Contig-U16604-1 |
Contig ID |
Contig-U16604-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
no gap |
Contig length |
1612 |
Chromosome number (1..6, M) |
3 |
Chromosome length |
6358359 |
Start point |
4663357 |
End point |
4661746 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
25 |
Number of EST |
41 |
Link to clone list |
U16604 |
List of clone(s) |
est1=VFK777F,-1868,-1719 est2=VFH576F,-1864,-1719 est3=VFM893F,-1861,-1719 est4=VFI107F,-1852,-1719 est5=VFM277F,-1852,-1719 est6=VFJ267F,-1851,-1719 est7=VFG403F,-1848,-1719 est8=VFD458F,-1847,-1719 est9=VFA440F,-1846,-1719 est10=VFL228F,-1838,-1686 est11=VFF317F,-1767,-1483 est12=CFG454F,1,134 est13=SLB737F,15,682 est14=SLA560F,25,701 est15=SLJ794F,27,308 est16=VFM884F,177,812 est17=VFA758F,366,968 est18=VFI319E,405,1594 est19=VFF157E,471,1538 est20=VFA440Z,841,1564 est21=VFD458Z,855,1581 est22=VFJ267Z,876,1557 est23=VFH576Z,895,1539 est24=SLB737Z,914,1608 est25=VFF317Z,936,1598 est26=VFL228Z,947,1579 est27=CFG454Z,948,1552 est28=VFI107Z,950,1562 est29=VFK777Z,950,1599 est30=SLG707Z,953,1605 est31=VFM893Z,983,1558 est32=VFG403Z,1019,1591 est33=VFM884Z,1033,1530 est34=SLD247Z,1042,1600 est35=VSC139E,1054,1609 est36=VFM277Z,1136,1555 est37=VFL176Z,1139,1477 est38=VFA758Z,1258,1579 est39=SLK177Z,1328,1602 est40=SLJ794Z,1401,1605 est41=VSG887F,1416,1612
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 4.13 |
Homology vs DNA |
Query= Contig-U16604-1 (Contig-U16604-1Q) /CSM_Contig/Contig-U16604-1Q.Seq.d (1612 letters)
Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ416571) Dictyostelium discoideum cDNA clone:ddv26h22, 5' ... 1261 0.0 1 (AU060198) Dictyostelium discoideum slug cDNA, clone SLA560. 1116 0.0 1 (AU060851) Dictyostelium discoideum slug cDNA, clone SLB737. 1078 0.0 1 (BJ428312) Dictyostelium discoideum cDNA clone:ddv11a15, 3' ... 900 0.0 2 (AU034096) Dictyostelium discoideum slug cDNA, clone SLB737. 860 0.0 2 (BJ434423) Dictyostelium discoideum cDNA clone:ddv16g19, 3' ... 860 0.0 3 (BJ432723) Dictyostelium discoideum cDNA clone:ddv19e18, 3' ... 860 0.0 4 (BJ430516) Dictyostelium discoideum cDNA clone:ddv7d16, 3' e... 860 0.0 4 (BJ428851) Dictyostelium discoideum cDNA clone:ddv1p10, 3' e... 860 0.0 5 (BJ431928) Dictyostelium discoideum cDNA clone:ddv17f05, 3' ... 852 0.0 5 (BJ410166) Dictyostelium discoideum cDNA clone:ddv11a15, 5' ... 848 0.0 3 (BJ428174) Dictyostelium discoideum cDNA clone:ddv11b05, 3' ... 827 0.0 3 (BJ433913) Dictyostelium discoideum cDNA clone:ddv23g08, 3' ... 805 0.0 2 (BJ372678) Dictyostelium discoideum cDNA clone:ddc13l14, 3' ... 803 0.0 3 (AU039903) Dictyostelium discoideum slug cDNA, clone SLG707. 791 0.0 2 (BJ433763) Dictyostelium discoideum cDNA clone:ddv22j19, 3' ... 791 0.0 3 (BJ431958) Dictyostelium discoideum cDNA clone:ddv17m01, 3' ... 791 0.0 3 (BJ435357) Dictyostelium discoideum cDNA clone:ddv26j24, 3' ... 712 0.0 2 (BJ410968) Dictyostelium discoideum cDNA clone:ddv2d15, 5' e... 916 0.0 3 (BJ431160) Dictyostelium discoideum cDNA clone:ddv13f02, 3' ... 662 0.0 3 (BJ413818) Dictyostelium discoideum cDNA clone:ddv17f05, 5' ... 916 0.0 3 (AU052395) Dictyostelium discoideum slug cDNA, clone SLD247. 593 0.0 2 (AU262360) Dictyostelium discoideum vegetative cDNA clone:VS... 577 0.0 2 (BJ435344) Dictyostelium discoideum cDNA clone:ddv26h22, 3' ... 628 0.0 2 (BJ435035) Dictyostelium discoideum cDNA clone:ddv25i20, 3' ... 422 0.0 3 (AF020284) Dictyostelium discoideum AmyA (amyA) gene, partia... 761 0.0 1 (BJ434075) Dictyostelium discoideum cDNA clone:ddv23g19, 3' ... 456 e-146 3 (BJ429152) Dictyostelium discoideum cDNA clone:ddv2d15, 3' e... 331 e-134 4 (AU053926) Dictyostelium discoideum slug cDNA, clone SLK177. 424 e-122 2 (AU060461) Dictyostelium discoideum slug cDNA, clone SLJ794. 337 6e-89 2 (AU053849) Dictyostelium discoideum slug cDNA, clone SLJ794. 327 8e-85 1 (AU266901) Dictyostelium discoideum vegetative cDNA clone:VS... 303 1e-77 1 (BJ416582) Dictyostelium discoideum cDNA clone:ddv26j24, 5' ... 82 8e-11 1 (BJ416339) Dictyostelium discoideum cDNA clone:ddv25i20, 5' ... 82 8e-11 1 (BJ415669) Dictyostelium discoideum cDNA clone:ddv23g08, 5' ... 82 8e-11 1 (BJ415528) Dictyostelium discoideum cDNA clone:ddv22j19, 5' ... 82 8e-11 1 (BJ413849) Dictyostelium discoideum cDNA clone:ddv17m01, 5' ... 82 8e-11 1 (BJ359271) Dictyostelium discoideum cDNA clone:ddc13l14, 5' ... 82 8e-11 1 (BJ412841) Dictyostelium discoideum cDNA clone:ddv13f02, 5' ... 74 2e-08 1 (BJ410044) Dictyostelium discoideum cDNA clone:ddv11b05, 5' ... 74 2e-08 1 (BJ413744) Dictyostelium discoideum cDNA clone:ddv16g19, 5' ... 72 7e-08 1 (BJ412249) Dictyostelium discoideum cDNA clone:ddv7d16, 5' e... 72 7e-08 1 (BJ414547) Dictyostelium discoideum cDNA clone:ddv19e18, 5' ... 70 3e-07 1 (AM052253) Entodinium caudatum EST, clone Entodinium98B. 46 2e-06 2 (S77586) Debaryomyces occidentalis alpha-amylase (AMY) gene,... 56 2e-06 2 (X62079) S. occidentalis alpha amylase gene. 56 2e-06 2 (E29394) Microorganism producing amylase constructed by reco... 56 2e-06 2 (BD000146) Microorganism producing amylase constructed by re... 56 2e-06 2 (A08557) Unknown alpha amylase structural gene. 56 2e-06 2 (A05233) Artificial sequence for alpha-amylase. 56 2e-06 2 (X16040) Schwanniomyces occidentalis amy1 gene for alpha-amy... 56 2e-06 2 (S38381) AMY=alpha-amylase [Schwanniomyces occidentalis, ATC... 56 3e-06 2 (EA374704) Sequence 28 from patent US 7314925. 56 3e-06 2 (EA263562) Sequence 28 from patent US 7238356. 56 3e-06 2 (DJ393706) Constructs and methods for expression of recombin... 56 3e-06 2 (DI132343) Core-glycosylated HCV envelope proteins. 56 3e-06 2 (DD107136) Constructs and methods for expression of recombin... 56 3e-06 2 (DD104542) Core-glycosylated HCV envelope proteins. 56 3e-06 2 (DD088074) Expression of core-glycosylated HCV envelope prot... 56 3e-06 2 (AX717586) Sequence 28 from Patent WO02086101. 56 3e-06 2 (AX591163) Sequence 28 from Patent WO02085932. 56 3e-06 2 (AX591010) Sequence 28 from Patent WO02086100. 56 3e-06 2 (AR880102) Sequence 28 from patent US 7048930. 56 3e-06 2 (X73497) S.occidentalis SWA2 gene for alpha-amylase. 54 5e-06 3 (AB353118) Pichia burtonii pba gene for alpha-amylase, compl... 60 9e-06 3 (AM053788) Eudiplodinium maggii EST, clone Em04_B05. 48 3e-05 2 (BJ410681) Dictyostelium discoideum cDNA clone:ddv1p10, 5' e... 60 3e-04 1 (DJ350432) Amylases, Nucleic Acids Encoding Them and Methods... 58 0.001 1 (CP000903) Bacillus weihenstephanensis KBAB4, complete genome. 54 0.017 1 (EF037835) Synthetic construct Bacillus anthracis clone FLH2... 52 0.068 1 (EA213592) Sequence 77907 from patent US 7214786. 