (CR053087) Forward strand read from insert in 3'HPRT inserti... 46 3.0 1 (CR007968) Forward strand read from insert in 5'HPRT inserti... 46 3.0 1 (ES347058) PPMGBL164 P. papatasi adult female blood fed midg... 46 3.0 1 (AU265899) Dictyostelium discoideum vegetative cDNA clone:VS... 46 3.0 1 (DK436838) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK435585) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK435279) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK435169) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK434245) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK431127) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK430454) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK430439) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK430297) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK426974) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK425433) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK424244) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK422548) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK421727) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK421522) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK421494) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK420925) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (DK420289) Drosophila simulans mRNA, adult full-length cDNA ... 46 3.0 1 (AU052356) Dictyostelium discoideum slug cDNA, clone SLD188. 46 3.0 1 (CX023376) Mdlv4-4047g02.y1 Mdlv4 Malus x domestica cDNA clo... 46 3.0 1 (CO865701) Mddb5013e21.y1 Mddb Malus x domestica cDNA clone ... 46 3.0 1 (CB714934) AMGNNUC:MRPE3-00062-C4-A placenta embryo D17 (103... 46 3.0 1 (BU095130) rf62f04.y2 Meloidogyne hapla J2 pAMP1 v1 Meloidog... 46 3.0 1 (BJ417189) Dictyostelium discoideum cDNA clone:ddv29d21, 5' ... 46 3.0 1 (BJ414993) Dictyostelium discoideum cDNA clone:ddv21h06, 5' ... 46 3.0 1 (BJ387335) Dictyostelium discoideum cDNA clone:dds1c20, 5' e... 46 3.0 1 (FK813197) PRAG-aad10d09.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (FK812021) PRAG-aad19e12.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (FK811580) PRAG-aac82a08.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (FK810541) PRAG-aad28e09.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (FG115383) PRAG-aab46g10.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY218827) PRAG-aaa67g08.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY217212) PRAG-aaa25h01.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY217049) PRAG-aaa62c02.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY215499) PRAG-aaa85f02.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY211173) PRAG-aaa21d01.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY208260) PRAG-aab14b08.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (EY204604) PRAG-aab15d10.g1 Sand_fly_EST_Normalized Phleboto... 46 3.0 1 (CP000867) Methanococcus maripaludis C6, complete genome. 46 3.0 1 (EJ233968) 1092404078604 Global-Ocean-Sampling_GS-27-01-01-1... 38 3.0 2 (AC004157) Plasmodium falciparum chromosome 12 clone PFYAC29... 30 3.0 11 (BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 34 3.3 20 (AP008934) Staphylococcus saprophyticus subsp. saprophyticus... 40 3.7 24 (BQ312625) RC3-BN0428-201100-011-c06 BN0428 Homo sapiens cDN... 36 3.7 2 (FM992688) Candida dubliniensis CD36 chromosome 1, complete ... 36 3.8 19 (AC116924) Dictyostelium discoideum chromosome 2 map 6357117... 38 3.9 7 (AC209194) Populus trichocarpa clone POP091-C08, complete se... 36 3.9 7 (CD082392) MA3-9999U-M333-F07-U.B MA3-0001 Schistosoma manso... 34 3.9 3 (CP001182) Acinetobacter baumannii AB0057, complete genome. 38 4.0 21 (CP001186) Bacillus cereus G9842, complete genome. 36 4.2 21 (AC153279) Bos taurus clone CH240-23P3, *** SEQUENCING IN PR... 40 4.3 8 (AC202357) Medicago truncatula clone mth2-52g1, WORKING DRAF... 36 4.5 8 (AC145920) Pan troglodytes BAC clone RP43-10C15 from chromos... 36 4.5 7 (AC147091) Pan troglodytes BAC clone RP43-57O16 from chromos... 36 4.8 6 (BX255916) Mouse DNA sequence from clone RP23-408N4 on chrom... 42 4.8 3 (AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 34 4.9 11 (BX088528) Zebrafish DNA sequence from clone CH211-226D23 in... 36 4.9 6 (CR962123) Medicago truncatula chromosome 5 clone mth2-167a1... 42 5.0 6 (CU464189) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 5.3 6 (AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 30 5.4 11 (CU855806) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 5.5 3 (AE014826) Plasmodium falciparum 3D7 chromosome 14 section 1... 34 5.7 12 (CP001184) Ureaplasma urealyticum serovar 10 str. ATCC 33699... 34 5.7 20 (ER437189) 1092963801049 Global-Ocean-Sampling_GS-35-01-01-1... 30 5.7 3 (AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 32 6.0 11 (EK053847) 1092959730741 Global-Ocean-Sampling_GS-31-01-01-1... 38 6.1 3 (AC005140) Plasmodium falciparum chromosome 12 clone PFYACB8... 32 6.2 9 (BI782611) kh28a09.y1 Ascaris suum male head pAMP1 v2 Chiape... 42 6.3 2 (BH161455) ENTSM33TR Entamoeba histolytica Sheared DNA Entam... 32 6.4 3 (CR318592) Zebrafish DNA sequence from clone CH211-51F17 in ... 32 6.4 8 (AC162141) Loxodonta africana clone VMRC15-499E9, WORKING DR... 40 6.5 5 (AE014834) Plasmodium falciparum 3D7 chromosome 10 section 6... 32 6.5 10 (AC209584) Solanum lycopersicum DNA sequence from clone LE_H... 38 6.6 6 (AC115599) Dictyostelium discoideum chromosome 2 map 4229098... 36 6.8 8 (AC173165) Bos taurus clone CH240-189E15, WORKING DRAFT SEQU... 38 6.9 8 (CR407589) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 7.0 9 (AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 34 7.1 11 (AC189307) Brassica rapa subsp. pekinensis clone KBrB033O04,... 34 7.1 5 (EH011109) USDA-FP_184141 Lysiphlebus testaceipes adult whol... 38 7.4 2 (FC299883) CAIC10495.rev CAIC Nematostella vectensis Nemve w... 32 7.6 3 (FC314963) CAIC465.rev CAIC Nematostella vectensis Nemve who... 32 7.6 3 (FC323072) CAIC8972.fwd CAIC Nematostella vectensis Nemve wh... 32 7.7 3 (FC856096) CAMCEP230h08 camce Biomphalaria glabrata cDNA clo... 34 7.8 2 (CK991559) EST0111 Eyestalk cDNA library Penaeus monodon cDN... 34 7.9 2 (EK204001) 1095460067135 Global-Ocean-Sampling_GS-31-01-01-1... 34 7.9 3 (AM462063) Vitis vinifera, whole genome shotgun sequence, co... 40 8.0 6 (AC179602) Strongylocentrotus purpuratus clone R3-1029D21, W... 38 8.1 8 (AU264850) Dictyostelium discoideum vegetative cDNA clone:VS... 34 8.1 2 (FC299884) CAIC10495.fwd CAIC Nematostella vectensis Nemve w... 32 8.2 3 (AM180355) Clostridium difficile 630 complete genome. 34 8.2 21 (BI506397) BB170024B20D11.5 Bee Brain Normalized/Subtracted ... 42 8.2 2 (AQ389881) RPCI11-142A22.TV RPCI-11 Homo sapiens genomic clo... 42 8.3 2 (FC314964) CAIC465.fwd CAIC Nematostella vectensis Nemve who... 32 8.4 3 (BZ837648) CH240_248J4.TV CHORI-240 Bos taurus genomic clone... 38 8.4 2 (CR382398) Plasmodium falciparum chromosome 6, complete sequ... 32 8.6 14 (AC163263) Rhinolophus ferrumequinum clone VMRC7-282K15, WOR... 38 8.9 3 (AC128662) Mus musculus BAC clone RP24-440E3 from chromosome... 38 8.9 5 (FM992691) Candida dubliniensis CD36 chromosome 4, complete ... 34 8.9 18 (CR848783) Zebrafish DNA sequence from clone CH211-136C24 in... 34 9.2 7 (BX538351) Cryptosporidium parvum chromosome 6, complete seq... 32 9.5 11 (DV156066) CV03099B2F02.f1 CV03-normalized library Euphorbia... 36 9.8 2 (AM639182) Entamoeba dispar GSS, clone dispar60d03.q1k. 42 9.9 2
>(BJ400797) Dictyostelium discoideum cDNA clone:dds14i23, 3' end, single read. Length = 699
Score = 1384 bits (698), Expect = 0.0 Identities = 698/698 (100%) Strand = Plus / Minus
Query: 444 gtgataatgttcaatgggcaatgcctgaaaatagaattggatattttccagatgtgggta 503 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 699 gtgataatgttcaatgggcaatgcctgaaaatagaattggatattttccagatgtgggta 640
Query: 504 caagttattttttatctagacttggttcaattggattatatttagcaatggttggggtaa 563 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 639 caagttattttttatctagacttggttcaattggattatatttagcaatggttggggtaa 580
Query: 564 agataaattcaaaagatttgataaatgtgaaattggcaactcattatataccaaatgaat 623 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 579 agataaattcaaaagatttgataaatgtgaaattggcaactcattatataccaaatgaat 520
Query: 624 tatttgaaagaacattggaagagttatgtaatgatgatgatattgaaggttatagacaaa 683 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 519 tatttgaaagaacattggaagagttatgtaatgatgatgatattgaaggttatagacaaa 460
Query: 684 ttgaattcattttaaataagtatagaaagacattgtatcctgataaagagtcttctcatt 743 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 459 ttgaattcattttaaataagtatagaaagacattgtatcctgataaagagtcttctcatt 400
Query: 744 tagttctttatcaatcaataattaatagatgttttaataataaagaatttaaatcagtga 803 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 399 tagttctttatcaatcaataattaatagatgttttaataataaagaatttaaatcagtga 340
Query: 804 aagagatattgaatcaattgaaagtggagattgaaaatgtggataataaaaacaataaag 863 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 339 aagagatattgaatcaattgaaagtggagattgaaaatgtggataataaaaacaataaag 280
Query: 864 atgaaattgaatgggcttcaaaaacattatctatactattagatcaattatgtccgacat 923 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 279 atgaaattgaatgggcttcaaaaacattatctatactattagatcaattatgtccgacat 220
Query: 924 cagtttgtgtctcatttgaaattattaaacgtgctttacaaatgaatattgatcaaatct 983 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 219 cagtttgtgtctcatttgaaattattaaacgtgctttacaaatgaatattgatcaaatct 160
Query: 984 ttcaaatggaagtcagggttggtactagattgggcaatagacaagatttaactcaaggtg 1043 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 159 ttcaaatggaagtcagggttggtactagattgggcaatagacaagatttaactcaaggtg 100
Query: 1044 ttttcaaaactttaattgataaaactcataaaccaatttattcaccttcatcaatatatg 1103 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 99 ttttcaaaactttaattgataaaactcataaaccaatttattcaccttcatcaatatatg 40
Query: 1104 atataaatcaatcttttatgattctttctttttacctt 1141 |||||||||||||||||||||||||||||||||||||| Sbjct: 39 atataaatcaatcttttatgattctttctttttacctt 2
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 102105510 Number of Hits to DB: 1,519,549,332 Number of extensions: 99126062 Number of successful extensions: 8426508 Number of sequences better than 10.0: 272 Length of query: 1141 Length of database: 101,790,757,118 Length adjustment: 24 Effective length of query: 1117 Effective length of database: 99,340,224,878 Effective search space: 110963031188726 Effective search space used: 110963031188726 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.29 |
Homology vs Protein |
Query= Contig-U03592-1 (Contig-U03592-1Q) /CSM_Contig/Contig-U03592-1Q.Seq.d (1141 letters)
Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q58EB4) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 201 4e-50 BX323586_3(BX323586|pid:none) Zebrafish DNA sequence from clone ... 199 2e-49 FJ362368_3(FJ362368|pid:none) Caenorhabditis brenneri contig JD1... 189 1e-46 T16010(T16010) hypothetical protein F09F7.4 - Caenorhabditis ele... 187 6e-46 U00050_8(U00050|pid:none) Caenorhabditis elegans cosmid F09F7, c... 187 6e-46 AE014297_2096(AE014297|pid:none) Drosophila melanogaster chromos... 186 1e-45 AP007255_3583(AP007255|pid:none) Magnetospirillum magneticum AMB... 181 3e-44 (A2VDC2) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 181 4e-44 CU459003_1466(CU459003|pid:none) Magnetospirillum gryphiswaldens... 180 1e-43 CP000269_3361(CP000269|pid:none) Janthinobacterium sp. Marseille... 179 2e-43 CR382139_526(CR382139|pid:none) Debaryomyces hansenii strain CBS... 178 3e-43 BT059467_1(BT059467|pid:none) Salmo salar clone ssal-rgf-530-184... 178 3e-43 CP000449_1539(CP000449|pid:none) Maricaulis maris MCS10, complet... 178 4e-43 AM920436_840(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 177 5e-43 CP001157_1032(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 177 6e-43 CP001019_217(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com... 177 8e-43 BT037025_1(BT037025|pid:none) Zea mays full-length cDNA clone ZM... 177 8e-43 CP000733_77(CP000733|pid:none) Coxiella burnetii Dugway 5J108-11... 176 1e-42 CP000927_3041(CP000927|pid:none) Caulobacter sp. K31, complete g... 176 1e-42 CP000113_2629(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 176 1e-42 AM260525_1038(AM260525|pid:none) Bartonella tribocorum CIP 10547... 175 2e-42 FN392321_964(FN392321|pid:none) Pichia pastoris GS115 chromosome... 175 3e-42 (Q55GS6) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 175 3e-42 AB333788_1(AB333788|pid:none) Glycine max mRNA for peroxisomal 3... 175 3e-42 AP006627_1802(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 175 3e-42 CP001020_143(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 174 5e-42 (Q5ZJ60) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 174 7e-42 CP000230_1829(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 174 7e-42 CU640366_1229(CU640366|pid:none) Podospora anserina genomic DNA ... 173 1e-41 AM181176_2962(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 172 2e-41 (Q6NVY1) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 172 3e-41 BC067822_1(BC067822|pid:none) Homo sapiens 3-hydroxyisobutyryl-C... 171 3e-41 CP001562_956(CP001562|pid:none) Bartonella grahamii as4aup, comp... 171 6e-41 CP000613_1307(CP000613|pid:none) Rhodospirillum centenum SW, com... 170 1e-40 AP009384_1544(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 170 1e-40 BX897699_832(BX897699|pid:none) Bartonella henselae strain Houst... 169 1e-40 CP000764_1658(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 169 1e-40 CP000076_3016(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 169 2e-40 CP001510_4288(CP001510|pid:none) Methylobacterium extorquens AM1... 168 4e-40 CP001283_2285(CP001283|pid:none) Bacillus cereus AH820, complete... 167 5e-40 AE008917_1195(AE008917|pid:none) Brucella melitensis 16M chromos... 167 6e-40 AE014291_733(AE014291|pid:none) Brucella suis 1330 chromosome I,... 167 8e-40 CP000094_2862(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 167 8e-40 CP000758_2516(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 167 8e-40 (Q5XIE6) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 166 1e-39 (Q8QZS1) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 166 1e-39 CR378678_207(CR378678|pid:none) Photobacterium profundum SS9 chr... 166 1e-39 AP009386_1659(AP009386|pid:none) Burkholderia multivorans ATCC 1... 166 1e-39 BA000012_6602(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 166 2e-39 CP000302_1925(CP000302|pid:none) Shewanella denitrificans OS217,... 165 2e-39 CP000781_4258(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 165 3e-39 AE016879_2166(AE016879|pid:none) Bacillus anthracis str. Ames, c... 164 4e-39 AM270326_22(AM270326|pid:none) Aspergillus niger contig An14c019... 164 5e-39 CP000390_1121(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 164 7e-39 CP001186_2167(CP001186|pid:none) Bacillus cereus G9842, complete... 163 9e-39 AM236080_612(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 163 1e-38 CP000958_1530(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 162 2e-38 CR628337_906(CR628337|pid:none) Legionella pneumophila str. Lens... 162 2e-38 CP000675_959(CP000675|pid:none) Legionella pneumophila str. Corb... 162 2e-38 CP000378_1071(CP000378|pid:none) Burkholderia cenocepacia AU 105... 162 3e-38 AF380642_1(AF380642|pid:none) Arabidopsis thaliana AT4g13360/T9E... 161 4e-38 AP009385_1541(AP009385|pid:none) Burkholderia multivorans ATCC 1... 161 4e-38 CP000388_943(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 161 5e-38 EF148698_1(EF148698|pid:none) Populus trichocarpa x Populus delt... 160 6e-38 CP000356_3032(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 160 1e-37 AK100907_1(AK100907|pid:none) Oryza sativa Japonica Group cDNA c... 159 1e-37 BT043030_1(BT043030|pid:none) Zea mays full-length cDNA clone ZM... 159 1e-37 AP008218_620(AP008218|pid:none) Oryza sativa (japonica cultivar-... 159 1e-37 CP000472_3235(CP000472|pid:none) Shewanella piezotolerans WP3, c... 159 2e-37 CP000903_2115(CP000903|pid:none) Bacillus weihenstephanensis KBA... 159 2e-37 CR954246_1419(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 159 2e-37 AE008689_502(AE008689|pid:none) Agrobacterium tumefaciens str. C... 159 2e-37 CP000440_1456(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 159 2e-37 CP000949_2870(CP000949|pid:none) Pseudomonas putida W619, comple... 159 2e-37 AE007870_495(AE007870|pid:none) Agrobacterium tumefaciens str. C... 159 2e-37 CP000151_1514(CP000151|pid:none) Burkholderia sp. 383 chromosome... 159 2e-37 CP001074_632(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 158 3e-37 CP001025_1466(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 158 3e-37 CP001103_1890(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 158 4e-37 CP000157_2006(CP000157|pid:none) Erythrobacter litoralis HTCC259... 157 7e-37 CP000431_7000(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 157 7e-37 CP000090_2001(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 157 9e-37 CP001154_219(CP001154|pid:none) Laribacter hongkongensis HLHK9, ... 157 9e-37 CP000158_900(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 156 1e-36 CP000572_1813(CP000572|pid:none) Burkholderia pseudomallei 1106a... 156 1e-36 CP001016_607(CP001016|pid:none) Beijerinckia indica subsp. indic... 156 1e-36 CP001622_256(CP001622|pid:none) Rhizobium leguminosarum bv. trif... 156 1e-36 CP000526_1696(CP000526|pid:none) Burkholderia mallei SAVP1 chrom... 156 1e-36 CP000133_559(CP000133|pid:none) Rhizobium etli CFN 42, complete ... 156 1e-36 CR382130_243(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 156 1e-36 CP000010_1056(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 156 1e-36 CP000152_716(CP000152|pid:none) Burkholderia sp. 383 chromosome ... 155 2e-36 AK229190_1(AK229190|pid:none) Arabidopsis thaliana mRNA for enoy... 155 2e-36 CP000058_1646(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 155 2e-36 AL591985_1456(AL591985|pid:none) Sinorhizobium meliloti 1021 pla... 155 2e-36 (O74802) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitoch... 155 2e-36 CR543861_1471(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 155 3e-36 AL513466_21(AL513466|pid:none) Neurospora crassa DNA linkage gro... 155 3e-36 BC005190_1(BC005190|pid:none) Homo sapiens 3-hydroxyisobutyryl-C... 155 3e-36 AE015451_3458(AE015451|pid:none) Pseudomonas putida KT2440 compl... 155 3e-36 CP000790_759(CP000790|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 155 3e-36 AC002340_4(AC002340|pid:none) Arabidopsis thaliana chromosome 2 ... 155 3e-36 CP000446_2582(CP000446|pid:none) Shewanella sp. MR-4, complete g... 155 3e-36 CP000851_2770(CP000851|pid:none) Shewanella pealeana ATCC 700345... 154 4e-36 CR858943_1(CR858943|pid:none) Pongo abelii mRNA; cDNA DKFZp468E1... 154 6e-36 CP000469_2749(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 154 6e-36 CP000086_2464(CP000086|pid:none) Burkholderia thailandensis E264... 154 6e-36 AE016853_3618(AE016853|pid:none) Pseudomonas syringae pv. tomato... 154 6e-36 BT039399_1(BT039399|pid:none) Zea mays full-length cDNA clone ZM... 154 6e-36 AB018108_11(AB018108|pid:none) Arabidopsis thaliana genomic DNA,... 154 7e-36 CP000500_334(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 154 7e-36 BA000040_3956(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 154 7e-36 CP000959_2114(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 153 1e-35 CP001068_1111(CP001068|pid:none) Ralstonia pickettii 12J chromos... 153 1e-35 CP000480_5099(CP000480|pid:none) Mycobacterium smegmatis str. MC... 153 1e-35 CP001001_3731(CP001001|pid:none) Methylobacterium radiotolerans ... 153 1e-35 AP007255_2561(AP007255|pid:none) Magnetospirillum magneticum AMB... 152 2e-35 CP000681_1392(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 152 2e-35 AP009493_329(AP009493|pid:none) Streptomyces griseus subsp. gris... 152 2e-35 CP000503_2666(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 152 2e-35 BX571966_636(BX571966|pid:none) Burkholderia pseudomallei strain... 152 3e-35 CP000571_916(CP000571|pid:none) Burkholderia pseudomallei 668 ch... 152 3e-35 BT061798_1(BT061798|pid:none) Zea mays full-length cDNA clone ZM... 152 3e-35 CP000271_1898(CP000271|pid:none) Burkholderia xenovorans LB400 c... 152 3e-35 CP000463_2364(CP000463|pid:none) Rhodopseudomonas palustris BisA... 151 4e-35 CP001281_3417(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 151 4e-35 AM181176_1405(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 151 4e-35 CP000379_423(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 151 5e-35 AP011115_4497(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 150 6e-35 CR931997_1503(CR931997|pid:none) Corynebacterium jeikeium K411 c... 150 6e-35 AP009044_1035(AP009044|pid:none) Corynebacterium glutamicum R DN... 150 6e-35 CP001096_3869(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 150 6e-35 CU914168_1547(CU914168|pid:none) Ralstonia solanacearum strain I... 150 8e-35 CU695238_137(CU695238|pid:none) Ralstonia solanacearum strain Mo... 150 1e-34 CU458896_1172(CU458896|pid:none) Mycobacterium abscessus chromos... 150 1e-34 AM910996_574(AM910996|pid:none) Plasmodium knowlesi strain H chr... 150 1e-34 CP000272_245(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 150 1e-34 CP000511_4604(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 149 1e-34 CP001111_222(CP001111|pid:none) Stenotrophomonas maltophilia R55... 148 3e-34 CP000949_1052(CP000949|pid:none) Pseudomonas putida W619, comple... 148 4e-34 AK072650_1(AK072650|pid:none) Oryza sativa Japonica Group cDNA c... 147 5e-34 CU695240_183(CU695240|pid:none) Ralstonia solanacearum strain Mo... 147 5e-34 CP000316_2383(CP000316|pid:none) Polaromonas sp. JS666, complete... 147 5e-34 CP001052_1697(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 147 5e-34 BA000038_1039(BA000038|pid:none) Vibrio vulnificus YJ016 DNA, ch... 147 5e-34 CP000739_658(CP000739|pid:none) Sinorhizobium medicae WSM419 pla... 147 7e-34 AL583925_135(AL583925|pid:none) Mycobacterium leprae strain TN c... 147 9e-34 AE017340_864(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 147 9e-34 AF190450_1(AF190450|pid:none) Avicennia marina enoyl-CoA-hydrata... 147 9e-34 CU914166_684(CU914166|pid:none) Ralstonia solanacearum strain IP... 147 9e-34 BT077746_1(BT077746|pid:none) Lepeophtheirus salmonis Pacific fo... 147 9e-34 CP000316_2424(CP000316|pid:none) Polaromonas sp. JS666, complete... 147 9e-34 AY723769_1(AY723769|pid:none) Saccharomyces cerevisiae clone FLH... 146 1e-33 AM743169_253(AM743169|pid:none) Stenotrophomonas maltophilia K27... 146 1e-33 CP000250_2115(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 145 2e-33 BC083737_1(BC083737|pid:none) Rattus norvegicus 3-hydroxyisobuty... 145 2e-33 CP001392_1230(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 145 3e-33 CP000563_1480(CP000563|pid:none) Shewanella baltica OS155, compl... 145 3e-33 CP000753_1470(CP000753|pid:none) Shewanella baltica OS185, compl... 145 3e-33 AC026758_5(AC026758|pid:none) Oryza sativa chromosome 10 BAC OSJ... 145 3e-33 CP000283_3284(CP000283|pid:none) Rhodopseudomonas palustris BisB... 145 3e-33 CP000085_1790(CP000085|pid:none) Burkholderia thailandensis E264... 145 3e-33 AK221578_1(AK221578|pid:none) Arabidopsis thaliana mRNA for 3-hy... 145 3e-33 CP000447_1332(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 145 3e-33 A84711(A84711) 3-hydroxyisobutyryl-coenzyme A hydrolase [importe... 144 4e-33 CP000083_624(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 144 4e-33 AE016958_1018(AE016958|pid:none) Mycobacterium avium subsp. para... 144 4e-33 CP000270_1940(CP000270|pid:none) Burkholderia xenovorans LB400 c... 144 4e-33 CP000094_1347(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 144 4e-33 CP000479_1139(CP000479|pid:none) Mycobacterium avium 104, comple... 144 6e-33 CR382126_803(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 144 6e-33 CP000539_2458(CP000539|pid:none) Acidovorax sp. JS42, complete g... 144 6e-33 CP001628_265(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 144 6e-33 CP001252_2793(CP001252|pid:none) Shewanella baltica OS223, compl... 144 6e-33 CT573326_4003(CT573326|pid:none) Pseudomonas entomophila str. L4... 144 8e-33 CP000529_1988(CP000529|pid:none) Polaromonas naphthalenivorans C... 143 1e-32 CP000926_4370(CP000926|pid:none) Pseudomonas putida GB-1, comple... 143 1e-32 CP000854_4331(CP000854|pid:none) Mycobacterium marinum M, comple... 143 1e-32 CP000083_1567(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 143 1e-32 AM458201_2(AM458201|pid:none) Vitis vinifera contig VV78X173640.... 143 1e-32 CU928178_42(CU928178|pid:none) Zygosaccharomyces rouxii strain C... 142 3e-32 CP000884_2989(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 142 3e-32 BX248356_162(BX248356|pid:none) Corynebacterium diphtheriae grav... 142 3e-32 CP000712_4256(CP000712|pid:none) Pseudomonas putida F1, complete... 141 5e-32 CP000512_3318(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 140 6e-32 AE015451_1400(AE015451|pid:none) Pseudomonas putida KT2440 compl... 140 8e-32 CP000874_2056(CP000874|pid:none) Rhizobium sp. NGR234 plasmid pN... 140 1e-31 CP000494_3365(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 139 1e-31 CP000323_1509(CP000323|pid:none) Psychrobacter cryohalolentis K5... 139 2e-31 AE017341_296(AE017341|pid:none) Cryptococcus neoformans var. neo... 139 2e-31 CP001601_867(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 139 2e-31 CP000474_475(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 139 2e-31 CP000580_4344(CP000580|pid:none) Mycobacterium sp. JLS, complete... 138 3e-31 CP000490_1629(CP000490|pid:none) Paracoccus denitrificans PD1222... 138 3e-31 CP000384_4138(CP000384|pid:none) Mycobacterium sp. MCS, complete... 138 3e-31 AM942444_571(AM942444|pid:none) Corynebacterium urealyticum DSM ... 138 4e-31 CP000462_2030(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 138 4e-31 AE000516_1138(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 138 4e-31 BX640415_121(BX640415|pid:none) Bordetella pertussis strain Toha... 137 7e-31 CT005269_384(CT005269|pid:none) Leishmania major strain Friedlin... 137 9e-31 CP000394_1815(CP000394|pid:none) Granulibacter bethesdensis CGDN... 136 1e-30 BX640427_262(BX640427|pid:none) Bordetella parapertussis strain ... 135 2e-30 CP001172_3340(CP001172|pid:none) Acinetobacter baumannii AB307-0... 135 2e-30 CP000438_4386(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 135 2e-30 AE004091_746(AE004091|pid:none) Pseudomonas aeruginosa PAO1, com... 135 2e-30 AE008922_1242(AE008922|pid:none) Xanthomonas campestris pv. camp... 135 3e-30 CP000362_2778(CP000362|pid:none) Roseobacter denitrificans OCh 1... 134 6e-30 CU234118_2964(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 134 6e-30 CP000319_2437(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 134 8e-30 CT573213_2731(CT573213|pid:none) Frankia alni str. ACN14A chromo... 134 8e-30 EF145507_1(EF145507|pid:none) Populus trichocarpa clone WS01125_... 133 1e-29 CP000863_1615(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 132 2e-29 CP001172_1868(CP001172|pid:none) Acinetobacter baumannii AB307-0... 132 2e-29 CP000699_644(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 132 2e-29 CP000521_1702(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 132 2e-29 CP000744_4722(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 132 2e-29 BT064324_1(BT064324|pid:none) Zea mays full-length cDNA clone ZM... 132 2e-29 CP000577_1775(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 132 3e-29 CP001150_1493(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 131 4e-29 CP001620_506(CP001620|pid:none) Corynebacterium kroppenstedtii D... 131 4e-29 AM167904_1755(AM167904|pid:none) Bordetella avium 197N complete ... 131 4e-29 AP009152_1959(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 131 5e-29 CP000301_3055(CP000301|pid:none) Rhodopseudomonas palustris BisB... 131 5e-29 CP001341_626(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 130 9e-29 CP000264_1908(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 130 1e-28 AE008923_1294(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 130 1e-28 CP000661_1323(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 130 1e-28 CP000967_3023(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 129 2e-28 AK069590_1(AK069590|pid:none) Oryza sativa Japonica Group cDNA c... 129 2e-28 CP000143_1759(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 129 2e-28 AM902716_2521(AM902716|pid:none) Bordetella petrii strain DSM 12... 129 2e-28 AP008229_1741(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 129 3e-28 AE013598_1817(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 129 3e-28 CP000830_1744(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 128 3e-28 CP001601_857(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 126 1e-27 AL138646_17(AL138646|pid:none) Arabidopsis thaliana DNA chromoso... 122 2e-26 BT070870_1(BT070870|pid:none) Picea sitchensis clone WS02757_D08... 120 7e-26 AF440524_20(AF440524|pid:none) Pseudomonas aeruginosa strain SG1... 120 9e-26 AM494969_391(AM494969|pid:none) Leishmania braziliensis chromoso... 119 2e-25 BT087820_1(BT087820|pid:none) Zea mays full-length cDNA clone ZM... 119 2e-25 EU962426_1(EU962426|pid:none) Zea mays clone 242532 unknown mRNA. 119 3e-25 CP000453_1582(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 117 1e-24 EU975003_1(EU975003|pid:none) Zea mays clone 462676 unknown mRNA. 115 4e-24 AL049607_1(AL049607|pid:none) Arabidopsis thaliana DNA chromosom... 113 1e-23 CP001331_133(CP001331|pid:none) Micromonas sp. RCC299 chromosome... 112 2e-23 AP008216_1383(AP008216|pid:none) Oryza sativa (japonica cultivar... 107 1e-21 AM502250_418(AM502250|pid:none) Leishmania infantum chromosome 32. 106 1e-21 AM502250_419(AM502250|pid:none) Leishmania infantum chromosome 32. 106 1e-21 AC010679_2(AC010679|pid:none) Homo sapiens BAC clone RP11-128O11... 103 1e-20 AM449059_2(AM449059|pid:none) Vitis vinifera contig VV78X190857.... 102 2e-20 BT064969_1(BT064969|pid:none) Zea mays full-length cDNA clone ZM... 94 1e-17 AM428196_2(AM428196|pid:none) Vitis vinifera contig VV78X040591.... 92 3e-17 AF462210_1(AF462210|pid:none) Narcissus pseudonarcissus putative... 91 6e-17 CP000252_3071(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 91 1e-16 AM494969_390(AM494969|pid:none) Leishmania braziliensis chromoso... 88 7e-16 AP009389_515(AP009389|pid:none) Pelotomaculum thermopropionicum ... 88 7e-16 CP000903_2305(CP000903|pid:none) Bacillus weihenstephanensis KBA... 88 7e-16 CP000557_1891(CP000557|pid:none) Geobacillus thermodenitrificans... 87 9e-16 AE017283_1855(AE017283|pid:none) Propionibacterium acnes KPA1712... 87 1e-15 BX572607_4(BX572607|pid:none) Rhodopseudomonas palustris CGA009 ... 87 1e-15 CP000557_1434(CP000557|pid:none) Geobacillus thermodenitrificans... 87 1e-15 CP000615_1234(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 87 1e-15 AM398681_49(AM398681|pid:none) Flavobacterium psychrophilum JIP0... 87 1e-15 AE008691_503(AE008691|pid:none) Thermoanaerobacter tengcongensis... 87 1e-15 CP001404_1245(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 86 2e-15 CP001399_1441(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 86 2e-15 CP001400_1341(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 86 2e-15 AE017194_2532(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 86 3e-15 AF218939_8(AF218939|pid:none) Bacillus subtilis FenH (fenH), Fen... 85 6e-15 CP001096_4745(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 85 6e-15 CP001635_4255(CP001635|pid:none) Variovorax paradoxus S110 chrom... 84 7e-15 CP000682_1964(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 84 7e-15 AY714845_24(AY714845|pid:none) Uncultured archaeon GZfos27B6 clo... 84 7e-15 CP001034_1850(CP001034|pid:none) Natranaerobius thermophilus JW/... 84 9e-15 BT069823_1(BT069823|pid:none) Zea mays full-length cDNA clone ZM... 84 9e-15 CP000542_4179(CP000542|pid:none) Verminephrobacter eiseniae EF01... 84 1e-14 AE016879_2347(AE016879|pid:none) Bacillus anthracis str. Ames, c... 84 1e-14 CP000148_2201(CP000148|pid:none) Geobacter metallireducens GS-15... 84 1e-14 GN123546_1(GN123546|pid:none) Sequence 6442 from Patent WO200903... 83 2e-14 GN123518_1(GN123518|pid:none) Sequence 6414 from Patent WO200903... 83 2e-14 CU207366_3167(CU207366|pid:none) Gramella forsetii KT0803 comple... 83 2e-14 CP001472_2221(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 83 2e-14 CP000001_2260(CP000001|pid:none) Bacillus cereus E33L, complete ... 82 3e-14 CP000448_1429(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 82 3e-14 AE017333_2036(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 82 3e-14 CP000157_2007(CP000157|pid:none) Erythrobacter litoralis HTCC259... 82 4e-14 (P52046) RecName: Full=3-hydroxybutyryl-CoA dehydratase; ... 82 4e-14 AL591688_2290(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 82 5e-14 CP000227_2328(CP000227|pid:none) Bacillus cereus Q1, complete ge... 82 5e-14 CP000764_1729(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 82 5e-14 AJ000330_12(AJ000330|pid:none) Pseudomonas sp. Y2 DNA for styren... 82 5e-14 BA000043_2038(BA000043|pid:none) Geobacillus kaustophilus HTA426... 81 6e-14 EU016653_26(EU016653|pid:none) Uncultured Group I marine crenarc... 81 6e-14 AM270003_13(AM270003|pid:none) Aspergillus niger contig An02c008... 81 6e-14 BA000043_1602(BA000043|pid:none) Geobacillus kaustophilus HTA426... 81 6e-14 CP000485_3001(CP000485|pid:none) Bacillus thuringiensis str. Al ... 81 6e-14 AE007870_472(AE007870|pid:none) Agrobacterium tumefaciens str. C... 81 6e-14 CP001087_988(CP001087|pid:none) Desulfobacterium autotrophicum H... 81 8e-14 CP001078_329(CP001078|pid:none) Clostridium botulinum E3 str. Al... 81 8e-14 CP000521_1444(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 80 1e-13 CP000708_1929(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 80 1e-13 CP000448_752(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 80 1e-13 CU459141_2228(CU459141|pid:none) Acinetobacter baumannii str. AY... 80 1e-13 BA000023_85(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, c... 80 1e-13 CP001172_2155(CP001172|pid:none) Acinetobacter baumannii AB307-0... 80 1e-13 CP000686_2238(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 80 1e-13 CP001357_111(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 80 1e-13 CP001488_2063(CP001488|pid:none) Brucella melitensis ATCC 23457 ... 80 1e-13 CP000148_2050(CP000148|pid:none) Geobacter metallireducens GS-15... 80 1e-13 BA000035_322(BA000035|pid:none) Corynebacterium efficiens YS-314... 80 1e-13 CP000001_3204(CP000001|pid:none) Bacillus cereus E33L, complete ... 80 2e-13 CP001176_2371(CP001176|pid:none) Bacillus cereus B4264, complete... 80 2e-13 BA000023_2585(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 80 2e-13 CR628337_905(CR628337|pid:none) Legionella pneumophila str. Lens... 80 2e-13 CP001022_740(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 80 2e-13 CP000817_870(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 80 2e-13 BA000004_3824(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 80 2e-13 CP000675_958(CP000675|pid:none) Legionella pneumophila str. Corb... 80 2e-13 AE009951_1596(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 80 2e-13 AE016877_2337(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 80 2e-13 AE017354_849(AE017354|pid:none) Legionella pneumophila subsp. pn... 80 2e-13 CP001322_3326(CP001322|pid:none) Desulfatibacillum alkenivorans ... 79 2e-13 AM998794_2(AM998794|pid:none) Clostridium saccharobutylicum ORF1... 79 2e-13 AC3495(AC3495) probable enoyl-CoA hydratase (EC 4.2.1.17) [impor... 79 2e-13 AP009152_510(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 79 2e-13 CU633900_891(CU633900|pid:none) Podospora anserina genomic DNA c... 79 3e-13 AK242840_1(AK242840|pid:none) Oryza sativa Japonica Group cDNA, ... 79 3e-13 GN119918_1(GN119918|pid:none) Sequence 2814 from Patent WO200903... 79 3e-13 (O34893) RecName: Full=Putative enoyl-CoA hydratase/isomerase yn... 79 3e-13 CP000077_1648(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 79 4e-13 AP009049_399(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 79 4e-13 AB471639_26(AB471639|pid:none) Desulfotignum balticum genomic DN... 79 4e-13 CP000866_1304(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 79 4e-13 GN123578_1(GN123578|pid:none) Sequence 6474 from Patent WO200903... 79 4e-13 CP000697_1430(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 78 5e-13 BA000016_95(BA000016|pid:none) Clostridium perfringens str. 13 D... 78 5e-13 AY892211_1(AY892211|pid:none) Synthetic construct Homo sapiens c... 78 7e-13 (Q5R646) RecName: Full=Enoyl-CoA hydratase, mitochondrial; ... 78 7e-13 AB170787_1(AB170787|pid:none) Macaca fascicularis brain cDNA clo... 78 7e-13 AY889749_1(AY889749|pid:none) Synthetic construct Homo sapiens c... 78 7e-13 CP000316_641(CP000316|pid:none) Polaromonas sp. JS666, complete ... 77 9e-13 CP000509_4057(CP000509|pid:none) Nocardioides sp. JS614, complet... 77 9e-13 CP000685_932(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 77 9e-13 CP000721_2012(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 77 1e-12 A97398(A97398) probable enoyl-CoA hydratase [imported] - Agrobac... 77 1e-12 AB2616(AB2616) enoyl CoA hydratase [imported] - Agrobacterium tu... 77 1e-12 AP008955_3856(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 77 2e-12 CP000272_806(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 77 2e-12 CP001638_1635(CP001638|pid:none) Geobacillus sp. WCH70, complete... 77 2e-12 GN123604_1(GN123604|pid:none) Sequence 6500 from Patent WO200903... 77 2e-12 CP000267_1543(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 77 2e-12 CP001390_239(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 76 2e-12 CP000094_2864(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 76 2e-12 AP008955_5001(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 76 2e-12 CP000529_3339(CP000529|pid:none) Polaromonas naphthalenivorans C... 76 2e-12 AM437571_3(AM437571|pid:none) Vitis vinifera contig VV78X212578.... 76 2e-12 AL132876_5(AL132876|pid:none) Caenorhabditis elegans YAC Y105E8A... 76 2e-12 CP000521_106(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 76 2e-12 CP001581_3408(CP001581|pid:none) Clostridium botulinum A2 str. K... 76 2e-12 CP001399_793(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 76 2e-12 D72628(D72628)probable 3-hydroxybutyryl-CoA dehydratase APE1484 ... 76 2e-12 BA000002_978(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 76 2e-12 CP000661_1520(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 76 2e-12 CP001623_586(CP001623|pid:none) Rhizobium leguminosarum bv. trif... 76 2e-12 AP006840_212(AP006840|pid:none) Symbiobacterium thermophilum IAM... 76 3e-12 CP001276_333(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 76 3e-12 CP000246_79(CP000246|pid:none) Clostridium perfringens ATCC 1312... 76 3e-12 CP000863_133(CP000863|pid:none) Acinetobacter baumannii ACICU, c... 76 3e-12 AM412317_3209(AM412317|pid:none) Clostridium botulinum A str. AT... 76 3e-12 CP001400_2505(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 75 3e-12 CP000158_2404(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 75 3e-12 CP000888_194(CP000888|pid:none) Brucella abortus S19 chromosome ... 75 3e-12 GN123320_1(GN123320|pid:none) Sequence 6216 from Patent WO200903... 75 3e-12 AP011115_4573(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 75 3e-12 CP000304_606(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 75 4e-12 CP000922_563(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 75 4e-12 CP001399_2631(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 75 4e-12 CP000698_2995(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 75 4e-12 CP001400_760(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 75 6e-12 (Q1ZXF1) RecName: Full=Probable enoyl-CoA hydratase, mitochondri... 75 6e-12 CP000076_3018(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 75 6e-12 CP001078_1733(CP001078|pid:none) Clostridium botulinum E3 str. A... 75 6e-12 CP000077_1031(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 75 6e-12 CP000076_2666(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 75 6e-12 CP000509_4242(CP000509|pid:none) Nocardioides sp. JS614, complet... 75 6e-12 CP001283_2952(CP001283|pid:none) Bacillus cereus AH820, complete... 75 6e-12 AE014292_214(AE014292|pid:none) Brucella suis 1330 chromosome II... 75 6e-12 AP011115_4496(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 75 6e-12 CP001489_203(CP001489|pid:none) Brucella melitensis ATCC 23457 c... 74 7e-12 AE006641_1188(AE006641|pid:none) Sulfolobus solfataricus P2, com... 74 7e-12 CP001114_461(CP001114|pid:none) Deinococcus deserti VCD115, comp... 74 7e-12 CP000542_1775(CP000542|pid:none) Verminephrobacter eiseniae EF01... 74 7e-12 EU974260_1(EU974260|pid:none) Zea mays clone 444239 methylglutac... 74 7e-12 CP000082_1171(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 74 7e-12 BA000012_6405(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 74 7e-12 CP001402_749(CP001402|pid:none) Sulfolobus islandicus M.16.4, co... 74 1e-11 CP000243_4520(CP000243|pid:none) Escherichia coli UTI89, complet... 74 1e-11 AE006641_2295(AE006641|pid:none) Sulfolobus solfataricus P2, com... 74 1e-11 AB190764_2(AB190764|pid:none) Butyrivibrio fibrisolvens thl, crt... 74 1e-11 AE013599_1862(AE013599|pid:none) Drosophila melanogaster chromos... 74 1e-11 CP000478_1382(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 74 1e-11 BA000028_2120(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 74 1e-11 CR382128_396(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 74 1e-11 CR555306_1026(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 74 1e-11 CT573326_2573(CT573326|pid:none) Pseudomonas entomophila str. L4... 74 1e-11 BX842653_156(BX842653|pid:none) Bdellovibrio bacteriovorus compl... 74 1e-11 CP000926_1830(CP000926|pid:none) Pseudomonas putida GB-1, comple... 74 1e-11 BA000043_1685(BA000043|pid:none) Geobacillus kaustophilus HTA426... 74 1e-11 BA000016_2301(BA000016|pid:none) Clostridium perfringens str. 13... 74 1e-11 AP008955_5002(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 74 1e-11 CP000682_399(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 73 2e-11 BX640451_129(BX640451|pid:none) Bordetella bronchiseptica strain... 73 2e-11 CU459003_1464(CU459003|pid:none) Magnetospirillum gryphiswaldens... 73 2e-11 CP000728_3184(CP000728|pid:none) Clostridium botulinum F str. La... 73 2e-11 CP000383_17(CP000383|pid:none) Cytophaga hutchinsonii ATCC 33406... 73 2e-11 CP000682_384(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 73 2e-11 CP000141_1557(CP000141|pid:none) Carboxydothermus hydrogenoforma... 73 2e-11 (P14604) RecName: Full=Enoyl-CoA hydratase, mitochondrial; ... 73 2e-11 CP000774_1681(CP000774|pid:none) Parvibaculum lavamentivorans DS... 73 2e-11 GN119864_1(GN119864|pid:none) Sequence 2760 from Patent WO200903... 73 2e-11 AF029714_4(AF029714|pid:none) Pseudomonas putida transcriptional... 73 2e-11 D13900_1(D13900|pid:none) Homo sapiens mRNA for mitochondrial sh... 73 2e-11 CP000251_1640(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 73 2e-11 CP001389_3632(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 72 3e-11 EU686636_5(EU686636|pid:none) Uncultured marine group III euryar... 72 3e-11 AE015451_3688(AE015451|pid:none) Pseudomonas putida KT2440 compl... 72 3e-11 DQ987697_3(DQ987697|pid:none) Butyrate-producing bacterium L2-50... 72 3e-11 CP000804_3078(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 72 3e-11 CP000774_566(CP000774|pid:none) Parvibaculum lavamentivorans DS-... 72 3e-11 CP001401_392(CP001401|pid:none) Sulfolobus islandicus M.16.27, c... 72 3e-11 CP000230_3790(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 72 3e-11 CP000813_1753(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 72 3e-11 AJ400821_6(AJ400821|pid:none) Capsella rubella ORF1, ORF2, ORF3,... 72 3e-11 AE015451_3257(AE015451|pid:none) Pseudomonas putida KT2440 compl... 72 3e-11 CP001281_840(CP001281|pid:none) Thauera sp. MZ1T, complete genome. 72 4e-11 CP000884_1526(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 72 4e-11 BT074974_1(BT074974|pid:none) Osmerus mordax clone omor-eva-509-... 72 4e-11 CP000712_2433(CP000712|pid:none) Pseudomonas putida F1, complete... 72 4e-11 BT078384_1(BT078384|pid:none) Lepeophtheirus salmonis Pacific fo... 72 4e-11 AM920689_2759(AM920689|pid:none) Xanthomonas campestris pv. camp... 72 4e-11 CP000356_3033(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 72 4e-11 CP000390_2918(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 72 4e-11 AM236080_377(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 72 5e-11 AL445063_60(AL445063|pid:none) Thermoplasma acidophilum complete... 72 5e-11 CP001392_2878(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 72 5e-11 CP000539_3479(CP000539|pid:none) Acidovorax sp. JS42, complete g... 72 5e-11 CP001399_406(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 72 5e-11 CU928162_4908(CU928162|pid:none) Escherichia coli ED1a chromosom... 72 5e-11 CP001407_2876(CP001407|pid:none) Bacillus cereus 03BB102, comple... 72 5e-11 DQ311162_1(DQ311162|pid:none) Bombyx mori enoyl-CoA hydratase pr... 72 5e-11 BA000035_2772(BA000035|pid:none) Corynebacterium efficiens YS-31... 72 5e-11 CP000926_2595(CP000926|pid:none) Pseudomonas putida GB-1, comple... 72 5e-11 CP000077_2064(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 72 5e-11 CP001191_4324(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 72 5e-11 AM181176_2960(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 71 6e-11 CP000655_1550(CP000655|pid:none) Polynucleobacter necessarius su... 71 6e-11 CP000473_6134(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 71 6e-11 CP000359_1783(CP000359|pid:none) Deinococcus geothermalis DSM 11... 71 6e-11 AM902716_1120(AM902716|pid:none) Bordetella petrii strain DSM 12... 71 6e-11 CP000509_1169(CP000509|pid:none) Nocardioides sp. JS614, complet... 71 6e-11 CP001400_373(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 71 6e-11 GN123370_1(GN123370|pid:none) Sequence 6266 from Patent WO200903... 71 6e-11 CP000970_4486(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 71 6e-11 CP001276_99(CP001276|pid:none) Thermomicrobium roseum DSM 5159 p... 71 6e-11 CP000148_1697(CP000148|pid:none) Geobacter metallireducens GS-15... 71 6e-11 CP000248_1732(CP000248|pid:none) Novosphingobium aromaticivorans... 71 6e-11 A42560(A42560)4-chlorobenzoate dehalogenase (EC 3.8.1.6), 30K ch... 71 6e-11 AE017355_2672(AE017355|pid:none) Bacillus thuringiensis serovar ... 71 6e-11 DQ384311_1(DQ384311|pid:none) Isochrysis galbana enoyl-CoA hydra... 71 6e-11 CP000781_3278(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 71 8e-11 AP008229_2323(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 71 8e-11 AE013598_2406(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 71 8e-11 CP000390_4063(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 71 8e-11 CP000712_2000(CP000712|pid:none) Pseudomonas putida F1, complete... 71 8e-11 CP000036_3936(CP000036|pid:none) Shigella boydii Sb227, complete... 71 8e-11 CU633749_1605(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 71 8e-11 CP000352_2594(CP000352|pid:none) Ralstonia metallidurans CH34, c... 71 8e-11 AM946981_4036(AM946981|pid:none) Escherichia coli BL21, complete... 71 8e-11 CP000852_329(CP000852|pid:none) Caldivirga maquilingensis IC-167... 71 8e-11 CP000946_3721(CP000946|pid:none) Escherichia coli ATCC 8739, com... 71 8e-11 CP000247_4407(CP000247|pid:none) Escherichia coli 536, complete ... 71 8e-11 AM483925_3(AM483925|pid:none) Vitis vinifera contig VV78X070771.... 71 8e-11 CP000077_1927(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 71 8e-11 CP001322_1726(CP001322|pid:none) Desulfatibacillum alkenivorans ... 70 1e-10 BX842651_35(BX842651|pid:none) Bdellovibrio bacteriovorus comple... 70 1e-10 A69534(A69534) 3-hydroxyacyl-CoA dehydrogenase (hbd-10) homolog ... 70 1e-10 AM902716_4374(AM902716|pid:none) Bordetella petrii strain DSM 12... 70 1e-10 AE014075_5191(AE014075|pid:none) Escherichia coli CFT073, comple... 70 1e-10 CP001074_385(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 70 1e-10 CU928164_4630(CU928164|pid:none) Escherichia coli IAI39 chromoso... 70 1e-10 CP000362_3063(CP000362|pid:none) Roseobacter denitrificans OCh 1... 70 1e-10 AF290950_5(AF290950|pid:none) Pseudomonas putida FadDx (fadDx), ... 70 1e-10 BC171144_1(BC171144|pid:none) Xenopus tropicalis hypothetical pr... 70 1e-10 AE008922_1510(AE008922|pid:none) Xanthomonas campestris pv. camp... 70 1e-10 GN119852_1(GN119852|pid:none) Sequence 2748 from Patent WO200903... 70 1e-10 CP000485_2515(CP000485|pid:none) Bacillus thuringiensis str. Al ... 70 1e-10 (Q58DM8) RecName: Full=Enoyl-CoA hydratase, mitochondrial; ... 70 1e-10 CP000968_114(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 70 1e-10 CP000557_962(CP000557|pid:none) Geobacillus thermodenitrificans ... 70 1e-10 AM942759_3517(AM942759|pid:none) Proteus mirabilis strain HI4320... 70 1e-10
>(Q58EB4) RecName: Full=3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; EC=3.1.2.4; AltName: Full=3-hydroxyisobutyryl-coenzyme A hydrolase; Short=HIB-CoA hydrolase; Short=HIBYL-CoA-H; Flags: Precursor; &BC091995_1(BC091995|pid:none) &BC164778_1(BC164778|pid:none) Length = 382
Score = 201 bits (511), Expect = 4e-50 Identities = 118/340 (34%), Positives = 197/340 (57%), Gaps = 3/340 (0%) Frame = +2
Query: 113 IILNRSEALNSLTMEMLKFLSEKLKEFNNDDNCKFVIINSSTEKSFCSGGDIKEFSQLSR 292 I LNR +ALN+LT+ M++ + +LK+++ D VII + EK+FC+GGDI+ ++ + Sbjct: 45 ITLNRPKALNALTLNMIRHIYPQLKKWDKDSETDIVIIKGAGEKAFCAGGDIRAIAEAGK 104
Query: 293 SSAGVNE-FIRVEYAMDHLIHTFNKPILSFVNGIVMGGGVGLSIHSSHRIIGDNVQWAMP 469 + +++ F R EY +++ I T+ KP ++ +NGI MGGGVGLS+H R+ + +AMP Sbjct: 105 AGNLLSQVFFREEYILNNTIGTYQKPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMP 164
Query: 470 ENRIGYFPDVGTSYFLSRL-GSIGLYLAMVGVKINSKDLINVKLATHYIPNELFERTLEE 646 E IG FPDVG YFL RL G +GL+LA+ G ++ +D+ V +ATH++ +E E +LE+ Sbjct: 165 ETGIGLFPDVGGGYFLPRLQGKLGLFLALTGFRLKGRDVQRVGVATHFVQSEKIE-SLEK 223
Query: 647 LCNDDDIEGYRQIEFILNKYRKTLYPDKESSHLVLYQS-IINRCFNNKEFKSVKEILNQL 823 D + +L+ Y++ + D E ++ Q+ I+R F+ SV+EI+ L Sbjct: 224 DLVDLKSPSISDVAQLLDSYQEQSHLDAEKPFVLQEQTEAIDRLFS---AGSVEEIVENL 280
Query: 824 KVEIENVDNKNNKDEIEWASKTLSILLDQLCPTSVCVSFEIIKRALQMNIDQIFQMEVRV 1003 K KD +A K L ++ PTS+ ++F I+ +M++ ++F ME R+ Sbjct: 281 K-----------KDGSAFALKQAETLA-KMSPTSLKLTFRQIEEGARMSLQEVFMMEYRL 328
Query: 1004 GTRLGNRQDLTQGVFKTLIDKTHKPIYSPSSIYDINQSFM 1123 N D +GV LIDK P + PS++ +++ F+ Sbjct: 329 SQACMNGHDFYEGVRAVLIDKDQSPKWKPSTLAGVSEQFV 368
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 1,576,709,235 Number of extensions: 29684574 Number of successful extensions: 88786 Number of sequences better than 10.0: 2950 Number of HSP's gapped: 86423 Number of HSP's successfully gapped: 2977 Length of query: 380 Length of database: 1,061,185,681 Length adjustment: 130 Effective length of query: 250 Effective length of database: 636,287,441 Effective search space: 159071860250 Effective search space used: 159071860250 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
0 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
1 |
SH (FL, L) |
0 |
SF (FL, S) |
1 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |