NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U03504-1
Contig ID Contig-U03504-1
Contig update 2001. 8.29
Contig sequence 
>Contig-U03504-1 (Contig-U03504-1Q) /CSM_Contig/Contig-U03504-1Q.Seq.d
CTGTCACACCATCACTATTTGTTCCAGGCACATTGGCAGCATGTAATGTT
ATCCTATATTGCTGGTACACCGATTTGAAGAGGGTCACACCCTTGAATAC
TTGGATTGGCGCATTCGTCGGTGCCATCCCCGCCATTAATCGGCTCGGTT
GCTGCCACTGGTGAATTTGAAGCAATCGGTATGCTATTGGCTACCTTTAT
GTACATTTGGCAAATTCCTCATTTCTTAGCACTCTCTCAAGTACTTCGTG
AACAATATCGTGGTGCAGGTTATAAAATGTTATCAGTGACTCACGAAAAG
AAAACAGTGGATCGTGTTTCATTGGCTCATGCTTTATTTGGTATTCCATT
GCCTTTCATCTTTGACTATTTCTTTAATTTCAACGTTCATCCAATCACTC
TCACTTGTATGGCATTAAGTAGTGCCTCTTTAGCATTACCATTCATCACT
AAAATCTCTCCAAAACGTTTATATATCATATCCTTAATATCTTTAC
Gap no gap
Contig length 496
Chromosome number (1..6, M) 5
Chromosome length 5062330
Start point 1169765
End point 1169289
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U03504
List of clone(s) 

est1=SFE126Z,1,497
Translated Amino Acid sequence 
lshhhylfqahwqhvmlsyiagtpi*rgshp*ILGLAHSSVPSPPLIGSVAATGEFEAIG
MLLATFMYIWQIPHFLALSQVLREQYRGAGYKMLSVTHEKKTVDRVSLAHALFGIPLPFI
FDYFFNFNVHPITLTCMALSSASLALPFITKISPKRLYIISLISL
Translated Amino Acid sequence (All Frames) 
Frame A:
lshhhylfqahwqhvmlsyiagtpi*rgshp*ILGLAHSSVPSPPLIGSVAATGEFEAIG
MLLATFMYIWQIPHFLALSQVLREQYRGAGYKMLSVTHEKKTVDRVSLAHALFGIPLPFI
FDYFFNFNVHPITLTCMALSSASLALPFITKISPKRLYIISLISL


Frame B:
chtiticsrhigsm*cypillvhrfeeghtleyldwrirrchprh*sarllplvnlkqsv
cywlplctfgkflis*hslkyfvnnivvqvikcyq*ltkrkqwivfhwlmlylvfhclss
ltislistfiqslslvwh*vvpl*hyhsslkslqnvyisyp*yly


Frame C:
vtpslfvpgtlaacnvilycwytdlkrvtplntwigafvgaipainrlgcchw*i*snry
aigylyvhlanssflstlssts*tiswcrl*nvisdsrkensgscfigscfiwysiafhl
*lfl*fqrssnhshlygik*clfsitihh*nlsktfiyhilnif
own update 2004. 6. 9
Homology vs CSM-cDNA 
Query= Contig-U03504-1 (Contig-U03504-1Q)
/CSM_Contig/Contig-U03504-1Q.Seq.d
         (496 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U03504-1 (Contig-U03504-1Q) /CSM_Contig/Conti...   983  0.0
Contig-U13909-1 (Contig-U13909-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U12466-1 (Contig-U12466-1Q) /CSM_Contig/Conti...    32  0.54
Contig-U11896-1 (Contig-U11896-1Q) /CSM_Contig/Conti...    32  0.54
Contig-U11421-1 (Contig-U11421-1Q) /CSM_Contig/Conti...    32  0.54
Contig-U10692-1 (Contig-U10692-1Q) /CSM_Contig/Conti...    32  0.54
Contig-U13978-1 (Contig-U13978-1Q) /CSM_Contig/Conti...    30  2.1
Contig-U13531-1 (Contig-U13531-1Q) /CSM_Contig/Conti...    30  2.1
Contig-U12581-1 (Contig-U12581-1Q) /CSM_Contig/Conti...    30  2.1
Contig-U12323-1 (Contig-U12323-1Q) /CSM_Contig/Conti...    30  2.1

>Contig-U03504-1 (Contig-U03504-1Q) /CSM_Contig/Contig-U03504-1Q.Seq.d
          Length = 496

 Score =  983 bits (496), Expect = 0.0
 Identities = 496/496 (100%)
 Strand = Plus / Plus

                                                                       
Query: 1   ctgtcacaccatcactatttgttccaggcacattggcagcatgtaatgttatcctatatt 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   ctgtcacaccatcactatttgttccaggcacattggcagcatgtaatgttatcctatatt 60

                                                                       
Query: 61  gctggtacaccgatttgaagagggtcacacccttgaatacttggattggcgcattcgtcg 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  gctggtacaccgatttgaagagggtcacacccttgaatacttggattggcgcattcgtcg 120

                                                                       
Query: 121 gtgccatccccgccattaatcggctcggttgctgccactggtgaatttgaagcaatcggt 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gtgccatccccgccattaatcggctcggttgctgccactggtgaatttgaagcaatcggt 180

                                                                       
Query: 181 atgctattggctacctttatgtacatttggcaaattcctcatttcttagcactctctcaa 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 atgctattggctacctttatgtacatttggcaaattcctcatttcttagcactctctcaa 240

                                                                       
Query: 241 gtacttcgtgaacaatatcgtggtgcaggttataaaatgttatcagtgactcacgaaaag 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gtacttcgtgaacaatatcgtggtgcaggttataaaatgttatcagtgactcacgaaaag 300

                                                                       
Query: 301 aaaacagtggatcgtgtttcattggctcatgctttatttggtattccattgcctttcatc 360
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 aaaacagtggatcgtgtttcattggctcatgctttatttggtattccattgcctttcatc 360

                                                                       
Query: 361 tttgactatttctttaatttcaacgttcatccaatcactctcacttgtatggcattaagt 420
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tttgactatttctttaatttcaacgttcatccaatcactctcacttgtatggcattaagt 420

                                                                       
Query: 421 agtgcctctttagcattaccattcatcactaaaatctctccaaaacgtttatatatcata 480
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 agtgcctctttagcattaccattcatcactaaaatctctccaaaacgtttatatatcata 480

                           
Query: 481 tccttaatatctttac 496
           ||||||||||||||||
Sbjct: 481 tccttaatatctttac 496


>Contig-U13909-1 (Contig-U13909-1Q) /CSM_Contig/Contig-U13909-1Q.Seq.d
          Length = 2788

 Score = 34.2 bits (17), Expect = 0.14
 Identities = 17/17 (100%)
 Strand = Plus / Plus

                             
Query: 441  attcatcactaaaatct 457
            |||||||||||||||||
Sbjct: 2642 attcatcactaaaatct 2658


>Contig-U12466-1 (Contig-U12466-1Q) /CSM_Contig/Contig-U12466-1Q.Seq.d
          Length = 1285

 Score = 32.2 bits (16), Expect = 0.54
 Identities = 22/24 (91%)
 Strand = Plus / Minus

                                   
Query: 449 ctaaaatctctccaaaacgtttat 472
           |||||||||||| | |||||||||
Sbjct: 757 ctaaaatctctctacaacgtttat 734


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 3244
Number of Sequences: 6905
Number of extensions: 3244
Number of successful extensions: 289
Number of sequences better than 10.0: 70
length of query: 496
length of database: 5,674,871
effective HSP length: 16
effective length of query: 480
effective length of database: 5,564,391
effective search space: 2670907680
effective search space used: 2670907680
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 6. 2
Homology vs DNA 
Query= Contig-U03504-1 (Contig-U03504-1Q) /CSM_Contig/Contig-U03504-1Q.Seq.d
         (496 letters)

Database: ddbj_A
           102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(BJ400212) Dictyostelium discoideum cDNA clone:dds9c07, 3' e...   983   0.0    1
(AL138924) Human DNA sequence from clone RP11-39O22 on chrom...    48   0.32   1
(CU468317) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    46   1.3    1
(CT544211) A BAC library has been constructed from cultivar ...    46   1.3    1
(CT109513) Sus scrofa genomic clone CH242-218H8, genomic sur...    46   1.3    1
(DW142356) CLSZ1588.b1_G13.ab1 CLS(XYZ) lettuce sativa Lactu...    46   1.3    1
(AC184098) Populus trichocarpa clone Pop1-90I7, complete seq...    40   3.7    3
(AC187489) Rhesus macaque BAC clone CH250-96H12 from chromos...    44   5.0    1

>(BJ400212) Dictyostelium discoideum cDNA clone:dds9c07, 3' end,
           single read.
          Length = 497

 Score =  983 bits (496), Expect = 0.0
 Identities = 496/496 (100%)
 Strand = Plus / Minus


Query: 1   ctgtcacaccatcactatttgttccaggcacattggcagcatgtaatgttatcctatatt 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 497 ctgtcacaccatcactatttgttccaggcacattggcagcatgtaatgttatcctatatt 438


Query: 61  gctggtacaccgatttgaagagggtcacacccttgaatacttggattggcgcattcgtcg 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 437 gctggtacaccgatttgaagagggtcacacccttgaatacttggattggcgcattcgtcg 378


Query: 121 gtgccatccccgccattaatcggctcggttgctgccactggtgaatttgaagcaatcggt 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 377 gtgccatccccgccattaatcggctcggttgctgccactggtgaatttgaagcaatcggt 318


Query: 181 atgctattggctacctttatgtacatttggcaaattcctcatttcttagcactctctcaa 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 317 atgctattggctacctttatgtacatttggcaaattcctcatttcttagcactctctcaa 258


Query: 241 gtacttcgtgaacaatatcgtggtgcaggttataaaatgttatcagtgactcacgaaaag 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 257 gtacttcgtgaacaatatcgtggtgcaggttataaaatgttatcagtgactcacgaaaag 198


Query: 301 aaaacagtggatcgtgtttcattggctcatgctttatttggtattccattgcctttcatc 360
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 197 aaaacagtggatcgtgtttcattggctcatgctttatttggtattccattgcctttcatc 138


Query: 361 tttgactatttctttaatttcaacgttcatccaatcactctcacttgtatggcattaagt 420
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 137 tttgactatttctttaatttcaacgttcatccaatcactctcacttgtatggcattaagt 78


Query: 421 agtgcctctttagcattaccattcatcactaaaatctctccaaaacgtttatatatcata 480
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77  agtgcctctttagcattaccattcatcactaaaatctctccaaaacgtttatatatcata 18


Query: 481 tccttaatatctttac 496
           ||||||||||||||||
Sbjct: 17  tccttaatatctttac 2

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 520,850,626
Number of extensions: 28534672
Number of successful extensions: 2125183
Number of sequences better than 10.0: 10
Length of query: 496
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 473
Effective length of database: 99,442,330,388
Effective search space: 47036222273524
Effective search space used: 47036222273524
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 7.28
Homology vs Protein 
Query= Contig-U03504-1 (Contig-U03504-1Q) /CSM_Contig/Contig-U03504-1Q.Seq.d
         (496 letters)

Database: nrp_A
           3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

T01579(T01579;T02407)heme A farnesyltransferase homolog F16B22.1...    69   1e-18
E84879(E84879)probable heme A farnesyltransferase [imported] - A...    69   1e-18
AK061861_1(AK061861|pid:none) Oryza sativa Japonica Group cDNA c...    67   2e-18
BT040092_1(BT040092|pid:none) Zea mays full-length cDNA clone ZM...    66   3e-18
BC158428_1(BC158428|pid:none) Xenopus tropicalis hypothetical pr...    68   3e-18
BC124463_1(BC124463|pid:none) Danio rerio hypothetical protein L...    67   3e-18
AK171661_1(AK171661|pid:none) Mus musculus activated spleen cDNA...    66   4e-18
AK149999_1(AK149999|pid:none) Mus musculus bone marrow macrophag...    66   4e-18
AJ720296_1(AJ720296|pid:none) Gallus gallus mRNA for hypothetica...    66   6e-18
FN357449_3(FN357449|pid:none) Schistosoma mansoni genome sequenc...    64   7e-18
BC151873_1(BC151873|pid:none) Danio rerio hypothetical protein L...    67   7e-18
EU974253_1(EU974253|pid:none) Zea mays clone 443874 protoheme IX...    65   7e-18
AY809878_1(AY809878|pid:none) Schistosoma japonicum SJCHGC08457 ...    65   1e-17
BC123368_1(BC123368|pid:none) Xenopus laevis hypothetical protei...    66   1e-17
AB168550_1(AB168550|pid:none) Macaca fascicularis testis cDNA cl...    65   1e-17
BC140517_1(BC140517|pid:none) Bos taurus COX10 homolog, cytochro...    65   2e-17
AY892375_1(AY892375|pid:none) Synthetic construct Homo sapiens c...    65   2e-17
AK295925_1(AK295925|pid:none) Homo sapiens cDNA FLJ52303 complet...    65   2e-17
(Q5R460) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    64   4e-17
I38603(I38603) heme A farnesyltransferase (EC 2.5.1.-) - human  ...    62   1e-16
(Q6BKW6) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    60   8e-16
FM992692_191(FM992692|pid:none) Candida dubliniensis CD36 chromo...    57   7e-15
AM920428_811(AM920428|pid:none) Penicillium chrysogenum Wisconsi...    58   2e-14
CP000499_239(CP000499|pid:none) Pichia stipitis CBS 6054 chromos...    55   3e-14
FN392319_197(FN392319|pid:none) Pichia pastoris GS115 chromosome...    54   3e-14
AP007157_644(AP007157|pid:none) Aspergillus oryzae RIB40 genomic...    56   5e-14
AC159443_17(AC159443|pid:none) Trypanosoma brucei chromosome 5 c...    59   6e-14
(Q4WP81) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    55   7e-14
(Q6CTW6) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    55   7e-14
CT005262_191(CT005262|pid:none) Leishmania major strain Friedlin...    58   1e-13
CU633876_156(CU633876|pid:none) Podospora anserina genomic DNA c...    55   2e-13
AM270074_13(AM270074|pid:none) Aspergillus niger contig An04c013...    54   3e-13
AM502241_192(AM502241|pid:none) Leishmania infantum chromosome 23.     56   4e-13
(Q9Y7Y4) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    52   1e-12
(Q4I5G1) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    54   2e-12
(Q7S5E7) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    51   2e-12
(P21592) RecName: Full=Protoheme IX farnesyltransferase, mitocho...    53   2e-12
CR954204_517(CR954204|pid:none) Ostreococcus tauri strain OTTH05...    55   3e-12
CP001330_152(CP001330|pid:none) Micromonas sp. RCC299 chromosome...    53   5e-12
AL110484_30(AL110484|pid:none) Caenorhabditis elegans YAC Y38E10...    60   5e-11
(A4ILX0) RecName: Full=Protoheme IX farnesyltransferase;        ...    64   8e-11
CP000383_2175(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334...    56   1e-10
(Q11SZ7) RecName: Full=Protoheme IX farnesyltransferase;        ...    56   1e-10
(Q5L114) RecName: Full=Protoheme IX farnesyltransferase;        ...    64   1e-10
D70843_2(D70843|pid:none) Bacillus stearothermophilus genes for ...    64   2e-10
CP000975_1421(CP000975|pid:none) Methylacidiphilum infernorum V4...    45   3e-10
CP000485_3384(CP000485|pid:none) Bacillus thuringiensis str. Al ...    57   1e-09
(A0RHW3) RecName: Full=Protoheme IX farnesyltransferase;        ...    57   1e-09
(B7H6T1) RecName: Full=Protoheme IX farnesyltransferase;        ...    57   1e-09
(B7JK33) RecName: Full=Protoheme IX farnesyltransferase;        ...    57   1e-09
(B7IVI2) RecName: Full=Protoheme IX farnesyltransferase;        ...    57   1e-09
(A7H8V9) RecName: Full=Protoheme IX farnesyltransferase;        ...    64   3e-09
(Q8CXI8) RecName: Full=Protoheme IX farnesyltransferase;        ...    60   3e-09
CP000764_2505(CP000764|pid:none) Bacillus cereus subsp. cytotoxi...    57   4e-09
AP008955_4981(AP008955|pid:none) Brevibacillus brevis NBRC 10059...    50   9e-09
AM746676_2901(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    62   1e-08
CP000922_1846(CP000922|pid:none) Anoxybacillus flavithermus WK1,...    62   1e-08
AC146329_13(AC146329|pid:none) Medicago truncatula clone mth2-5i...    61   1e-08
CP001614_77(CP001614|pid:none) Teredinibacter turnerae T7901, co...    56   2e-08
CP000514_69(CP000514|pid:none) Marinobacter aquaeolei VT8, compl...    55   2e-08
(A1TWQ8) RecName: Full=Protoheme IX farnesyltransferase;        ...    55   2e-08
(Q5LNX8) RecName: Full=Protoheme IX farnesyltransferase;        ...    54   4e-08
(Q9K9M9) RecName: Full=Protoheme IX farnesyltransferase;        ...    50   4e-08
AM910992_132(AM910992|pid:none) Plasmodium knowlesi strain H chr...    42   6e-08
(A4WQ57) RecName: Full=Protoheme IX farnesyltransferase;        ...    54   6e-08
(A9VUA6) RecName: Full=Protoheme IX farnesyltransferase;        ...    53   6e-08
(A6H1E4) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   1e-07
CP000251_898(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C...    56   1e-07
CP001359_942(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C...    56   1e-07
CP001131_942(CP001131|pid:none) Anaeromyxobacter sp. K, complete...    56   1e-07
(Q2IPE5) RecName: Full=Protoheme IX farnesyltransferase;        ...    56   1e-07
(O31652) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    58   1e-07
AL009126_1247(AL009126|pid:none) Bacillus subtilis subsp. subtil...    58   1e-07
CP000159_2311(CP000159|pid:none) Salinibacter ruber DSM 13855, c...    42   1e-07
(B1ZMT0) RecName: Full=Protoheme IX farnesyltransferase;        ...    50   1e-07
(A3PGX5) RecName: Full=Protoheme IX farnesyltransferase;        ...    52   2e-07
CP001150_133(CP001150|pid:none) Rhodobacter sphaeroides KD131 ch...    52   2e-07
(Q4KKL2) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    52   2e-07
CP000685_1652(CP000685|pid:none) Flavobacterium johnsoniae UW101...    43   2e-07
(B1Y6Q4) RecName: Full=Protoheme IX farnesyltransferase;        ...    54   2e-07
CP001099_860(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ...    47   4e-07
(Q1GTA5) RecName: Full=Protoheme IX farnesyltransferase;        ...    56   4e-07
(Q2JNL3) RecName: Full=Protoheme IX farnesyltransferase;        ...    54   5e-07
AM181176_66(AM181176|pid:none) Pseudomonas fluorescens SBW25 com...    51   5e-07
(Q3SLW5) RecName: Full=Protoheme IX farnesyltransferase;        ...    54   5e-07
CP001154_179(CP001154|pid:none) Laribacter hongkongensis HLHK9, ...    54   6e-07
(Q3KK91) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    50   6e-07
(A3Q941) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    49   6e-07
AY658938_1(AY658938|pid:none) Synthetic construct Peudomonas aer...    50   1e-06
(A6UXP9) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    50   1e-06
(Q88RL9) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    49   1e-06
(B0KFZ0) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    49   1e-06
(A5VWP2) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    49   1e-06
(A7N6I9) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    50   1e-06
(A8H9S9) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   1e-06
(Q71XV7) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   1e-06
AP009384_2958(AP009384|pid:none) Azorhizobium caulinodans ORS 57...    49   2e-06
(A8IDL3) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   2e-06
(Q8Y5K3) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   2e-06
(Q3J6R6) RecName: Full=Protoheme IX farnesyltransferase;        ...    54   2e-06
(Q3IJQ0) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    47   2e-06
CP001281_1005(CP001281|pid:none) Thauera sp. MZ1T, complete geno...    47   2e-06
(A4XNK8) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   2e-06
(A4VS42) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   2e-06
(Q0HDK5) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    47   2e-06
(Q0HPV6) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    47   2e-06
(Q8E8P7) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   2e-06
(B1KM58) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    47   3e-06
(A0AKG3) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   3e-06
BT060595_1(BT060595|pid:none) Zea mays full-length cDNA clone ZM...    53   3e-06
FM954973_365(FM954973|pid:none) Vibrio splendidus LGP32 chromoso...    48   4e-06
(A1SBD7) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   4e-06
(A0LXT1) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   4e-06
(Q1IGZ4) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    47   5e-06
(Q47G19) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   5e-06
(A4T079) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   5e-06
(Q01YC2) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   5e-06
CP000584_478(CP000584|pid:none) Ostreococcus lucimarinus CCE9901...    52   6e-06
(B0C0A5) RecName: Full=Protoheme IX farnesyltransferase;        ...    51   6e-06
AY458649_128(AY458649|pid:none) Uncultured marine bacterium 582 ...    44   6e-06
(A1BA40) RecName: Full=Protoheme IX farnesyltransferase;        ...    52   8e-06
(Q7P0G0) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    52   8e-06
(Q2G9W3) RecName: Full=Protoheme IX farnesyltransferase;        ...    52   8e-06
(A5VD56) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   8e-06
(Q2YCM2) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   8e-06
(Q6LVR2) RecName: Full=Protoheme IX farnesyltransferase;        ...    52   1e-05
CR378663_158(CR378663|pid:none) Photobacterium profundum SS9; se...    52   1e-05
(B0JGA8) RecName: Full=Protoheme IX farnesyltransferase;        ...    52   1e-05
(B1XKB3) RecName: Full=Protoheme IX farnesyltransferase;        ...    52   1e-05
CP000934_857(CP000934|pid:none) Cellvibrio japonicus Ueda107, co...    45   1e-05
(Q15N01) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    45   1e-05
CP001635_4330(CP001635|pid:none) Variovorax paradoxus S110 chrom...    49   1e-05
(Q7MDC8) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   1e-05
(O66544) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   1e-05
(A5G0I2) RecName: Full=Protoheme IX farnesyltransferase;        ...    51   1e-05
AM778904_19(AM778904|pid:none) Microcystis aeruginosa PCC 7806 g...    51   1e-05
(Q39CQ5) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   1e-05
(B1YN86) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   1e-05
(Q0BBM3) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   1e-05
(Q82VQ6) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   1e-05
CP001114_2022(CP001114|pid:none) Deinococcus deserti VCD115, com...    51   2e-05
(Q1D1K4) RecName: Full=Protoheme IX farnesyltransferase;        ...    51   2e-05
(B0T0X6) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   2e-05
(Q12E37) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   2e-05
(Q0ABY1) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   2e-05
(A3CYW8) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   2e-05
CP001252_4049(CP001252|pid:none) Shewanella baltica OS223, compl...    47   2e-05
CP000359_405(CP000359|pid:none) Deinococcus geothermalis DSM 113...    50   2e-05
(Q48AB7) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   3e-05
(Q5R0Y6) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   3e-05
CP001656_4808(CP001656|pid:none) Paenibacillus sp. JDR-2, comple...    46   3e-05
(Q5P2E3) RecName: Full=Protoheme IX farnesyltransferase;        ...    50   3e-05
CU633749_294(CU633749|pid:none) Cupriavidus taiwanensis str. LMG...    47   4e-05
(A1SY55) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   4e-05
(Q0KER8) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   4e-05
(B2AGR8) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   4e-05
(Q8D6H2) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   4e-05
(B1XS75) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   4e-05
(P08301) RecName: Full=Protoheme IX farnesyltransferase;        ...    50   4e-05
S03804(S03804) hypothetical protein 1 - Paracoccus denitrificans...    50   4e-05
(B0UFS2) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   5e-05
(Q089F2) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    46   5e-05
(Q5HQ51) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   5e-05
AE015929_815(AE015929|pid:none) Staphylococcus epidermidis ATCC ...    42   5e-05
(Q8CPM1) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   5e-05
(Q146A1) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   5e-05
(A4YC13) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    46   5e-05
BA000039_1892(BA000039|pid:none) Thermosynechococcus elongatus B...    44   6e-05
(A1UZV8) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   6e-05
(A3N5D1) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   6e-05
(B7K336) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   7e-05
CP001337_3545(CP001337|pid:none) Chloroflexus aggregans DSM 9485...    46   8e-05
CP000908_3219(CP000908|pid:none) Methylobacterium extorquens PA1...    43   8e-05
(Q21XT4) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   8e-05
(Q67ML5) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   9e-05
(Q2KTX0) RecName: Full=Protoheme IX farnesyltransferase;        ...    49   9e-05
CP001340_3514(CP001340|pid:none) Caulobacter crescentus NA1000, ...    46   1e-04
(Q9A301) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   1e-04
CP001349_254(CP001349|pid:none) Methylobacterium nodulans ORS 20...    44   1e-04
(A1RZ10) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   1e-04
(Q79EF2) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   1e-04
CP000884_4048(CP000884|pid:none) Delftia acidovorans SPH-1, comp...    48   1e-04
(Q18JU9) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   1e-04
(A1WHP5) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   1e-04
(A5GMY0) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   1e-04
(Q2GJ17) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   1e-04
(Q72H22) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   1e-04
(A1KAQ4) RecName: Full=Protoheme IX farnesyltransferase;        ...    48   1e-04
(B1ZKN8) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   2e-04
(B1M595) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   2e-04
CP001276_395(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ...    47   2e-04
(Q7VDD5) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   2e-04
(A0RUY7) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    47   2e-04
CP000667_3040(CP000667|pid:none) Salinispora tropica CNB-440, co...    44   2e-04
CP001298_3435(CP001298|pid:none) Methylobacterium chloromethanic...    43   2e-04
CP001644_242(CP001644|pid:none) Ralstonia pickettii 12D chromoso...    45   2e-04
CP001068_223(CP001068|pid:none) Ralstonia pickettii 12J chromoso...    45   2e-04
(Q2YX83) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   2e-04
(A6T2T7) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   2e-04
(Q7UJF4) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   2e-04
(A1TU04) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   2e-04
CP000878_447(CP000878|pid:none) Prochlorococcus marinus str. MIT...    47   2e-04
(A6VRF6) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   2e-04
CP000352_270(CP000352|pid:none) Ralstonia metallidurans CH34, co...    44   3e-04
(Q1LRS0) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   3e-04
(B4SHI1) RecName: Full=Protoheme IX farnesyltransferase;        ...    43   3e-04
CP000100_2598(CP000100|pid:none) Synechococcus elongatus PCC 794...    45   3e-04
(Q0I891) RecName: Full=Protoheme IX farnesyltransferase;        ...    47   3e-04
CP000777_2542(CP000777|pid:none) Leptospira biflexa serovar Pato...    47   3e-04
AE009442_565(AE009442|pid:none) Xylella fastidiosa Temecula1, co...    42   4e-04
CP000941_654(CP000941|pid:none) Xylella fastidiosa M12, complete...    42   4e-04
(Q2JCG7) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   4e-04
CP001616_2051(CP001616|pid:none) Tolumonas auensis DSM 9187, com...    46   4e-04
CP001503_3011(CP001503|pid:none) Burkholderia glumae BGR1 chromo...    44   5e-04
(B0CKF4) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   6e-04
(A5VP40) RecName: Full=Protoheme IX farnesyltransferase;        ...    46   6e-04
CP000887_434(CP000887|pid:none) Brucella abortus S19 chromosome ...    46   6e-04
CP001344_995(CP001344|pid:none) Cyanothece sp. PCC 7425, complet...    44   6e-04
AL646052_372(AL646052|pid:none) Ralstonia solanacearum GMI1000 c...    43   6e-04
(Q8Y2G4) RecName: Full=Protoheme IX farnesyltransferase;        ...    43   6e-04
CP000781_4607(CP000781|pid:none) Xanthobacter autotrophicus Py2,...    45   7e-04
(A5UPV7) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   7e-04
(A9IQQ6) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   8e-04
AM295250_737(AM295250|pid:none) Staphylococcus carnosus subsp. c...    37   8e-04
(A5EA98) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.001
(Q2IR91) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.001
(Q7V2M7) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   0.001
CR543861_2216(CR543861|pid:none) Acinetobacter sp. ADP1 complete...    45   0.001
(Q6F9R1) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   0.001
(A5GRR8) RecName: Full=Protoheme IX farnesyltransferase;        ...    45   0.001
CP001366_97(CP001366|pid:none) Halorubrum lacusprofundi ATCC 492...    41   0.001
X89566_3(X89566|pid:none) N.winogradskyi DNA for coxA, coxB and ...    41   0.001
(Q1QHV7) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.001
(A1AV76) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.001
(A5CXZ0) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.001
CP000758_582(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188...    44   0.002
(Q46GX1) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.002
(A6WWG0) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.002
(A2C0Q4) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.002
CR940353_235(CR940353|pid:none) Theileria annulata strain Ankara...    44   0.002
(A7NRY4) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.002
BA000002_1232(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple...    38   0.002
(Q9YAR5) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.002
(Q74GM3) RecName: Full=Protoheme IX farnesyltransferase;        ...    36   0.002
(Q0RH20) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.002
CT573213_4471(CT573213|pid:none) Frankia alni str. ACN14A chromo...    44   0.002
(Q13CY5) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.002
(A5CRS6) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.002
(Q31C87) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.003
CP001600_2135(CP001600|pid:none) Edwardsiella ictaluri 93-146, c...    44   0.003
(A7HQW1) RecName: Full=Protoheme IX farnesyltransferase;        ...    44   0.003
(Q3IRC9) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    40   0.003
(Q4FPD2) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.003
(Q87IH5) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    43   0.004
(Q9RM98) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.004
(Q8YYA3) RecName: Full=Protoheme IX farnesyltransferase;        ...    43   0.005
(Q5V5S6) RecName: Full=Protoheme IX farnesyltransferase;        ...    43   0.005
(A2BVA8) RecName: Full=Protoheme IX farnesyltransferase;        ...    43   0.005
(B0REI2) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.005
(A6V8N8) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    42   0.006
CP001063_317(CP001063|pid:none) Shigella boydii CDC 3083-94, com...    42   0.006
CP000243_442(CP000243|pid:none) Escherichia coli UTI89, complete...    42   0.006
CP001164_466(CP001164|pid:none) Escherichia coli O157:H7 str. EC...    42   0.006
(A1A897) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.006
CU928163_457(CU928163|pid:none) Escherichia coli UMN026 chromoso...    42   0.006
(A7ZII5) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.006
(Q3Z4X5) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.006
(Q11KD2) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.006
(B2VHR9) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.008
AM420293_1280(AM420293|pid:none) Saccharopolyspora erythraea NRR...    42   0.008
AE017283_1540(AE017283|pid:none) Propionibacterium acnes KPA1712...    42   0.008
AM942759_104(AM942759|pid:none) Proteus mirabilis strain HI4320,...    42   0.008
(A2BPT0) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.010
(Q7W316) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.010
DQ366731_20(DQ366731|pid:none) Uncultured Prochlorococcus marinu...    42   0.010
(A9MM32) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.010
(A4TPF3) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.010
(A3PBH0) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.010
(A8G3G2) RecName: Full=Protoheme IX farnesyltransferase;        ...    42   0.010
BX572595_202(BX572595|pid:none) Rhodopseudomonas palustris CGA00...    38   0.011
(Q6NBJ5) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.011
(B0R3W4) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.014
(Q6D836) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(Q57SC4) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
CP001127_461(CP001127|pid:none) Salmonella enterica subsp. enter...    41   0.014
AE017220_481(AE017220|pid:none) Salmonella enterica subsp. enter...    41   0.014
(A9MWZ0) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(Q8Z8V5) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(A1JNP6) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(A4W799) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(A7N2M2) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    41   0.014
(Q6G4C6) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(A6T5H1) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
AP006725_1119(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204...    41   0.014
CP001037_5032(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    41   0.014
(Q2GDE4) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
(B1I6G5) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.014
CP000875_3692(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ...    37   0.014
(Q9HRJ8) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.014
(A4SPY8) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.018
CP000462_2864(CP000462|pid:none) Aeromonas hydrophila subsp. hyd...    41   0.018
(A0KME5) RecName: Full=Protoheme IX farnesyltransferase;        ...    41   0.018
AB033827_5(AB033827|pid:none) Shewanella violacea CyoA, CyoB, Cy...    37   0.018
(Q089I2) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    37   0.018
CP001399_1439(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    40   0.023
(A0LTZ0) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.023
CP001197_527(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy...    32   0.030
(Q72B27) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   0.030
BA000023_1648(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,...    40   0.030
(Q970T4) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.030
(A3Q9U4) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    40   0.030
(Q310M2) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.030
CP000561_1922(CP000561|pid:none) Pyrobaculum calidifontis JCM 11...    40   0.030
AE008922_3774(AE008922|pid:none) Xanthomonas campestris pv. camp...    40   0.030
(Q8PFU4) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.030
(Q2NYG1) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.030
CP001654_2842(CP001654|pid:none) Dickeya dadantii Ech703, comple...    40   0.040
(B1MC66) RecName: Full=Protoheme IX farnesyltransferase;        ...    40   0.040
(A4YC85) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    36   0.050
(A4Z2D2) RecName: Full=Protoheme IX farnesyltransferase;        ...    36   0.050
(Q1LTJ4) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.052
CP000285_950(CP000285|pid:none) Chromohalobacter salexigens DSM ...    39   0.052
(A1T8M8) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.052
AM181176_5019(AM181176|pid:none) Pseudomonas fluorescens SBW25 c...    39   0.052
AE005674_369(AE005674|pid:none) Shigella flexneri 2a str. 301, c...    39   0.052
(Q83SF7) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.052
AP008955_2700(AP008955|pid:none) Brevibacillus brevis NBRC 10059...    39   0.052
(Q6AF34) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.052
AP009153_2581(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...    39   0.067
CP001280_1223(CP001280|pid:none) Methylocella silvestris BL2, co...    39   0.067
CP000384_2401(CP000384|pid:none) Mycobacterium sp. MCS, complete...    39   0.067
(Q7NQZ3) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    39   0.067
(A1SJR1) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.088
(A0QWY2) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.088
(Q3K773) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    39   0.088
(B3CN58) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.088
AF321090_5(AF321090|pid:none) Pseudomonas putida cytochrome o ub...    39   0.088
(Q7VT22) RecName: Full=Protoheme IX farnesyltransferase;        ...    39   0.088
(A1RE49) RecName: Full=Protoheme IX farnesyltransferase 1;      ...    35   0.11
(A6WU49) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    35   0.11
(Q0HDH7) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    35   0.11
(Q0HPR0) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    35   0.11
(A9KV13) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    35   0.11
BA000030_6322(BA000030|pid:none) Streptomyces avermitilis MA-468...    38   0.11
CP000479_3205(CP000479|pid:none) Mycobacterium avium 104, comple...    38   0.11
(Q48M92) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.11
(Q829U3) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.11
(A6WC46) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.15
CP000431_7115(CP000431|pid:none) Rhodococcus jostii RHA1, comple...    38   0.15
(Q04PG4) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.15
(Q0S0I5) RecName: Full=Protoheme IX farnesyltransferase;        ...    38   0.15
AP011115_6968(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp...    38   0.15
AP008232_663(AP008232|pid:none) Sodalis glossinidius str. 'morsi...    37   0.20
CP001391_393(CP001391|pid:none) Wolbachia sp. wRi, complete geno...    37   0.20
(Q2NV87) RecName: Full=Protoheme IX farnesyltransferase;        ...    37   0.20
(Q83GF8) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   0.23
AP010872_331(AP010872|pid:none) Candidatus Ishikawaella capsulat...    34   0.30
(Q887G7) RecName: Full=Protoheme IX farnesyltransferase;        ...    37   0.33
CP001620_912(CP001620|pid:none) Corynebacterium kroppenstedtii D...    37   0.33
CP001277_60(CP001277|pid:none) Candidatus Hamiltonella defensa 5...    37   0.33
(Q5FPU4) RecName: Full=Protoheme IX farnesyltransferase;        ...    37   0.33
(Q4ZXC3) RecName: Full=Protoheme IX farnesyltransferase;        ...    37   0.33
CP001389_517(CP001389|pid:none) Rhizobium sp. NGR234, complete g...    35   0.38
(Q6KZG0) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    30   0.39
CP000682_1965(CP000682|pid:none) Metallosphaera sedula DSM 5348,...    36   0.44
(Q9WWR5) RecName: Full=Protoheme IX farnesyltransferase;        ...    36   0.57
CU640366_1425(CU640366|pid:none) Podospora anserina genomic DNA ...    36   0.57
(Q1IEP0) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    36   0.57
AY466718_5(AY466718|pid:none) Pseudomonas putida strain DOT-T1E ...    36   0.57
(B1JDU9) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    36   0.57
(B0KPE4) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    36   0.57
(A5CF31) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   0.64
(B3CTF6) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   0.64
(A4FBP2) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    35   0.75
(Q47ND5) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   0.75
(B1HST2) RecName: Full=Protoheme IX farnesyltransferase 2;      ...    35   0.97
(A0PPP7) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   0.97
CP000817_3494(CP000817|pid:none) Lysinibacillus sphaericus C3-41...    35   0.97
CP000854_2233(CP000854|pid:none) Mycobacterium marinum M, comple...    35   0.97
AC099045_25(AC099045|pid:none) Trypanosoma brucei chromosome 8 c...    35   0.97
(A1RRA6) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   0.97
AP007255_740(AP007255|pid:none) Magnetospirillum magneticum AMB-...    35   0.97
(Q1RI93) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   1.3
(Q72VU2) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   1.3
CP000660_565(CP000660|pid:none) Pyrobaculum arsenaticum DSM 1351...    35   1.3
(A8GVN8) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   1.3
(A0JWQ8) RecName: Full=Protoheme IX farnesyltransferase;        ...    35   1.3
(A1R6I0) RecName: Full=Protoheme IX farnesyltransferase;        ...    34   1.7
CP001628_1075(CP001628|pid:none) Micrococcus luteus NCTC 2665, c...    34   1.7
CP000633_773(CP000633|pid:none) Agrobacterium vitis S4 chromosom...    34   1.7
AF439739_5(AF439739|pid:none) Vitreoscilla sp. C1 cytochrome bo ...    34   1.7
AX065541_1(AX065541|pid:none) Sequence 667 from Patent WO0100844...    34   2.2
(Q613L4) RecName: Full=Histone deacetylase 4;          EC=3.5.1....    34   2.2
(A4QEE9) RecName: Full=Protoheme IX farnesyltransferase;        ...    34   2.2
(Q2A5L1) RecName: Full=Protoheme IX farnesyltransferase;        ...    34   2.2
(Q6MR11) RecName: Full=Protoheme IX farnesyltransferase;        ...    34   2.2
(A0Q4E4) RecName: Full=Protoheme IX farnesyltransferase;        ...    34   2.2
(A1QRH1) RecName: Full=Protoheme IX farnesyltransferase;        ...    34   2.2
(O28243) RecName: Full=Protoheme IX farnesyltransferase;        ...    27   2.3
(Q92RG8) RecName: Full=Protoheme IX farnesyltransferase;        ...    33   2.8
AL591688_908(AL591688|pid:none) Sinorhizobium meliloti 1021 comp...    33   2.8
(B1YB28) RecName: Full=Protoheme IX farnesyltransferase;        ...    33   2.8
AE006641_595(AE006641|pid:none) Sulfolobus solfataricus P2, comp...    33   3.7
(Q4JVK2) RecName: Full=Protoheme IX farnesyltransferase;        ...    33   4.8
(Q2KBM1) RecName: Full=Protoheme IX farnesyltransferase;        ...    33   4.8
(B3PSB2) RecName: Full=Protoheme IX farnesyltransferase;        ...    33   4.8
(Q8D350) RecName: Full=Protoheme IX farnesyltransferase;        ...    33   4.8
AM746676_5872(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    32   6.2
AE015929_1682(AE015929|pid:none) Staphylococcus epidermidis ATCC...    32   6.3
(A8GRQ1) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   6.3
(Q4UM22) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   6.3
CP000683_353(CP000683|pid:none) Rickettsia massiliae MTU5, compl...    32   6.3
(Q1MKI5) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   6.3
CP000113_5247(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    32   6.3
(A8GN36) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   6.3
(Q92IF1) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   6.3
AM181176_4730(AM181176|pid:none) Pseudomonas fluorescens SBW25 c...    32   8.2
(A8EZ97) RecName: Full=Protoheme IX farnesyltransferase;        ...    32   8.2
CP001601_1203(CP001601|pid:none) Corynebacterium aurimucosum ATC...    32   8.2

>T01579(T01579;T02407)heme A farnesyltransferase homolog F16B22.1 -
           Arabidopsis thaliana (fragment)
          Length = 469

 Score = 68.9 bits (167), Expect(2) = 1e-18
 Identities = 34/78 (43%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +1

Query: 130 PPLIGSVAATGEFEAIGMLLATFMYIWQIPHFLALSQVLREQYRGAGYKMLSVTHEK-KT 306
           PPL+G  AA+G+     M+L   +Y WQIPHF+AL+ + R  Y   GYKMLS+     K
Sbjct: 273 PPLLGWAAASGQISYNSMILPAALYFWQIPHFMALAHLCRNDYAAGGYKMLSLFDPSGKR 332

Query: 307 VDRVSLAHALFGIPLPFI 360
           +  V+L +  + IPL FI
Sbjct: 333 IAAVALRNCFYMIPLGFI 350

 Score = 46.2 bits (108), Expect(2) = 1e-18
 Identities = 20/36 (55%), Positives = 29/36 (80%), Gaps = 1/36 (2%)
 Frame = +3

Query: 33  LAACNVILYCW-YTDLKRVTPLNTWIGAFVGAIPAI 137
           LA+ N++LY + YT LK++ P+NTW+GA VGAIP +
Sbjct: 240 LASANLVLYAFVYTPLKQLHPINTWVGAVVGAIPPL 275

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 957,780,849
Number of extensions: 21188421
Number of successful extensions: 49140
Number of sequences better than 10.0: 419
Number of HSP's gapped: 49119
Number of HSP's successfully gapped: 636
Length of query: 165
Length of database: 1,061,185,681
Length adjustment: 119
Effective length of query: 46
Effective length of database: 672,240,369
Effective search space: 30923056974
Effective search space used: 30923056974
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
PSORT 

 psg: 0.90  gvh: 0.64  alm: 0.36  top: 0.30  tms: 0.00  mit: 0.24  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 36.0 %: extracellular, including cell wall
	 20.0 %: cytoplasmic
	 20.0 %: nuclear
	 12.0 %: vacuolar
	  4.0 %: mitochondrial
	  4.0 %: vesicles of secretory system
	  4.0 %: endoplasmic reticulum

>> prediction for Contig-U03504-1 is exc
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 1
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0