52 0.068 1 (BU672235) WHE3302_B07_C14ZS Chinese Spring wheat drought st... 52 0.068 1 (CP001283) Bacillus cereus AH820, complete genome. 52 0.068 1 (CP001177) Bacillus cereus AH187, complete genome. 52 0.068 1 (CP000485) Bacillus thuringiensis str. Al Hakam, complete ge... 52 0.068 1 (CP000227) Bacillus cereus Q1, complete genome. 52 0.068 1 (AE017334) Bacillus anthracis str. 'Ames Ancestor', complete... 52 0.068 1 (AE017225) Bacillus anthracis str. Sterne, complete genome. 52 0.068 1 (AE017194) Bacillus cereus ATCC 10987, complete genome. 52 0.068 1 (AE016879) Bacillus anthracis str. Ames, complete genome. 52 0.068 1 (ER504215) 1093015415312 Global-Ocean-Sampling_GS-35-01-01-1... 50 0.27 1 (CL869061) abe54d06.x1 Soybean methylation filtered genomic ... 36 0.78 2 (AM052252) Entodinium caudatum EST, clone Entodinium212D. 46 0.95 2 (AC006600) Homo sapiens chromosome 17, clone hRPK.502_F_1, c... 48 1.1 1 (EK227046) 1095460162333 Global-Ocean-Sampling_GS-31-01-01-1... 48 1.1 1 (CX564325) UI-M-IB0-cug-g-14-0-UI.r1 NIH_BMAP_IB0 Mus muscul... 34 1.2 3 (CO060701) est_k_brevis6944 Karenia brevis EST Library (L99-... 38 1.2 2 (BM400915) 5009-0-80-A12.t.1 Chilcoat/Turkewitz cDNA (large ... 34 1.3 3 (CO064341) est_k_brevis3947 Karenia brevis EST Library (L99-... 38 1.5 2 (CT740604) Paramecium tetraurelia 5-PRIME EST from clone LK0... 36 2.8 2 (AY406844) Mus musculus ME1 gene, VIRTUAL TRANSCRIPT, partia... 34 4.0 3 (CT027830) Zebrafish DNA sequence from clone CH211-160K22 in... 46 4.2 1 (AC116361) Homo sapiens chromosome 5 clone RP11-731L3, compl... 46 4.2 1 (AC091941) Homo sapiens chromosome 5 clone RP11-334G8, compl... 46 4.2 1 (AC157102) Bos taurus clone CH240-74P1, WORKING DRAFT SEQUEN... 46 4.2 1 (AC091846) Homo sapiens chromosome 5 clone CTD-2210H19, WORK... 46 4.2 1 (AC026997) Homo sapiens clone RP11-731L3, WORKING DRAFT SEQU... 46 4.2 1 (CR848046) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 46 4.2 1 (AC201555) Strongylocentrotus purpuratus clone R3-3118O4, WO... 46 4.2 1 (AC176190) Strongylocentrotus purpuratus clone R3-3063P22, W... 46 4.2 1 (AC165846) Bos taurus clone CH240-130H14, WORKING DRAFT SEQU... 46 4.2 1 (AC019079) Homo sapiens chromosome 5 clone RP11-334G8, WORKI... 46 4.2 1 (EJ270513) 1095353009381 Global-Ocean-Sampling_GS-27-01-01-1... 46 4.2 1 (EI789953) CHORI518015P06TR BAC library from the breast cell... 46 4.2 1 (DU682670) Bst015206 lambda03 Boechera stricta genomic clone... 46 4.2 1 (BU807964) haa19g12.y2 Fugu UT11 adult fin Takifugu rubripes... 46 4.2 1 (GE317658) OXBA-aaa47h05.g1 Oxytricha_pSMART_OXBA Sterkiella... 46 4.2 1 (AR549737) Sequence 4868 from patent US 6747137. 42 4.6 2 (CZ785654) OC__Ba0148L14.f OC__Ba Oryza coarctata genomic cl... 38 4.8 2 (CZ699734) OC__Ba0014L06.r OC__Ba Oryza coarctata genomic cl... 38 5.0 2 (AY155463) Lipomyces starkeyi alpha-amylase precursor, mRNA,... 34 5.4 3 (DJ436421) PROTEIN WITH ACTIVITY OF HYDROLYZING AMYLOPECTIN,... 34 5.4 3 (DI105396) Protein with the hydrolysis of amylopectin, starc... 34 5.4 3 (DL173505) Methods for Identifying the Target of a Compound ... 42 5.5 2 (AX489065) Sequence 6365 from Patent WO02053728. 42 5.5 2 (CZ722502) OC__Ba0048G01.f OC__Ba Oryza coarctata genomic cl... 38 5.5 2
>(BJ416571) Dictyostelium discoideum cDNA clone:ddv26h22, 5' end, single read. Length = 636
Score = 1261 bits (636), Expect = 0.0 Identities = 636/636 (100%) Strand = Plus / Plus
Query: 177 aatttttgctttaattgctattgttagtgtaacattagcagcaacaccagatcaatgggg 236 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1 aatttttgctttaattgctattgttagtgtaacattagcagcaacaccagatcaatgggg 60
Query: 237 ttcaagaactatttatcaacttttaaccgatagattcagtcaaactgtcaatagttctca 296 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 61 ttcaagaactatttatcaacttttaaccgatagattcagtcaaactgtcaatagttctca 120
Query: 297 accatgcggtaatcttcaaggctattgtggtggtacattccaaggtgtcgaagctcattt 356 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 121 accatgcggtaatcttcaaggctattgtggtggtacattccaaggtgtcgaagctcattt 180
Query: 357 agattatatccaaggtatgggttttgatgcaatttggatttcaccagttgttacaaatac 416 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 181 agattatatccaaggtatgggttttgatgcaatttggatttcaccagttgttacaaatac 240
Query: 417 accaggtggttatcatggttattggcaacaagatatttatacagtaaatgaatatttcgg 476 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 241 accaggtggttatcatggttattggcaacaagatatttatacagtaaatgaatatttcgg 300
Query: 477 aacagaaaatgatttattaaatatgattaaagcatgtcatgaaagaggtatttgggttat 536 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 301 aacagaaaatgatttattaaatatgattaaagcatgtcatgaaagaggtatttgggttat 360
Query: 537 gttagatgttgttgcaaatcatgttggtccagttaattatgattattcaaccattgttcc 596 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 361 gttagatgttgttgcaaatcatgttggtccagttaattatgattattcaaccattgttcc 420
Query: 597 atttgattcagttgaacattatcacaattgtactacatgtccacaatattgtaccattga 656 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 421 atttgattcagttgaacattatcacaattgtactacatgtccacaatattgtaccattga 480
Query: 657 tgatttcaccaattatccacaagttgaagaatgtcgtttatcaggtttaccagatttaga 716 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 481 tgatttcaccaattatccacaagttgaagaatgtcgtttatcaggtttaccagatttaga 540
Query: 717 tcaagataaccaattcgttagaacaacactccaagcatggattaaaaatatgacagaatt 776 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 541 tcaagataaccaattcgttagaacaacactccaagcatggattaaaaatatgacagaatt 600
Query: 777 ctatggtttcgatggtattcgtatcgatacagtacc 812 |||||||||||||||||||||||||||||||||||| Sbjct: 601 ctatggtttcgatggtattcgtatcgatacagtacc 636
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 102105510 Number of Hits to DB: 1,637,505,974 Number of extensions: 99820548 Number of successful extensions: 8201653 Number of sequences better than 10.0: 116 Length of query: 1612 Length of database: 101,790,757,118 Length adjustment: 24 Effective length of query: 1588 Effective length of database: 99,340,224,878 Effective search space: 157752277106264 Effective search space used: 157752277106264 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 8. 2 |
Homology vs Protein |
Query= Contig-U16604-1 (Contig-U16604-1Q) /CSM_Contig/Contig-U16604-1Q.Seq.d (1612 letters)
Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
CQ830101_1(CQ830101|pid:none) Sequence 3 from Patent WO2004055178. 356 2e-96 DQ143884_1(DQ143884|pid:none) Gibberella moniliformis alpha-amyl... 332 3e-89 AM920427_643(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 329 2e-88 AF208225_3(AF208225|pid:none) Emericella nidulans amylase cluste... 328 3e-88 M33218_1(M33218|pid:none) A.oryzae Taka-amylase A (Taa-G1) gene,... 308 3e-82 JN0588(JN0588)alpha-amylase (EC 3.2.1.1) precursor - Aspergillus... 308 3e-82 (P0C1B3) RecName: Full=Alpha-amylase A type-1/2; EC=3.2... 308 5e-82 CS627085_1(CS627085|pid:none) Sequence 35 from Patent WO20050033... 308 5e-82 AB109452_1(AB109452|pid:none) Aspergillus kawachii amyA gene for... 308 5e-82 FB722564_1(FB722564|pid:none) Sequence 11 from Patent WO20071478... 307 8e-82 AB083159_1(AB083159|pid:none) Aspergillus awamori amyl I mRNA fo... 307 8e-82 (Q02906) RecName: Full=Alpha-amylase B; EC=3.2.1.1; Alt... 306 1e-81 (Q02905) RecName: Full=Alpha-amylase A; EC=3.2.1.1; Alt... 306 1e-81 FB722560_1(FB722560|pid:none) Sequence 7 from Patent WO2007147835. 305 2e-81 FB722554_1(FB722554|pid:none) Sequence 1 from Patent WO2007147835. 303 9e-81 NRL(6TAA) alpha-amylase (EC 3.2.1.1) Taka A - Aspergillus oryzae 303 9e-81 GN046004_1(GN046004|pid:none) Sequence 35 from Patent WO20071496... 303 9e-81 GN046000_1(GN046000|pid:none) Sequence 31 from Patent WO20071496... 303 9e-81 DQ526426_2(DQ526426|pid:none) Ophiostoma floccosum alpha amylase... 300 8e-80 DQ526426_1(DQ526426|pid:none) Ophiostoma floccosum alpha amylase... 300 8e-80 A48521_1(A48521|pid:none) Sequence 1 from Patent WO9601323. 299 2e-79 AM920437_1234(AM920437|pid:none) Penicillium chrysogenum Wiscons... 299 2e-79 JK0201(JK0201) alpha-amylase (EC 3.2.1.1) - Aspergillus oryzae ... 296 1e-78 CS627057_1(CS627057|pid:none) Sequence 7 from Patent WO200500331... 293 9e-78 AM270232_3(AM270232|pid:none) Aspergillus niger contig An11c0150... 293 9e-78 CS627083_1(CS627083|pid:none) Sequence 33 from Patent WO20050033... 293 9e-78 GN045998_1(GN045998|pid:none) Sequence 29 from Patent WO20071496... 291 5e-77 U30376_1(U30376|pid:none) Lipomyces kononenkoae subsp. spencerma... 291 6e-77 A35282(A35282)alpha-amylase (EC 3.2.1.1) - Aspergillus niger 290 8e-77 (P56271) RecName: Full=Acid alpha-amylase; EC=3.2.1.1; ... 286 1e-75 NRL(2AAA) alpha-amylase (EC 3.2.1.1) - Aspergillus niger 286 1e-75 (Q08806) RecName: Full=Alpha-amylase 2; EC=3.2.1.1; Alt... 283 2e-74 (P21567) RecName: Full=Alpha-amylase; EC=3.2.1.1; Flags... 280 1e-73 FJ773284_1(FJ773284|pid:none) Sclerotinia sclerotiorum alpha-amy... 279 2e-73 DQ663472_1(DQ663472|pid:none) Fusicoccum sp. BCC4124 alpha-amyla... 276 2e-72 AM270197_11(AM270197|pid:none) Aspergillus niger contig An09c008... 276 2e-72 EU014874_1(EU014874|pid:none) Cryptococcus flavus alpha-amylase ... 275 3e-72 AP007155_1300(AP007155|pid:none) Aspergillus oryzae RIB40 genomi... 274 6e-72 CU633901_403(CU633901|pid:none) Podospora anserina genomic DNA c... 268 7e-71 S38381_1(S38381|pid:none) AMY=alpha-amylase [Schwanniomyces occi... 268 3e-70 (Q09840) RecName: Full=Alpha-amylase 2; EC=3.2.1.1; Alt... 265 3e-69 AF443872_1(AF443872|pid:none) Lipomyces kononenkoae alpha-amylas... 265 4e-69 HB443650_1(HB443650|pid:none) Sequence 373 from Patent WO2009077... 255 3e-66 A05233_1(A05233|pid:none) Artificial sequence for alpha-amylase.... 253 1e-65 (O74922) RecName: Full=Alpha-amylase 1; EC=3.2.1.1; Alt... 253 1e-65 (O14154) RecName: Full=Alpha-amylase mde5; EC=3.2.1.1; ... 252 2e-65 AE017341_116(AE017341|pid:none) Cryptococcus neoformans var. neo... 250 1e-64 CU633457_45(CU633457|pid:none) Podospora anserina genomic DNA ch... 247 8e-64 (O13996) RecName: Full=Uncharacterized glycosyl hydrolase C27E2.... 241 3e-62 AM920431_614(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 238 4e-61 DQ384334_1(DQ384334|pid:none) Physarum polycephalum alpha amylas... 233 2e-59 AM270264_27(AM270264|pid:none) Aspergillus niger contig An12c007... 223 1e-56 CP000557_609(CP000557|pid:none) Geobacillus thermodenitrificans ... 216 1e-54 DQ384276_1(DQ384276|pid:none) Mastigamoeba balamuthi alpha amyla... 213 2e-53 AE017348_23(AE017348|pid:none) Cryptococcus neoformans var. neof... 211 6e-53 AJ871341_1(AJ871341|pid:none) Nyctotherus ovalis partial gene fo... 209 2e-52 CP001634_455(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 170 2e-40 CP001472_2396(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 160 2e-37 (P26827) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 160 2e-37 CP000879_1382(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 159 2e-37 AE008691_1706(AE008691|pid:none) Thermoanaerobacter tengcongensi... 159 3e-37 CP000923_1150(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 157 1e-36 ALBSXF(S26588;S26590;S31284;S31283;S31282)cyclomaltodextrin gluc... 157 1e-36 CP000934_3178(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 156 2e-36 (P27036) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 155 5e-36 (P30921) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 155 5e-36 CP000359_1732(CP000359|pid:none) Deinococcus geothermalis DSM 11... 154 9e-36 (P09121) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 154 1e-35 NRL(1CGW) Cyclomaltodextrin glucanotransferase (cgtase) (EC 2.4.... 154 1e-35 AJ876899_1(AJ876899|pid:none) Haloferax mediterranei amy gene fo... 153 2e-35 CP000771_1645(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 153 2e-35 NRL(1CGX) Cyclomaltodextrin glucanotransferase (cgtase) (EC 2.4.... 153 2e-35 NRL(1CGV) Cyclomaltodextrin glucanotransferase (EC 2.4.1.19) (cg... 153 2e-35 AB248273_1(AB248273|pid:none) Bacillus circulans igtY, igtZ gene... 153 2e-35 AY770575_1(AY770575|pid:none) Bacillus sp. TS1-1 cyclodextrin gl... 153 2e-35 NRL(1CDG) cyclomaltodextrin glucanotransferase (EC 2.4.1.19) - B... 153 2e-35 NRL(1CGY) Cyclomaltodextrin glucanotransferase (cgtase) (EC 2.4.... 152 3e-35 Y18523_23(Y18523|pid:none) Actinoplanes sp. SE50/110 complete ac... 152 3e-35 (P05618) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 152 4e-35 (P31746) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 151 6e-35 CP000702_942(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 151 6e-35 AI1827(AI1827) cyclomaltodextrin glucanotransferase [imported] -... 151 6e-35 DQ243816_1(DQ243816|pid:none) Paenibacillus sp. BL11 amylase X (... 151 6e-35 CP000961_3383(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 151 8e-35 AF302787_3(AF302787|pid:none) Bacillus circulans putative ferric... 151 8e-35 AY478421_1(AY478421|pid:none) Bacillus sp. I-5 CGTase (cgt) gene... 151 8e-35 D13068_1(D13068|pid:none) Bacillus sp. KC201 gene for cyclodextr... 150 1e-34 CP001114_832(CP001114|pid:none) Deinococcus deserti VCD115, comp... 150 1e-34 A18991_1(A18991|pid:none) Bacillus 290-3 (DSM 5850) gene for gam... 150 1e-34 PDBN(1CXK)A MOL_ID: 1;MOL_ID: 1; MOLECULE: CYCLODEXTRIN-GLYCOSYL... 150 1e-34 AP007166_225(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 150 1e-34 AX700817_1(AX700817|pid:none) Sequence 1 from Patent EP1284293. 149 3e-34 AB082929_1(AB082929|pid:none) Bacillus clarkii cgt gene for cycl... 149 3e-34 AB432985_1(AB432985|pid:none) Bacillus clarkii cgt, cda genes fo... 149 3e-34 AF047363_1(AF047363|pid:none) Paenibacillus macerans alpha-cyclo... 148 5e-34 AX453023_1(AX453023|pid:none) Sequence 1 from Patent WO0244350. 148 5e-34 (P04830) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 148 6e-34 EU572721_1(EU572721|pid:none) Paenibacillus sp. JB-13 cyclodextr... 148 6e-34 AX356717_1(AX356717|pid:none) Sequence 1 from Patent WO0206508. 147 8e-34 AY251462_1(AY251462|pid:none) Bacillus agaradhaerens LS-3C cyclo... 147 8e-34 AL939111_262(AL939111|pid:none) Streptomyces coelicolor A3(2) co... 147 1e-33 (P17692) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 146 2e-33 (P31747) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 146 2e-33 CP000252_2102(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 146 2e-33 AM933612_1(AM933612|pid:none) Paenibacillus sp. C36 cgt gene for... 146 2e-33 (P30920) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 146 2e-33 NRL(1CGT) cyclomaltodextrin glucanotransferase (EC 2.4.1.19) - B... 146 2e-33 AF497477_1(AF497477|pid:none) Nostoc sp. PCC 9229 cyclomaltodext... 145 3e-33 AM748796_1(AM748796|pid:none) Paenibacillus pabuli cgtase gene f... 145 4e-33 (O30565) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 145 5e-33 (P14014) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 144 7e-33 AE004092_1004(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 144 1e-32 DQ192528_1(DQ192528|pid:none) Pyrococcus furiosus DSM 3638 cyclo... 142 3e-32 BA000030_5989(BA000030|pid:none) Streptomyces avermitilis MA-468... 142 4e-32 CP001037_13(CP001037|pid:none) Nostoc punctiforme PCC 73102, com... 142 5e-32 CP000388_1368(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 141 8e-32 CP000725_1310(CP000725|pid:none) Streptococcus gordonii str. Cha... 139 2e-31 CP000360_1499(CP000360|pid:none) Acidobacteria bacterium Ellin34... 139 2e-31 (P19531) RecName: Full=Maltogenic alpha-amylase; EC=3.2... 139 4e-31 CP000855_1458(CP000855|pid:none) Thermococcus onnurineus NA1, co... 138 5e-31 CP001114_961(CP001114|pid:none) Deinococcus deserti VCD115, comp... 137 1e-30 CP000113_5238(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 137 1e-30 FM204883_1373(FM204883|pid:none) Streptococcus equi subsp. equi ... 136 2e-30 AE009950_478(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 136 3e-30 AM055811_1(AM055811|pid:none) Roseburia sp. A2-194 amyB gene for... 135 3e-30 CP001107_1032(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 135 6e-30 AB072372_1(AB072372|pid:none) Thermococcus kodakaraensis Tk-cgt ... 134 1e-29 CP000387_1381(CP000387|pid:none) Streptococcus sanguinis SK36, c... 134 1e-29 CP000447_809(CP000447|pid:none) Shewanella frigidimarina NCIMB 4... 134 1e-29 AP009493_5281(AP009493|pid:none) Streptomyces griseus subsp. gri... 133 2e-29 BA000045_373(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 133 2e-29 CP000474_212(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 132 3e-29 CP000359_656(CP000359|pid:none) Deinococcus geothermalis DSM 113... 131 8e-29 CP000159_2350(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 131 8e-29 CP000517_1538(CP000517|pid:none) Lactobacillus helveticus DPC 45... 130 1e-28 AE008923_2553(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 130 1e-28 CP000140_3446(CP000140|pid:none) Parabacteroides distasonis ATCC... 130 1e-28 CP000568_788(CP000568|pid:none) Clostridium thermocellum ATCC 27... 130 1e-28 AY766185_18(AY766185|pid:none) Uncultured murine large bowel bac... 130 2e-28 CP000050_1620(CP000050|pid:none) Xanthomonas campestris pv. camp... 129 2e-28 AM920689_1724(AM920689|pid:none) Xanthomonas campestris pv. camp... 129 2e-28 AE008922_2422(AE008922|pid:none) Xanthomonas campestris pv. camp... 129 2e-28 CP001139_2074(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 128 5e-28 EU644086_1(EU644086|pid:none) Bacillus circulans strain DF 9R cy... 128 7e-28 CP000919_932(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 128 7e-28 CP000020_2078(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 128 7e-28 CP000140_2665(CP000140|pid:none) Parabacteroides distasonis ATCC... 127 9e-28 CP001131_4229(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 127 2e-27 CP000557_605(CP000557|pid:none) Geobacillus thermodenitrificans ... 127 2e-27 HB443632_1(HB443632|pid:none) Sequence 355 from Patent WO2009077... 126 2e-27 AP006841_3290(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 126 2e-27 CR626927_3048(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 126 2e-27 CP001615_1713(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 126 3e-27 BA000028_2561(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 126 3e-27 CP000936_1158(CP000936|pid:none) Streptococcus pneumoniae Hungar... 126 3e-27 EU305539_1(EU305539|pid:none) Paenibacillus graminis strain MC22... 125 3e-27 AF1340(AF1340) maltogenic amylase homolog lmo2126 [imported] - L... 125 4e-27 CP001638_644(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 125 6e-27 AE007317_948(AE007317|pid:none) Streptococcus pneumoniae R6, com... 124 8e-27 M36539_1(M36539|pid:none) B.stearothermophilus maltogenic alpha-... 124 8e-27 CP000509_192(CP000509|pid:none) Nocardioides sp. JS614, complete... 124 1e-26 CP000407_2057(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 124 1e-26 M12777_1(M12777|pid:none) B.mecerans cyclodextrin glucanotransfe... 124 1e-26 A60999(A60999) alpha-amylase (EC 3.2.1.1) precursor - Micrococcu... 123 2e-26 AL049662_1(AL049662|pid:none) S.pombe chromosome III cosmid c188. 123 2e-26 AD1711(AD1711) maltogenic amylase homolog lin2231 [imported] - L... 123 2e-26 AE000513_1446(AE000513|pid:none) Deinococcus radiodurans R1 chro... 123 2e-26 CP000233_1279(CP000233|pid:none) Lactobacillus salivarius UCC118... 123 2e-26 GN095968_1(GN095968|pid:none) Sequence 749 from Patent WO2009037... 122 3e-26 CP000113_3595(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 122 3e-26 CP001359_4247(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 122 4e-26 AP007281_1507(AP007281|pid:none) Lactobacillus reuteri JCM 1112 ... 122 4e-26 FJ788421_1(FJ788421|pid:none) Geobacillus caldoxylosilyticus str... 121 8e-26 AM409314_27(AM409314|pid:none) Streptomyces glaucescens ORF1 (pa... 120 1e-25 AY064726_1(AY064726|pid:none) Thermus sp. YBJ-1 alpha-cyclodextr... 120 1e-25 CP000934_3194(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 120 1e-25 AE017198_214(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 120 1e-25 EU427451_1(EU427451|pid:none) Uncultured bacterium clone Amy132 ... 120 2e-25 AB015670_14(AB015670|pid:none) Bacillus sp. genes for CDase, CGT... 120 2e-25 CP001341_476(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 119 2e-25 U50744_1(U50744|pid:none) Bacillus stearothermophilus maltogenic... 119 3e-25 BA000043_703(BA000043|pid:none) Geobacillus kaustophilus HTA426 ... 119 3e-25 AM406671_735(AM406671|pid:none) Lactococcus lactis subsp. cremor... 119 3e-25 CP001283_3943(CP001283|pid:none) Bacillus cereus AH820, complete... 119 4e-25 BA000004_2927(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 118 5e-25 AE017194_4031(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 118 5e-25 AE016830_1253(AE016830|pid:none) Enterococcus faecalis V583, com... 118 5e-25 CP001056_1950(CP001056|pid:none) Clostridium botulinum B str. Ek... 118 7e-25 CP000227_3702(CP000227|pid:none) Bacillus cereus Q1, complete ge... 118 7e-25 AB054314_1(AB054314|pid:none) Schizosaccharomyces pombe mRNA for... 117 9e-25 AM409179_1(AM409179|pid:none) Bacillus sp. US149 ma gene for mal... 117 9e-25 AP010935_1246(AP010935|pid:none) Streptococcus dysgalactiae subs... 117 2e-24 CP000413_207(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 117 2e-24 BA000032_1616(BA000032|pid:none) Vibrio parahaemolyticus RIMD 22... 117 2e-24 CP001176_3962(CP001176|pid:none) Bacillus cereus B4264, complete... 117 2e-24 CU928160_1885(CU928160|pid:none) Escherichia coli IAI1 chromosom... 117 2e-24 AE017355_3714(AE017355|pid:none) Bacillus thuringiensis serovar ... 117 2e-24 CP000140_2662(CP000140|pid:none) Parabacteroides distasonis ATCC... 116 2e-24 CP001098_1602(CP001098|pid:none) Halothermothrix orenii H 168, c... 116 2e-24 AY937388_1(AY937388|pid:none) Anoxybacillus flavithermus cycloma... 116 3e-24 AE004092_1005(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 115 5e-24 FM204883_1374(FM204883|pid:none) Streptococcus equi subsp. equi ... 115 6e-24 CP001022_1657(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 114 1e-23 CP000383_942(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 114 1e-23 AM743169_1117(AM743169|pid:none) Stenotrophomonas maltophilia K2... 114 1e-23 FM954972_2458(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 114 1e-23 CP001656_1044(CP001656|pid:none) Paenibacillus sp. JDR-2, comple... 113 2e-23 AL009126_3575(AL009126|pid:none) Bacillus subtilis subsp. subtil... 113 2e-23 D13255_1(D13255|pid:none) Bacillus sp. KSM-1876 gene for neopull... 113 2e-23 CP001129_1216(CP001129|pid:none) Streptococcus equi subsp. zooep... 112 3e-23 (P14898) RecName: Full=Alpha-amylase 2; EC=3.2.1.1; Alt... 112 5e-23 HB443682_1(HB443682|pid:none) Sequence 405 from Patent WO2009077... 112 5e-23 AE017333_605(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 111 7e-23 CP000083_952(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 111 7e-23 CP000002_604(CP000002|pid:none) Bacillus licheniformis ATCC 1458... 111 7e-23 CP001103_1874(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 111 9e-23 CP001398_600(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 111 9e-23 CP000685_1392(CP000685|pid:none) Flavobacterium johnsoniae UW101... 110 2e-22 CP000246_1058(CP000246|pid:none) Clostridium perfringens ATCC 13... 110 2e-22 AY937387_1(AY937387|pid:none) Laceyella sacchari cyclomaltodextr... 110 2e-22 AX429161_1(AX429161|pid:none) Sequence 29 from Patent WO0234773.... 110 2e-22 BA000016_805(BA000016|pid:none) Clostridium perfringens str. 13 ... 108 4e-22 CP001037_5559(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 108 6e-22 CP000117_2013(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 108 7e-22 CP001107_1137(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 108 7e-22 A42950(A42950) cyclomaltodextrinase (EC 3.2.1.54) - Thermoanaero... 107 1e-21 (P08704) RecName: Full=Cyclomaltodextrin glucanotransferase; ... 107 1e-21 (P29964) RecName: Full=Cyclomaltodextrinase; Short=CDas... 107 1e-21 CP001344_332(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 107 1e-21 AF2386(AF2386) neopullulanase [imported] - Nostoc sp. (strain PC... 107 2e-21 BA000028_1185(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 107 2e-21 CP000312_921(CP000312|pid:none) Clostridium perfringens SM101, c... 107 2e-21 CP001656_773(CP001656|pid:none) Paenibacillus sp. JDR-2, complet... 106 3e-21 CP000575_606(CP000575|pid:none) Staphylothermus marinus F1, comp... 105 4e-21 BX569694_136(BX569694|pid:none) Synechococcus sp. WH8102 complet... 105 6e-21 CP001291_3074(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 105 6e-21 AP006878_1771(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 104 1e-20 BX548175_216(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 104 1e-20 (O42918) RecName: Full=Alpha-amylase 4; EC=3.2.1.1; Alt... 103 2e-20 CP000856_12(CP000856|pid:none) Deinococcus geothermalis DSM 1130... 103 2e-20 AB034969_1(AB034969|pid:none) Thermococcus sp. B1001 cgtB, cgtA,... 102 3e-20 CP000435_551(CP000435|pid:none) Synechococcus sp. CC9311, comple... 102 3e-20 CP001607_848(CP001607|pid:none) Aggregatibacter aphrophilus NJ87... 102 4e-20 CP000961_2188(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 102 5e-20 CP000110_493(CP000110|pid:none) Synechococcus sp. CC9605, comple... 101 7e-20 CP000934_1367(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 101 7e-20 CP000896_424(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 101 9e-20 CP000679_382(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 100 1e-19 CP000554_2148(CP000554|pid:none) Prochlorococcus marinus str. MI... 100 1e-19 CP000679_400(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 100 1e-19 AM406671_1830(AM406671|pid:none) Lactococcus lactis subsp. cremo... 100 2e-19 D38228_1(D38228|pid:none) Xanthomonas campestris gene for peripl... 100 2e-19 GN095988_1(GN095988|pid:none) Sequence 769 from Patent WO2009037... 99 3e-19 AM746676_7793(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 99 3e-19 CP000444_2193(CP000444|pid:none) Shewanella sp. MR-7, complete g... 99 3e-19 CP000097_1817(CP000097|pid:none) Synechococcus sp. CC9902, compl... 99 4e-19 BA000045_3646(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 99 4e-19 CP000393_3850(CP000393|pid:none) Trichodesmium erythraeum IMS101... 99 4e-19 EU427450_1(EU427450|pid:none) Uncultured bacterium clone Amy29 n... 99 4e-19 CP000804_1947(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 99 6e-19 CP001333_185(CP001333|pid:none) Micromonas sp. RCC299 chromosome... 99 6e-19 DQ985807_1(DQ985807|pid:none) Petrotoga sp. 64g3 amylase gene, c... 99 6e-19 FM954972_2450(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 98 8e-19 GM712409_1(GM712409|pid:none) Sequence 1 from Patent WO2008092919. 98 8e-19 CP001097_805(CP001097|pid:none) Chlorobium limicola DSM 245, com... 98 8e-19 CP001110_1754(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 98 8e-19 CP000449_2729(CP000449|pid:none) Maricaulis maris MCS10, complet... 98 8e-19 CP000446_2126(CP000446|pid:none) Shewanella sp. MR-4, complete g... 98 1e-18 CP000686_1659(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 98 1e-18 CP000159_2677(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 97 1e-18 CP000879_1385(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 97 1e-18 AP009552_5464(AP009552|pid:none) Microcystis aeruginosa NIES-843... 97 1e-18 AE000513_1121(AE000513|pid:none) Deinococcus radiodurans R1 chro... 97 1e-18 AP006878_978(AP006878|pid:none) Thermococcus kodakarensis KOD1 D... 97 1e-18 AM295054_1(AM295054|pid:none) Bacillus halodurans CGT gene for c... 97 2e-18 CP000969_971(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 97 2e-18 CP000469_2297(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 96 3e-18 Y11359_2(Y11359|pid:none) T.maritima amyA and malE genes. 96 3e-18 AM180355_905(AM180355|pid:none) Clostridium difficile 630 comple... 96 4e-18 CT971583_548(CT971583|pid:none) Synechococcus WH7803 complete ge... 96 4e-18 CP000934_720(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 96 5e-18 CP000686_3633(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 96 5e-18 BA000016_66(BA000016|pid:none) Clostridium perfringens str. 13 D... 95 6e-18 AL445063_136(AL445063|pid:none) Thermoplasma acidophilum complet... 95 8e-18 CP000312_72(CP000312|pid:none) Clostridium perfringens SM101, co... 95 8e-18 AB008764_1(AB008764|pid:none) Bacillus flavocaldarius gene for p... 95 8e-18 CP000033_651(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 94 1e-17 CP000423_1924(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 94 1e-17 CP001078_3069(CP001078|pid:none) Clostridium botulinum E3 str. A... 94 2e-17 CP000232_1815(CP000232|pid:none) Moorella thermoacetica ATCC 390... 93 3e-17 CP000680_3111(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 93 3e-17 AE001437_2646(AE001437|pid:none) Clostridium acetobutylicum ATCC... 92 4e-17 CP000698_1718(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 92 4e-17 CP000606_1880(CP000606|pid:none) Shewanella loihica PV-4, comple... 92 5e-17 CP000644_2900(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 92 7e-17 CP000896_639(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 91 9e-17 CR378668_187(CR378668|pid:none) Photobacterium profundum SS9; se... 91 1e-16 CP000302_2017(CP000302|pid:none) Shewanella denitrificans OS217,... 91 1e-16 AL935252_23(AL935252|pid:none) Lactobacillus plantarum strain WC... 91 2e-16 CP000916_781(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 90 2e-16 CP001140_270(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 90 3e-16 CP000916_294(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 89 6e-16 (O86956) RecName: Full=4-alpha-glucanotransferase; EC=2... 88 8e-16 CP000462_1174(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 88 8e-16 CP000492_922(CP000492|pid:none) Chlorobium phaeobacteroides DSM ... 88 8e-16 AP009049_3083(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 88 1e-15 AJ890146_1(AJ890146|pid:none) Haloarcula hispanica amyH gene for... 87 2e-15 Y18523_22(Y18523|pid:none) Actinoplanes sp. SE50/110 complete ac... 87 2e-15 BA000045_1595(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 86 3e-15 AM746676_6860(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 86 3e-15 AY596297_2084(AY596297|pid:none) Haloarcula marismortui ATCC 430... 86 3e-15 AE005176_1679(AE005176|pid:none) Lactococcus lactis subsp. lacti... 86 4e-15 CP001108_98(CP001108|pid:none) Prosthecochloris aestuarii DSM 27... 86 4e-15 AB026834_1(AB026834|pid:none) Klebsiella pneumoniae gene for mal... 86 5e-15 CP000964_169(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 86 5e-15 AX665562_1(AX665562|pid:none) Sequence 5 from Patent WO03002711. 85 7e-15 AP008934_2281(AP008934|pid:none) Staphylococcus saprophyticus su... 85 9e-15 AE000512_1804(AE000512|pid:none) Thermotoga maritima MSB8, compl... 85 9e-15 AE017180_2621(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 85 9e-15 CP001015_961(CP001015|pid:none) Streptococcus pneumoniae G54, co... 84 1e-14 CP000746_317(CP000746|pid:none) Actinobacillus succinogenes 130Z... 84 1e-14 CP000667_2645(CP000667|pid:none) Salinispora tropica CNB-440, co... 83 3e-14 CP000721_4822(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 82 4e-14 CP000157_634(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 82 4e-14 CP000425_1699(CP000425|pid:none) Lactococcus lactis subsp. cremo... 82 4e-14 AM406671_738(AM406671|pid:none) Lactococcus lactis subsp. cremor... 82 4e-14 CP000927_4076(CP000927|pid:none) Caulobacter sp. K31, complete g... 82 4e-14 CP000969_1161(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 82 6e-14 CP001340_2367(CP001340|pid:none) Caulobacter crescentus NA1000, ... 82 7e-14 CP000304_3407(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 82 7e-14 AE005673_2269(AE005673|pid:none) Caulobacter crescentus CB15, co... 82 7e-14 CP000702_958(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 82 7e-14 AE000512_1623(AE000512|pid:none) Thermotoga maritima MSB8, compl... 82 7e-14 AL935252_147(AL935252|pid:none) Lactobacillus plantarum strain W... 81 1e-13 CP000875_2423(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 81 1e-13 BA000030_5988(BA000030|pid:none) Streptomyces avermitilis MA-468... 81 1e-13 CP001098_239(CP001098|pid:none) Halothermothrix orenii H 168, co... 81 1e-13 CP001176_1089(CP001176|pid:none) Bacillus cereus B4264, complete... 81 1e-13 AE006468_3559(AE006468|pid:none) Salmonella enterica subsp. ente... 81 1e-13 CP000903_1040(CP000903|pid:none) Bacillus weihenstephanensis KBA... 81 1e-13 AP009044_1017(AP009044|pid:none) Corynebacterium glutamicum R DN... 81 1e-13 AE014613_3590(AE014613|pid:none) Salmonella enterica subsp. ente... 80 2e-13 CP000026_3281(CP000026|pid:none) Salmonella enterica subsp. ente... 80 2e-13 CP001113_3684(CP001113|pid:none) Salmonella enterica subsp. ente... 80 2e-13 AX065369_1(AX065369|pid:none) Sequence 495 from Patent WO0100844... 80 2e-13 BA000036_889(BA000036|pid:none) Corynebacterium glutamicum ATCC ... 80 2e-13 CP001138_3614(CP001138|pid:none) Salmonella enterica subsp. ente... 80 2e-13 CP001120_3724(CP001120|pid:none) Salmonella enterica subsp. ente... 80 2e-13 CP001327_396(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 80 2e-13 CP001364_744(CP001364|pid:none) Chloroflexus sp. Y-400-fl, compl... 80 2e-13 AM286415_3028(AM286415|pid:none) Yersinia enterocolitica subsp. ... 80 3e-13 AE016877_1034(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 80 3e-13 (O97396) RecName: Full=Alpha-amylase; EC=3.2.1.1; AltNa... 80 3e-13 AY736489_1(AY736489|pid:none) Drosophila parabipectinata Amyrel ... 80 3e-13 CP001144_3669(CP001144|pid:none) Salmonella enterica subsp. ente... 79 4e-13 AY736485_1(AY736485|pid:none) Drosophila ochrogaster Amyrel (Amy... 79 4e-13 FM178380_578(FM178380|pid:none) Aliivibrio salmonicida LFI1238 c... 79 4e-13 AE005174_4486(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 79 5e-13 CP000720_4077(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 79 5e-13 BA000007_4454(BA000007|pid:none) Escherichia coli O157:H7 str. S... 79 5e-13 CP000950_16(CP000950|pid:none) Yersinia pseudotuberculosis YPIII... 79 5e-13 CP000850_2786(CP000850|pid:none) Salinispora arenicola CNS-205, ... 79 5e-13 AF250053_1(AF250053|pid:none) Drosophila barbarae putative amyla... 79 5e-13 DQ021933_1(DQ021933|pid:none) Bactrocera oleae alpha-amylase (Am... 79 5e-13 EU893288_1(EU893288|pid:none) Escherichia coli strain TB182A alp... 79 5e-13 CP001291_4168(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 79 5e-13 CP001283_1150(CP001283|pid:none) Bacillus cereus AH820, complete... 79 6e-13 AE010300_1465(AE010300|pid:none) Leptospira interrogans serovar ... 79 6e-13 CP000970_3742(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 79 6e-13 AE017194_1263(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 79 6e-13 CP000001_1039(CP000001|pid:none) Bacillus cereus E33L, complete ... 79 6e-13 CP000485_963(CP000485|pid:none) Bacillus thuringiensis str. Al H... 79 6e-13 CP001215_3317(CP001215|pid:none) Bacillus anthracis str. CDC 684... 79 6e-13 AE016879_1071(AE016879|pid:none) Bacillus anthracis str. Ames, c... 79 6e-13 CP001186_1054(CP001186|pid:none) Bacillus cereus G9842, complete... 79 6e-13 CU928164_4051(CU928164|pid:none) Escherichia coli IAI39 chromoso... 79 6e-13 CP001407_1054(CP001407|pid:none) Bacillus cereus 03BB102, comple... 79 6e-13 AY736497_1(AY736497|pid:none) Drosophila pseudoananassae nigrens... 79 6e-13 AE017355_1037(AE017355|pid:none) Bacillus thuringiensis serovar ... 79 6e-13 CU651637_3459(CU651637|pid:none) Escherichia coli LF82 chromosom... 78 8e-13 CP000227_1119(CP000227|pid:none) Bacillus cereus Q1, complete ge... 78 8e-13 CU928162_4148(CU928162|pid:none) Escherichia coli ED1a chromosom... 78 8e-13 CP001177_1161(CP001177|pid:none) Bacillus cereus AH187, complete... 78 8e-13 CP000879_247(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 78 1e-12 CP000510_502(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 78 1e-12 (P27350) RecName: Full=Alpha-amylase; EC=3.2.1.1; AltNa... 78 1e-12 CP000117_4451(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 77 1e-12 CP000783_4028(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 77 1e-12 AM286415_3995(AM286415|pid:none) Yersinia enterocolitica subsp. ... 77 1e-12 CP001336_3145(CP001336|pid:none) Desulfitobacterium hafniense DC... 77 1e-12 (P25718) RecName: Full=Alpha-amylase; EC=3.2.1.1; AltNa... 77 1e-12 AM946981_3374(AM946981|pid:none) Escherichia coli BL21, complete... 77 1e-12 AH1915(AH1915) hypothetical protein all0875 [imported] - Nostoc ... 77 1e-12 AY804013_1(AY804013|pid:none) Escherichia coli strain T10 alpha-... 77 1e-12 CP001600_985(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 77 1e-12 AY736491_1(AY736491|pid:none) Drosophila phaeopleura Amyrel (Amy... 77 1e-12 AF504063_1(AF504063|pid:none) Thermococcus sp. 'AEPII 1a' alpha-... 77 1e-12 AF250052_1(AF250052|pid:none) Drosophila monieri putative amylas... 77 1e-12 CP001107_965(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 77 1e-12 AY733054_1(AY733054|pid:none) Drosophila malerkotliana pallens A... 77 1e-12 CP001104_1146(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 77 2e-12 BA000031_20(BA000031|pid:none) Vibrio parahaemolyticus RIMD 2210... 77 2e-12 CP000036_3329(CP000036|pid:none) Shigella boydii Sb227, complete... 77 2e-12 (O77011) RecName: Full=Alpha-amylase-related protein; E... 77 2e-12 CR378678_199(CR378678|pid:none) Photobacterium profundum SS9 chr... 77 2e-12 CP001098_1859(CP001098|pid:none) Halothermothrix orenii H 168, c... 77 2e-12 (Q9GQV3) RecName: Full=Alpha-amylase-related protein; E... 76 3e-12 AY744446_1(AY744446|pid:none) Drosophila vallismaia AMYREL (Amyr... 76 3e-12 CP001139_2292(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 76 3e-12 (O77021) RecName: Full=Alpha-amylase-related protein; E... 76 4e-12 AP009484_1939(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 76 4e-12 AY736494_1(AY736494|pid:none) Drosophila polychaeta Amyrel (Amyr... 76 4e-12 AF251132_1(AF251132|pid:none) Drosophila vulcana putative amylas... 76 4e-12 AF462602_1(AF462602|pid:none) Drosophila greeni AMYREL (Amyrel) ... 75 5e-12 (O77012) RecName: Full=Alpha-amylase-related protein; E... 75 5e-12 CP001034_554(CP001034|pid:none) Natranaerobius thermophilus JW/N... 75 5e-12 AE017283_582(AE017283|pid:none) Propionibacterium acnes KPA17120... 75 5e-12 AF251139_1(AF251139|pid:none) Drosophila davidi putative amylase... 75 5e-12 AF255722_1(AF255722|pid:none) Zabrotes subfasciatus alpha amylas... 75 5e-12 AE009950_477(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 75 5e-12 (Q9NJN7) RecName: Full=Alpha-amylase-related protein; E... 75 5e-12 AF240464_1(AF240464|pid:none) Pyrococcus woesei alpha-amylase ge... 75 5e-12 CP000266_3688(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 75 7e-12 AF136933_1(AF136933|pid:none) Drosophila bicornuta putative amyl... 75 7e-12 JN0663(JN0663)alpha-amylase (EC 3.2.1.1) precursor - Streptomyce... 75 7e-12 CP001607_842(CP001607|pid:none) Aggregatibacter aphrophilus NJ87... 75 7e-12 AF250057_1(AF250057|pid:none) Drosophila malagassya putative amy... 75 9e-12 AF251134_1(AF251134|pid:none) Drosophila tsacasi putative amylas... 75 9e-12 CP000612_1436(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 75 9e-12 AY733057_1(AY733057|pid:none) Drosophila merina AMYREL (Amyrel) ... 75 9e-12 CU928158_3448(CU928158|pid:none) Escherichia fergusonii ATCC 354... 75 9e-12 HB443634_1(HB443634|pid:none) Sequence 357 from Patent WO2009077... 75 9e-12 CP001107_525(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 75 9e-12 AF251136_1(AF251136|pid:none) Drosophila nikananu putative amyla... 75 9e-12 CP001398_223(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 75 9e-12 AB054318_1(AB054318|pid:none) Schizosaccharomyces pombe mRNA for... 75 9e-12 (O18344) RecName: Full=Alpha-amylase-related protein; E... 74 1e-11 CP000806_806(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 74 1e-11 (O77019) RecName: Full=Alpha-amylase-related protein; E... 74 1e-11 CP001063_3412(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 74 1e-11 CP001114_1341(CP001114|pid:none) Deinococcus deserti VCD115, com... 74 2e-11 CP000656_3313(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 74 2e-11 AE003852_895(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 74 2e-11 (O06994) RecName: Full=Oligo-1,6-glucosidase 1; EC=3.2.... 74 2e-11 AM180088_1086(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 74 2e-11 DQ021924_1(DQ021924|pid:none) Calliphora vomitoria alpha-amylase... 74 2e-11 U51129_1(U51129|pid:none) Stretomyces albus amylase (amy) gene, ... 73 3e-11 AY736537_1(AY736537|pid:none) Drosophila mimica Amyrel (Amyrel) ... 73 3e-11 DQ021950_1(DQ021950|pid:none) Tetanocera ferruginea alpha-amylas... 73 3e-11 (O76284) RecName: Full=Alpha-amylase-related protein; E... 73 3e-11 EF103352_1(EF103352|pid:none) Haliotis discus discus alpha amyla... 73 3e-11 AF250051_1(AF250051|pid:none) Drosophila asahinai putative amyla... 73 3e-11 (O77013) RecName: Full=Alpha-amylase-related protein; E... 73 3e-11 AF250058_1(AF250058|pid:none) Drosophila leontia putative amylas... 73 3e-11 CP000934_257(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 72 4e-11 DQ021928_1(DQ021928|pid:none) Coelopa frigida alpha-amylase (Amy... 72 4e-11 AF136931_1(AF136931|pid:none) Drosophila pallidosa putative amyl... 72 4e-11 AP010935_198(AP010935|pid:none) Streptococcus dysgalactiae subsp... 72 4e-11 AF504062_1(AF504062|pid:none) Thermococcus sp. GU5L5 alpha-amyla... 72 4e-11 AY736478_1(AY736478|pid:none) Drosophila lachaisei Amyrel (Amyre... 72 6e-11 (O76262) RecName: Full=Alpha-amylase-related protein; E... 72 6e-11 CP001638_650(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 72 6e-11 AF251137_1(AF251137|pid:none) Drosophila cauverii putative amyla... 72 6e-11 AY736507_1(AY736507|pid:none) Drosophila subelegans Amyrel (Amyr... 72 6e-11 (P43473) RecName: Full=Alpha-glucosidase; EC=3.2.1.20; ... 72 8e-11 AL935252_156(AL935252|pid:none) Lactobacillus plantarum strain W... 72 8e-11 AF153911_1(AF153911|pid:none) Pseudomonas sp. W7 beta-agarase (p... 72 8e-11 FM954972_2255(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 71 1e-10 CP001037_240(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 71 1e-10 AP006878_1885(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 71 1e-10 AF491635_1(AF491635|pid:none) Drosophila levii alpha-amylase (Am... 71 1e-10 AC010675_14(AC010675|pid:none) Arabidopsis thaliana chromosome 1... 71 1e-10 AF132512_1(AF132512|pid:none) Lutzomyia longipalpis putative alp... 71 1e-10 AP008230_2035(AP008230|pid:none) Desulfitobacterium hafniense Y5... 71 1e-10 AY212801_10(AY212801|pid:none) Uncultured bacterium clone VIIC10... 71 1e-10 AP006627_1259(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 71 1e-10 CP001056_124(CP001056|pid:none) Clostridium botulinum B str. Ekl... 71 1e-10 AY050398_1(AY050398|pid:none) Arabidopsis thaliana At1g69830/T17... 71 1e-10 AB048699_1(AB048699|pid:none) Drosophila khaoyana gene for amyla... 70 2e-10 CP001600_2041(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 70 2e-10 CP000159_2253(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 70 2e-10 CP000922_1422(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 70 2e-10 AF136935_1(AF136935|pid:none) Drosophila rufa putative amylase-r... 70 2e-10 U02029_1(U02029|pid:none) Drosophila virilis alpha-amylase (amy)... 70 2e-10 AF208003_1(AF208003|pid:none) Diabrotica virgifera virgifera alp... 70 2e-10 CR382137_19(CR382137|pid:none) Debaryomyces hansenii strain CBS7... 70 2e-10 AY736486_1(AY736486|pid:none) Drosophila pallidifrons Amyrel (Am... 70 2e-10 AY733044_1(AY733044|pid:none) Drosophila kepulauana AMYREL (Amyr... 70 2e-10 AE003853_247(AE003853|pid:none) Vibrio cholerae O1 biovar eltor ... 70 2e-10 (Q9BN01) RecName: Full=Alpha-amylase B; EC=3.2.1.1; Alt... 70 3e-10 AY495870_1(AY495870|pid:none) Aspergillus flavus isolate 92142a ... 70 3e-10 AF136603_2(AF136603|pid:none) Drosophila virilis sodium channel ... 70 3e-10 AF462600_1(AF462600|pid:none) Drosophila ficusphila AMYREL (Amyr... 70 3e-10 AY733052_1(AY733052|pid:none) Drosophila aracataca AMYREL (Amyre... 70 3e-10 AY736528_1(AY736528|pid:none) Drosophila adamsi Amyrel (Amyrel) ... 70 3e-10 AF048776_1(AF048776|pid:none) Drosophila repleta alpha-amylase (... 70 3e-10 AE015928_3696(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 70 3e-10 D17735_1(D17735|pid:none) D.teissieri Amy gene for alpha-amylase... 70 3e-10 AY736519_1(AY736519|pid:none) Zaprionus inermis Amyrel (Amyrel) ... 70 3e-10 (P83833) RecName: Full=Alpha-amylase A; EC=3.2.1.1; Alt... 70 3e-10
>CQ830101_1(CQ830101|pid:none) Sequence 3 from Patent WO2004055178. Length = 471
Score = 356 bits (913), Expect = 2e-96 Identities = 175/365 (47%), Positives = 241/365 (66%), Gaps = 6/365 (1%) Frame = +1
Query: 217 ATPDQWGSRTIYQLLTDRFSQTVNSSQPCGNLQGYCGGTFQGVEAHLDYIQGMGFDAIWI 396 AT D W S+ IYQLLTDRF + +S+ C NL YCGGT++G+ HLDYI GMGFDAIWI Sbjct: 34 ATSDDWKSKAIYQLLTDRFGRADDSTSNCSNLSNYCGGTYEGITKHLDYISGMGFDAIWI 93
Query: 397 SPVVTNTPGGYHGYWQQDIYTVNEYFGTENDLLNMIKACHERGIWVMLDVVANHVGPVNY 576 SP+ N+ GGYHGYW D Y +N FG E+ L +I+A HER ++VMLDVVANH GP + Sbjct: 94 SPIPKNSDGGYHGYWATDFYQLNSNFGDESQLKALIQAAHERDMYVMLDVVANHAGPTSN 153
Query: 577 DYSTIVPFDSVEHYHNCTTCPQYCTIDDFTNYPQVEECRLSG-LPDLDQDNQ----FVRT 741 YS D+ ++ CT D+ + +E+C ++ LPD+D +N + Sbjct: 154 GYSGYTFGDASLYHPKCTI--------DYNDQTSIEQCWVADELPDIDTENSDNVAILND 205
Query: 742 TLQAWIKNMTEFYGFDGIRIDTVPEVKADFWREYNDAAGVYAVGEVYNDKFNPMLPHTKG 921 + W+ N Y FDGIRIDTV ++ DFW Y +AAGV+A GEV+N + P+ K Sbjct: 206 IVSGWVGN----YSFDGIRIDTVKHIRKDFWTGYAEAAGVFATGEVFNGDPAYVGPYQK- 260
Query: 922 PVDGVLSYPMFFTLRSVF-AQQQSMNQIQSTFQSYQQLFSNMSLLGTFIDNHDQVRFLNE 1098 + +++YPM++ L VF ++ + ++I S + F + S+L TF+DNHD RFLN Sbjct: 261 YLPSLINYPMYYALNDVFVSKSKGFSRISEMLGSNRNAFEDTSVLTTFVDNHDNPRFLNS 320
Query: 1099 QSDIELYKNAITYVLMAQGIPIIYYGTEQGFNGASDPNNREPLWTTSFNTASPLYQFIQT 1278 QSD L+KNA+TYVL+ +GIPI+YYG+EQGF+G +DP NRE LWTT+++T+S LYQFI+T Sbjct: 321 QSDKALFKNALTYVLLGEGIPIVYYGSEQGFSGGADPANREVLWTTNYDTSSDLYQFIKT 380
Query: 1279 VNTFR 1293 VN+ R Sbjct: 381 VNSVR 385
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 2,499,346,462 Number of extensions: 51946096 Number of successful extensions: 143537 Number of sequences better than 10.0: 2846 Number of HSP's gapped: 140488 Number of HSP's successfully gapped: 3123 Length of query: 537 Length of database: 1,061,185,681 Length adjustment: 134 Effective length of query: 403 Effective length of database: 623,213,649 Effective search space: 251155100547 Effective search space used: 251155100547 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
2 |
VH (FL, L) |
0 |
VF (FL, S) |
16 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
6 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
1 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |