| Contig-U16566-1 |
| Contig ID |
Contig-U16566-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
2153 |
| Chromosome number (1..6, M) |
M |
| Chromosome length |
55569 |
| Start point |
48628 |
| End point |
50780 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
20 |
| Number of EST |
20 |
| Link to clone list |
U16566 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 4.12 |
| Homology vs DNA |
Query= Contig-U16566-1 (Contig-U16566-1Q) /CSM_Contig/Contig-U16566-1Q.Seq.d
(2153 letters)
Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(U02291) Dictyostelium discoideum mitochondrial NADH:ubiquin... 731 0.0 3
(AB000109) Dictyostelium discoideum mitochondrial DNA, compl... 731 0.0 3
(DQ336395) Dictyostelium citrinum mitochondrion, complete ge... 478 0.0 3
(BJ436102) Dictyostelium discoideum cDNA clone:ddv29p24, 3' ... 418 0.0 8
(AU266790) Dictyostelium discoideum vegetative cDNA clone:VS... 733 0.0 2
(AU268318) Dictyostelium discoideum vegetative cDNA clone:VS... 656 0.0 2
(AU060829) Dictyostelium discoideum slug cDNA, clone SLB626. 676 0.0 3
(AU271819) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 739 0.0 2
(BJ417245) Dictyostelium discoideum cDNA clone:ddv29p24, 5' ... 739 0.0 4
(AU268319) Dictyostelium discoideum vegetative cDNA clone:VS... 650 0.0 2
(AU271820) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 563 0.0 2
(AU033930) Dictyostelium discoideum slug cDNA, clone SLB626. 400 0.0 2
(AU271765) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 609 0.0 2
(AU271374) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 351 0.0 6
(BJ411750) Dictyostelium discoideum cDNA clone:ddv5l18, 5' e... 676 0.0 1
(AU271751) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 402 0.0 4
(AU271752) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 400 e-180 4
(AU271766) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 490 e-179 3
(AU052368) Dictyostelium discoideum slug cDNA, clone SLD207. 325 e-147 3
(AU261517) Dictyostelium discoideum vegetative cDNA clone:VS... 341 e-143 4
(AU261971) Dictyostelium discoideum vegetative cDNA clone:VS... 325 e-137 3
(AY700145) Polysphondylium pallidum mitochondrion DNA, compl... 157 e-121 16
(AU062063) Dictyostelium discoideum slug cDNA, clone SLH429. 436 e-117 1
(EU275726) Polysphondylium pallidum strain PN500 mitochondri... 165 e-105 12
(EU275727) Dictyostelium fasciculatum strain SH3 mitochondri... 252 e-101 10
(AU271379) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 373 2e-98 1
(AU272283) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 236 3e-57 1
(EJ159148) 1092344041264 Global-Ocean-Sampling_GS-27-01-01-1... 113 1e-45 4
(EK451401) 1095467452602 Global-Ocean-Sampling_GS-32-01-01-1... 74 5e-45 7
(ER411995) 1095386002029 Global-Ocean-Sampling_GS-34-01-01-1... 90 2e-44 5
(EJ533346) 1092955244319 Global-Ocean-Sampling_GS-29-01-01-1... 84 4e-42 4
(EJ395530) 1093011995494 Global-Ocean-Sampling_GS-28-01-01-1... 103 2e-41 5
(BJ416861) Dictyostelium discoideum cDNA clone:ddv27f17, 5' ... 180 1e-40 1
(ER475928) 1093015235231 Global-Ocean-Sampling_GS-35-01-01-1... 74 1e-38 7
(EK221150) 1095460141050 Global-Ocean-Sampling_GS-31-01-01-1... 103 1e-38 5
(EK575339) 1095521158998 Global-Ocean-Sampling_GS-32-01-01-1... 88 1e-38 4
(EJ878725) 1093018384713 Global-Ocean-Sampling_GS-30-02-01-1... 76 2e-38 4
(EK186664) 1095458156437 Global-Ocean-Sampling_GS-31-01-01-1... 74 2e-38 5
(EJ419880) 1093012225489 Global-Ocean-Sampling_GS-28-01-01-1... 82 3e-38 5
(EJ580781) 1092960162101 Global-Ocean-Sampling_GS-29-01-01-1... 84 5e-38 4
(ER450140) 1092963846486 Global-Ocean-Sampling_GS-35-01-01-1... 88 1e-37 5
(EK544038) 1095516074784 Global-Ocean-Sampling_GS-32-01-01-1... 103 2e-35 2
(EJ981581) 1093022157679 Global-Ocean-Sampling_GS-30-02-01-1... 90 2e-35 3
(EJ496207) 1095403575723 Global-Ocean-Sampling_GS-28-01-01-1... 68 3e-35 7
(EJ592163) 1092961057129 Global-Ocean-Sampling_GS-29-01-01-1... 74 1e-34 5
(EJ325776) 1092963382693 Global-Ocean-Sampling_GS-28-01-01-1... 74 1e-34 5
(EK084436) 1092961131577 Global-Ocean-Sampling_GS-31-01-01-1... 90 2e-34 4
(EK284434) 1095462308120 Global-Ocean-Sampling_GS-31-01-01-1... 90 2e-34 5
(EK325104) 1095467004390 Global-Ocean-Sampling_GS-31-01-01-1... 82 2e-34 3
(EK334282) 1095467034736 Global-Ocean-Sampling_GS-31-01-01-1... 82 2e-34 3
(EK373792) 1095469429927 Global-Ocean-Sampling_GS-31-01-01-1... 90 3e-34 3
(EJ583178) 1092960193165 Global-Ocean-Sampling_GS-29-01-01-1... 84 4e-34 5
(ER363607) 1093018930860 Global-Ocean-Sampling_GS-34-01-01-1... 107 6e-34 4
(EJ940131) 1093018860199 Global-Ocean-Sampling_GS-30-02-01-1... 90 3e-33 4
(ER487262) 1093015306083 Global-Ocean-Sampling_GS-35-01-01-1... 117 5e-33 5
(EJ258868) 1095349028149 Global-Ocean-Sampling_GS-27-01-01-1... 98 5e-33 4
(ER584085) 1093015858754 Global-Ocean-Sampling_GS-36-01-01-2... 72 6e-33 5
(CP000107) Ehrlichia canis str. Jake, complete genome. 141 7e-33 2
(EJ563676) 1092959685811 Global-Ocean-Sampling_GS-29-01-01-1... 98 1e-32 5
(EJ712973) 1092956090373 Global-Ocean-Sampling_GS-30-02-01-1... 66 2e-32 5
(EJ350622) 1092963584109 Global-Ocean-Sampling_GS-28-01-01-1... 82 3e-32 5
(EK115035) 1092963204739 Global-Ocean-Sampling_GS-31-01-01-1... 74 4e-32 5
(EJ052967) 1095456008994 Global-Ocean-Sampling_GS-26-01-01-1... 125 7e-32 3
(AU266975) Dictyostelium discoideum vegetative cDNA clone:VS... 121 8e-32 3
(EK315850) 1095462412686 Global-Ocean-Sampling_GS-31-01-01-1... 82 9e-32 5
(BJ410021) Dictyostelium discoideum cDNA clone:ddv10m23, 5' ... 151 1e-31 1
(EJ296581) 1095388046508 Global-Ocean-Sampling_GS-27-01-01-1... 76 1e-31 4
(EK015354) 1092955228285 Global-Ocean-Sampling_GS-31-01-01-1... 86 3e-31 5
(EJ767599) 1092963319615 Global-Ocean-Sampling_GS-30-02-01-1... 72 5e-31 4
(AF007261) Reclinomonas americana mitochondrion, complete ge... 96 7e-31 10
(ER587970) 1093016178417 Global-Ocean-Sampling_GS-36-01-01-2... 64 2e-30 5
(EK122739) 1092964704585 Global-Ocean-Sampling_GS-31-01-01-1... 74 2e-30 4
(EJ544007) 1092955418065 Global-Ocean-Sampling_GS-29-01-01-1... 74 2e-30 3
(EJ688799) 1092955237114 Global-Ocean-Sampling_GS-30-02-01-1... 88 3e-30 6
(EK073976) 1092961016696 Global-Ocean-Sampling_GS-31-01-01-1... 76 4e-30 6
(AF288092) Naegleria gruberi mitochondrial DNA, complete gen... 103 6e-30 9
(EK474111) 1095469471239 Global-Ocean-Sampling_GS-32-01-01-1... 58 7e-30 6
(EJ394293) 1093011986979 Global-Ocean-Sampling_GS-28-01-01-1... 105 8e-30 4
(EJ943323) 1093018899370 Global-Ocean-Sampling_GS-30-02-01-1... 72 1e-29 3
(EK440045) 1095522071740 Global-Ocean-Sampling_GS-31-01-01-1... 88 1e-29 4
(EJ378824) 1092963753414 Global-Ocean-Sampling_GS-28-01-01-1... 82 1e-29 5
(EJ935985) 1093018838598 Global-Ocean-Sampling_GS-30-02-01-1... 98 2e-29 2
(EJ840795) 1093017827949 Global-Ocean-Sampling_GS-30-02-01-1... 98 2e-29 2
(EK327694) 1095467012762 Global-Ocean-Sampling_GS-31-01-01-1... 72 2e-29 4
(EJ068934) 1095458067542 Global-Ocean-Sampling_GS-26-01-01-1... 74 2e-29 4
(ER362657) 1093017959403 Global-Ocean-Sampling_GS-34-01-01-1... 72 3e-29 4
(EK228012) 1095460165902 Global-Ocean-Sampling_GS-31-01-01-1... 82 5e-29 5
(AF222718) Chrysodidymus synuroideus mitochondrion, complete... 96 6e-29 9
(EJ174703) 1092344096145 Global-Ocean-Sampling_GS-27-01-01-1... 68 1e-28 4
(EJ633402) 1092966607688 Global-Ocean-Sampling_GS-29-01-01-1... 88 1e-28 4
(EJ463418) 1095383000362 Global-Ocean-Sampling_GS-28-01-01-1... 74 1e-28 4
(EJ606855) 1092962014386 Global-Ocean-Sampling_GS-29-01-01-1... 88 1e-28 4
(EK083478) 1092961122191 Global-Ocean-Sampling_GS-31-01-01-1... 74 2e-28 6
(EJ204887) 1092344332596 Global-Ocean-Sampling_GS-27-01-01-1... 74 2e-28 5
(EK213790) 1095460108360 Global-Ocean-Sampling_GS-31-01-01-1... 74 2e-28 4
(ER536959) 1093015863835 Global-Ocean-Sampling_GS-35-01-01-1... 82 2e-28 3
(EJ813951) 1093017505359 Global-Ocean-Sampling_GS-30-02-01-1... 90 2e-28 4
(EK035421) 1092959440021 Global-Ocean-Sampling_GS-31-01-01-1... 74 2e-28 4
(EJ690292) 1092956001076 Global-Ocean-Sampling_GS-30-02-01-1... 66 3e-28 4
(EJ108998) 1092343147288 Global-Ocean-Sampling_GS-27-01-01-1... 90 4e-28 5
(EK573817) 1095521099243 Global-Ocean-Sampling_GS-32-01-01-1... 74 4e-28 4
(EJ725107) 1092959492302 Global-Ocean-Sampling_GS-30-02-01-1... 88 9e-28 3
(EJ772804) 1092973903990 Global-Ocean-Sampling_GS-30-02-01-1... 72 1e-27 3
(EK403868) 1095469556832 Global-Ocean-Sampling_GS-31-01-01-1... 88 1e-27 3
(EJ784663) 1093017305163 Global-Ocean-Sampling_GS-30-02-01-1... 82 1e-27 5
(EK282637) 1095462300987 Global-Ocean-Sampling_GS-31-01-01-1... 90 1e-27 5
(AU267856) Dictyostelium discoideum vegetative cDNA clone:VS... 109 1e-27 2
(ER553539) 1093016276567 Global-Ocean-Sampling_GS-35-01-01-1... 80 1e-27 4
(EK285256) 1095462310605 Global-Ocean-Sampling_GS-31-01-01-1... 92 1e-27 4
(EK124425) 1092970302417 Global-Ocean-Sampling_GS-31-01-01-1... 72 2e-27 5
(EJ994769) 1093023079510 Global-Ocean-Sampling_GS-30-02-01-1... 137 2e-27 1
(EJ975625) 1093022115223 Global-Ocean-Sampling_GS-30-02-01-1... 137 2e-27 1
(EK321284) 1095462430210 Global-Ocean-Sampling_GS-31-01-01-1... 74 3e-27 5
(EK173273) 1095458085005 Global-Ocean-Sampling_GS-31-01-01-1... 70 3e-27 5
(AR546995) Sequence 2126 from patent US 6747137. 90 3e-27 5
(ER469139) 1092963942676 Global-Ocean-Sampling_GS-35-01-01-1... 64 3e-27 3
(EJ044277) 1095454111632 Global-Ocean-Sampling_GS-26-01-01-1... 107 4e-27 5
(EJ246687) 1095337014183 Global-Ocean-Sampling_GS-27-01-01-1... 82 5e-27 4
(EK233884) 1095460191756 Global-Ocean-Sampling_GS-31-01-01-1... 76 5e-27 5
(DL174265) Methods for Identifying the Target of a Compound ... 90 9e-27 4
(AX489457) Sequence 6757 from Patent WO02053728. 90 9e-27 4
(EJ985688) 1093023008297 Global-Ocean-Sampling_GS-30-02-01-1... 78 1e-26 4
(EJ873822) 1093018359017 Global-Ocean-Sampling_GS-30-02-01-1... 82 1e-26 5
(EJ965001) 1093022033438 Global-Ocean-Sampling_GS-30-02-01-1... 90 1e-26 3
(EK421869) 1095515515676 Global-Ocean-Sampling_GS-31-01-01-1... 121 2e-26 2
(EJ113761) 1092343248987 Global-Ocean-Sampling_GS-27-01-01-1... 84 2e-26 3
(EJ810734) 1093017488116 Global-Ocean-Sampling_GS-30-02-01-1... 68 2e-26 5
(ER369265) 1093022165052 Global-Ocean-Sampling_GS-34-01-01-1... 70 2e-26 4
(EJ511265) 1095407089874 Global-Ocean-Sampling_GS-28-01-01-1... 72 2e-26 6
(EJ384252) 1092963789643 Global-Ocean-Sampling_GS-28-01-01-1... 68 2e-26 4
(EJ457062) 1093017555749 Global-Ocean-Sampling_GS-28-01-01-1... 90 2e-26 4
(EJ570115) 1092960031604 Global-Ocean-Sampling_GS-29-01-01-1... 72 3e-26 4
(EK462259) 1095469397292 Global-Ocean-Sampling_GS-32-01-01-1... 62 3e-26 5
(CP000236) Ehrlichia chaffeensis str. Arkansas, complete gen... 133 3e-26 1
(EJ120387) 1092343370239 Global-Ocean-Sampling_GS-27-01-01-1... 54 3e-26 6
(EK066798) 1092960134755 Global-Ocean-Sampling_GS-31-01-01-1... 58 4e-26 6
(EK060142) 1092960070806 Global-Ocean-Sampling_GS-31-01-01-1... 74 4e-26 3
(EJ041280) 1095454095617 Global-Ocean-Sampling_GS-26-01-01-1... 78 5e-26 3
(EJ933311) 1093018817086 Global-Ocean-Sampling_GS-30-02-01-1... 78 5e-26 3
(EJ459130) 1093018407837 Global-Ocean-Sampling_GS-28-01-01-1... 117 8e-26 4
(ER344572) 1092344371215 Global-Ocean-Sampling_GS-34-01-01-1... 70 9e-26 3
(EJ830128) 1093017577300 Global-Ocean-Sampling_GS-30-02-01-1... 68 1e-25 5
(ER407051) 1095366027182 Global-Ocean-Sampling_GS-34-01-01-1... 76 2e-25 4
(ER504258) 1093015415356 Global-Ocean-Sampling_GS-35-01-01-1... 66 2e-25 4
(ER513639) 1093015475480 Global-Ocean-Sampling_GS-35-01-01-1... 64 2e-25 5
(EJ894976) 1093018463196 Global-Ocean-Sampling_GS-30-02-01-1... 74 2e-25 5
(ER594429) 1093016214938 Global-Ocean-Sampling_GS-36-01-01-2... 62 2e-25 5
(EJ780147) 1093017243840 Global-Ocean-Sampling_GS-30-02-01-1... 74 2e-25 5
(EJ914609) 1093018554569 Global-Ocean-Sampling_GS-30-02-01-1... 82 3e-25 4
(ER477281) 1093015244014 Global-Ocean-Sampling_GS-35-01-01-1... 74 3e-25 4
(EJ416770) 1093012188063 Global-Ocean-Sampling_GS-28-01-01-1... 70 3e-25 6
(AY534144) Saprolegnia ferax strain ATCC 36051 mitochondion,... 50 3e-25 11
(EJ122606) 1092343379894 Global-Ocean-Sampling_GS-27-01-01-1... 78 3e-25 4
(EK407641) 1095505091563 Global-Ocean-Sampling_GS-31-01-01-1... 76 4e-25 4
(EJ318216) 1095403322759 Global-Ocean-Sampling_GS-27-01-01-1... 64 5e-25 5
(DV185860) CT055_C10_CT055_3700_91.ab1 C. tentans tissue cul... 109 9e-25 2
(EK268377) 1095462242805 Global-Ocean-Sampling_GS-31-01-01-1... 84 1e-24 3
(EJ791992) 1093017381858 Global-Ocean-Sampling_GS-30-02-01-1... 68 1e-24 4
(EK106843) 1092963058421 Global-Ocean-Sampling_GS-31-01-01-1... 60 2e-24 5
(ER381519) 1094338763224 Global-Ocean-Sampling_GS-34-01-01-1... 88 2e-24 3
(EK400710) 1095469540013 Global-Ocean-Sampling_GS-31-01-01-1... 103 2e-24 3
(EJ252005) 1095344039411 Global-Ocean-Sampling_GS-27-01-01-1... 64 3e-24 5
(EJ507842) 1095407013237 Global-Ocean-Sampling_GS-28-01-01-1... 105 3e-24 2
(EJ609651) 1092962034486 Global-Ocean-Sampling_GS-29-01-01-1... 56 4e-24 4
(EJ164929) 1092344061930 Global-Ocean-Sampling_GS-27-01-01-1... 72 4e-24 4
(EJ741432) 1092962021706 Global-Ocean-Sampling_GS-30-02-01-1... 56 4e-24 6
(ER352723) 1092347051473 Global-Ocean-Sampling_GS-34-01-01-1... 72 4e-24 6
(EJ772853) 1092974100240 Global-Ocean-Sampling_GS-30-02-01-1... 56 5e-24 6
(EJ361402) 1092963688524 Global-Ocean-Sampling_GS-28-01-01-1... 62 6e-24 4
(ER525249) 1093015627659 Global-Ocean-Sampling_GS-35-01-01-1... 68 6e-24 6
(EJ715509) 1092959333835 Global-Ocean-Sampling_GS-30-02-01-1... 90 9e-24 3
(EJ668089) 1092955048826 Global-Ocean-Sampling_GS-30-02-01-1... 90 9e-24 3
(ER520621) 1093015565932 Global-Ocean-Sampling_GS-35-01-01-1... 56 1e-23 5
(ER591341) 1093016199231 Global-Ocean-Sampling_GS-36-01-01-2... 68 1e-23 4
(EJ162780) 1092344054644 Global-Ocean-Sampling_GS-27-01-01-1... 74 1e-23 3
(EU651892) Hemiselmis andersenii strain CCMP 644 mitochondri... 88 1e-23 8
(EK104452) 1092963039447 Global-Ocean-Sampling_GS-31-01-01-1... 90 2e-23 4
(EK076363) 1092961044058 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-23 4
(ER621028) 1093017408741 Global-Ocean-Sampling_GS-36-01-01-2... 90 2e-23 4
(EL775064) PUNC187TV Pythium ultimum ESTs Pythium ultimum DA... 70 2e-23 4
(DQ832718) Phytophthora ramorum mitochondrion, complete genome. 74 2e-23 7
(EU427470) Phytophthora ramorum strain CBS 101553 mitochondr... 74 2e-23 7
(EK177816) 1095458106006 Global-Ocean-Sampling_GS-31-01-01-1... 103 3e-23 3
(ER427567) 1092963761055 Global-Ocean-Sampling_GS-35-01-01-1... 80 3e-23 5
(EK392182) 1095469506314 Global-Ocean-Sampling_GS-31-01-01-1... 92 4e-23 3
(EJ822559) 1093017544395 Global-Ocean-Sampling_GS-30-02-01-1... 58 5e-23 4
(EJ699596) 1092956030882 Global-Ocean-Sampling_GS-30-02-01-1... 72 5e-23 4
(EJ203033) 1092344315185 Global-Ocean-Sampling_GS-27-01-01-1... 56 6e-23 6
(ER498263) 1093015360355 Global-Ocean-Sampling_GS-35-01-01-1... 68 8e-23 4
(EJ705924) 1092956053541 Global-Ocean-Sampling_GS-30-02-01-1... 72 9e-23 4
(EK268643) 1095462243793 Global-Ocean-Sampling_GS-31-01-01-1... 72 9e-23 5
(EJ821847) 1093017541287 Global-Ocean-Sampling_GS-30-02-01-1... 66 1e-22 4
(ER445423) 1092963827636 Global-Ocean-Sampling_GS-35-01-01-1... 80 1e-22 2
(EJ858764) 1093017961724 Global-Ocean-Sampling_GS-30-02-01-1... 66 2e-22 4
(CT789848) Paramecium tetraurelia 5-PRIME EST from clone LK0... 84 2e-22 3
(EJ091648) 1095460190429 Global-Ocean-Sampling_GS-26-01-01-1... 64 2e-22 3
(CT775302) Paramecium tetraurelia 5-PRIME EST from clone LK0... 84 2e-22 3
(EK121550) 1092963535497 Global-Ocean-Sampling_GS-31-01-01-1... 64 2e-22 5
(DB741377) Apis mellifera head cDNA, RIKEN full-length enric... 84 2e-22 4
(ER564165) 1093015761256 Global-Ocean-Sampling_GS-36-01-01-2... 76 2e-22 5
(EK211126) 1095460099525 Global-Ocean-Sampling_GS-31-01-01-1... 64 2e-22 4
(CT767517) Paramecium tetraurelia 5-PRIME EST from clone LK0... 84 2e-22 3
(ER308849) 1092343775886 Global-Ocean-Sampling_GS-34-01-01-1... 66 2e-22 5
(EJ736044) 1092961154612 Global-Ocean-Sampling_GS-30-02-01-1... 50 3e-22 6
(EK374563) 1095469432801 Global-Ocean-Sampling_GS-31-01-01-1... 84 3e-22 4
(EJ417407) 1093012194402 Global-Ocean-Sampling_GS-28-01-01-1... 72 3e-22 4
(ER488909) 1093015316053 Global-Ocean-Sampling_GS-35-01-01-1... 80 4e-22 4
(CT791106) Paramecium tetraurelia 5-PRIME EST from clone LK0... 84 5e-22 3
(ER582954) 1093015851318 Global-Ocean-Sampling_GS-36-01-01-2... 60 5e-22 3
(EK209842) 1095460095028 Global-Ocean-Sampling_GS-31-01-01-1... 82 6e-22 5
(EK008789) 1092955138985 Global-Ocean-Sampling_GS-31-01-01-1... 66 6e-22 3
(ER533981) 1093015798724 Global-Ocean-Sampling_GS-35-01-01-1... 98 6e-22 2
(EK387450) 1095469488605 Global-Ocean-Sampling_GS-31-01-01-1... 66 6e-22 3
(EJ036773) 1095454071419 Global-Ocean-Sampling_GS-26-01-01-1... 76 7e-22 2
(EJ134768) 1092343591301 Global-Ocean-Sampling_GS-27-01-01-1... 78 7e-22 3
(ER515771) 1093015501049 Global-Ocean-Sampling_GS-35-01-01-1... 66 2e-21 5
(EJ280626) 1095366052405 Global-Ocean-Sampling_GS-27-01-01-1... 82 2e-21 4
(EJ411568) 1093012149331 Global-Ocean-Sampling_GS-28-01-01-1... 76 2e-21 3
(ES645358) NVPR404TR NVPP Nasonia vitripennis cDNA, mRNA seq... 105 2e-21 3
(EJ793499) 1093017388395 Global-Ocean-Sampling_GS-30-02-01-1... 58 2e-21 4
(EK156273) 1095458006664 Global-Ocean-Sampling_GS-31-01-01-1... 74 2e-21 3
(EJ746657) 1092963000737 Global-Ocean-Sampling_GS-30-02-01-1... 76 3e-21 2
(EJ647084) 1092344026869 Global-Ocean-Sampling_GS-30-02-01-1... 84 3e-21 4
(EK069457) 1092960171726 Global-Ocean-Sampling_GS-31-01-01-1... 82 5e-21 3
(ER536036) 1093015843515 Global-Ocean-Sampling_GS-35-01-01-1... 78 7e-21 3
(EJ251610) 1095344036358 Global-Ocean-Sampling_GS-27-01-01-1... 58 7e-21 3
(ER562110) 1093015751076 Global-Ocean-Sampling_GS-36-01-01-2... 76 7e-21 3
(GE384039) 293431655 Nasonia vitripennis Female Pupae Nasoni... 105 8e-21 2
(GE384372) 293429159 Nasonia vitripennis Female Pupae Nasoni... 105 8e-21 2
(EJ805472) 1093017455782 Global-Ocean-Sampling_GS-30-02-01-1... 68 8e-21 3
(EK141129) 1095454111401 Global-Ocean-Sampling_GS-31-01-01-1... 100 8e-21 3
(GE410217) 293811212 Nasonia vitripennis Female Pupae Nasoni... 105 8e-21 2
(EJ485532) 1095403497860 Global-Ocean-Sampling_GS-28-01-01-1... 78 9e-21 3
(ER387094) 1094426031882 Global-Ocean-Sampling_GS-34-01-01-1... 64 9e-21 3
(GE424704) 294514751 Nasonia vitripennis Adult Male Nasonia ... 105 9e-21 2
(GE371636) 292305485 Nasonia vitripennis Male Pupae Nasonia ... 105 9e-21 2
(GE402934) 293790173 Nasonia vitripennis Female Pupae Nasoni... 105 1e-20 2
(EL780219) PUNDB22TV Pythium ultimum ESTs Pythium ultimum DA... 78 1e-20 4
(EK014847) 1092955225832 Global-Ocean-Sampling_GS-31-01-01-1... 70 1e-20 3
(GE393895) 293774461 Nasonia vitripennis Female Pupae Nasoni... 105 1e-20 2
(EK175116) 1095458094264 Global-Ocean-Sampling_GS-31-01-01-1... 82 1e-20 2
(FC680356) CAXX14105.fwd CAXX Lottia gigantea from male gona... 82 2e-20 3
(FC680206) CAXX14015.fwd CAXX Lottia gigantea from male gona... 82 2e-20 3
(FC690027) CAXX21016.fwd CAXX Lottia gigantea from male gona... 82 2e-20 3
(FC688348) CAXX2002.fwd CAXX Lottia gigantea from male gonad... 82 2e-20 3
(FC676871) CAXX1160.fwd CAXX Lottia gigantea from male gonad... 82 2e-20 3
(FC680375) CAXX14119.fwd CAXX Lottia gigantea from male gona... 82 2e-20 3
(FC766063) CBBN2891.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 82 2e-20 3
(FC687702) CAXX19632.fwd CAXX Lottia gigantea from male gona... 82 2e-20 3
(FC757580) CBBN10162.fwd CBBN Lottia gigantea 3,4,5,6.5d Lar... 82 3e-20 3
(FC641018) CAXU5162.fwd CAXU Lottia gigantea from female gon... 82 3e-20 3
(FC766641) CBBN3269.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 82 3e-20 3
(FC699059) CAXX742.fwd CAXX Lottia gigantea from male gonad ... 82 3e-20 3
(FC590171) CAXP5877.fwd CAXP Lottia gigantea from head, foot... 82 3e-20 3
(EK208891) 1095460091266 Global-Ocean-Sampling_GS-31-01-01-1... 113 3e-20 1
(EJ646820) 1092342088677 Global-Ocean-Sampling_GS-30-02-01-1... 84 3e-20 3
(FC637359) CAXU2522.fwd CAXU Lottia gigantea from female gon... 82 3e-20 3
(FC590142) CAXP5863.fwd CAXP Lottia gigantea from head, foot... 82 3e-20 3
(FC588812) CAXP4842.fwd CAXP Lottia gigantea from head, foot... 82 3e-20 3
(EJ937097) 1093018844309 Global-Ocean-Sampling_GS-30-02-01-1... 96 3e-20 2
(FC644314) CAXU7098.fwd CAXU Lottia gigantea from female gon... 82 3e-20 3
(FC700098) CAXX8090.fwd CAXX Lottia gigantea from male gonad... 82 3e-20 3
(CN763053) ID0AAA5DH09RM1 ApMS Acyrthosiphon pisum cDNA clon... 94 3e-20 3
(ER459545) 1092963884212 Global-Ocean-Sampling_GS-35-01-01-1... 80 4e-20 2
(CT770381) Paramecium tetraurelia 5-PRIME EST from clone LK0... 84 4e-20 3
(EJ818603) 1093017527439 Global-Ocean-Sampling_GS-30-02-01-1... 90 4e-20 2
(EK365861) 1095469396709 Global-Ocean-Sampling_GS-31-01-01-1... 74 4e-20 2
(EJ247857) 1095339022948 Global-Ocean-Sampling_GS-27-01-01-1... 82 5e-20 2
(EK004824) 1092343572510 Global-Ocean-Sampling_GS-31-01-01-1... 50 6e-20 6
(ER567135) 1093015774672 Global-Ocean-Sampling_GS-36-01-01-2... 64 1e-19 3
(FF003233) 219532_1218_2420 Pythium ultimum ESTs Pythium ult... 78 2e-19 3
(EJ103768) 1092343129819 Global-Ocean-Sampling_GS-27-01-01-1... 84 2e-19 2
(ER584135) 1093015858809 Global-Ocean-Sampling_GS-36-01-01-2... 64 3e-19 4
(CZ530723) SRAA-aac68f07.b1 Strongyloides ratti whole genome... 94 5e-19 3
(EJ699571) 1092956030855 Global-Ocean-Sampling_GS-30-02-01-1... 56 5e-19 3
(ER414209) 1095390080762 Global-Ocean-Sampling_GS-34-01-01-1... 82 6e-19 4
(EJ820710) 1093017536157 Global-Ocean-Sampling_GS-30-02-01-1... 72 6e-19 3
(EH631450) EST2557 LK04 Laupala kohalensis cDNA clone 106102... 66 7e-19 5
(EJ353597) 1092963613465 Global-Ocean-Sampling_GS-28-01-01-1... 82 8e-19 2
(EH633785) EST4892 LK04 Laupala kohalensis cDNA clone 106102... 66 8e-19 5
(EH629509) EST616 LK04 Laupala kohalensis cDNA clone 1061021... 66 9e-19 5
(CN759220) ID0AAA24DF07RM1 ApMS Acyrthosiphon pisum cDNA clo... 94 1e-18 3
(EH634711) EST5819 LK04 Laupala kohalensis cDNA clone 106102... 66 1e-18 5
(EJ986930) 1093023017337 Global-Ocean-Sampling_GS-30-02-01-1... 60 1e-18 5
(EJ998625) 1093025004720 Global-Ocean-Sampling_GS-30-02-01-1... 70 1e-18 3
(DQ832717) Phytophthora sojae mitochondrion, complete genome. 84 2e-18 8
(EK342722) 1095467068304 Global-Ocean-Sampling_GS-31-01-01-1... 64 2e-18 3
(FC685818) CAXX18466.fwd CAXX Lottia gigantea from male gona... 82 2e-18 3
(CZ542878) SRAA-aad46f09.g1 Strongyloides ratti whole genome... 94 2e-18 3
(FF020336) 301974_1507_1684 Pythium ultimum ESTs Pythium ult... 74 2e-18 3
(ER622920) 1093017470167 Global-Ocean-Sampling_GS-36-01-01-2... 68 2e-18 3
(EK381948) 1095469465095 Global-Ocean-Sampling_GS-31-01-01-1... 107 2e-18 1
(EJ351454) 1092963591165 Global-Ocean-Sampling_GS-28-01-01-1... 66 2e-18 3
(EJ609830) 1092962036214 Global-Ocean-Sampling_GS-29-01-01-1... 56 2e-18 4
(EJ715478) 1092959333800 Global-Ocean-Sampling_GS-30-02-01-1... 66 2e-18 3
(EJ668057) 1092955048791 Global-Ocean-Sampling_GS-30-02-01-1... 66 2e-18 3
(CX300812) C08002E05SK PhyRootSw1 Citrus sinensis cDNA clone... 94 2e-18 3
(GE389815) 293760544 Nasonia vitripennis Female Pupae Nasoni... 98 2e-18 2
(EK363510) 1095469362791 Global-Ocean-Sampling_GS-31-01-01-1... 62 2e-18 3
(DB730510) Apis mellifera head cDNA, RIKEN full-length enric... 84 2e-18 3
(EJ809258) 1093017479361 Global-Ocean-Sampling_GS-30-02-01-1... 58 2e-18 4
(EJ868582) 1093018298886 Global-Ocean-Sampling_GS-30-02-01-1... 76 2e-18 2
(EJ084185) 1095460082235 Global-Ocean-Sampling_GS-26-01-01-1... 90 3e-18 2
(EJ866442) 1093018281477 Global-Ocean-Sampling_GS-30-02-01-1... 66 3e-18 4
(EJ797347) 1093017407937 Global-Ocean-Sampling_GS-30-02-01-1... 58 3e-18 4
(EK272467) 1095462263409 Global-Ocean-Sampling_GS-31-01-01-1... 56 4e-18 5
(EJ098912) 1095462344239 Global-Ocean-Sampling_GS-26-01-01-1... 56 4e-18 5
(EK017946) 1092955253319 Global-Ocean-Sampling_GS-31-01-01-1... 66 4e-18 3
(EJ419322) 1093012218646 Global-Ocean-Sampling_GS-28-01-01-1... 56 5e-18 4
(FC696363) CAXX5499.fwd CAXX Lottia gigantea from male gonad... 82 5e-18 3
(FG022430) CBOT2620.fwd CBOT Phytophthora capsici LT1534 Myc... 66 5e-18 4
(FC648068) CAXU9476.fwd CAXU Lottia gigantea from female gon... 82 6e-18 3
(EK346887) 1095467559479 Global-Ocean-Sampling_GS-31-01-01-1... 88 6e-18 3
(EK156869) 1095458008777 Global-Ocean-Sampling_GS-31-01-01-1... 80 6e-18 3
(FM992695) Candida dubliniensis CD36 chromosome R, complete ... 98 6e-18 2
(EJ226931) 1092401215301 Global-Ocean-Sampling_GS-27-01-01-1... 64 6e-18 3
(EJ514161) 1092343604181 Global-Ocean-Sampling_GS-29-01-01-1... 72 7e-18 3
(EK301028) 1095462364943 Global-Ocean-Sampling_GS-31-01-01-1... 72 7e-18 2
(FF052941) 450942_1317_1702 Pythium ultimum ESTs Pythium ult... 78 7e-18 3
(EJ281148) 1095366053925 Global-Ocean-Sampling_GS-27-01-01-1... 84 9e-18 3
(ER569591) 1093015786575 Global-Ocean-Sampling_GS-36-01-01-2... 66 9e-18 3
(EK258385) 1095462046132 Global-Ocean-Sampling_GS-31-01-01-1... 76 9e-18 4
(EK533132) 1095516016668 Global-Ocean-Sampling_GS-32-01-01-1... 100 1e-17 2
(EK173807) 1095458087922 Global-Ocean-Sampling_GS-31-01-01-1... 84 1e-17 2
(ER506881) 1093015425159 Global-Ocean-Sampling_GS-35-01-01-1... 84 1e-17 2
(EK526491) 1095515644441 Global-Ocean-Sampling_GS-32-01-01-1... 100 1e-17 2
(CV659574) tak15e07.y1 Hydra EST UCI 6 Hydra magnipapillata ... 66 1e-17 4
(AY066623) Schmidtea mediterranea clone H.111.7f unknown mRN... 92 1e-17 3
(CV659353) tak40e03.y1 Hydra EST UCI 6 Hydra magnipapillata ... 66 1e-17 4
(DT611774) ACAG-aaa91g06.g1 Hydra_EST_UCI-9 Hydra magnipapil... 66 1e-17 4
(EJ748926) 1092963022064 Global-Ocean-Sampling_GS-30-02-01-1... 56 1e-17 5
(DT611597) ACAG-aab24c03.g1 Hydra_EST_UCI-9 Hydra magnipapil... 66 2e-17 4
(EJ257352) 1095349017017 Global-Ocean-Sampling_GS-27-01-01-1... 90 2e-17 3
(EK371243) 1095469417468 Global-Ocean-Sampling_GS-31-01-01-1... 82 2e-17 3
(ER286308) 1092343571760 Global-Ocean-Sampling_GS-34-01-01-1... 52 2e-17 5
(EK317595) 1095462418612 Global-Ocean-Sampling_GS-31-01-01-1... 90 3e-17 3
(CT009535) M.truncatula DNA sequence from clone MTH2-68D12 o... 103 3e-17 1
(AC148818) Medicago truncatula clone mth2-39c7, complete seq... 103 3e-17 1
(CU571058) M.truncatula DNA sequence *** SEQUENCING IN PROGR... 103 3e-17 1
(EJ317583) 1095403310031 Global-Ocean-Sampling_GS-27-01-01-1... 66 3e-17 3
(EJ005407) 1091138272111 Global-Ocean-Sampling_GS-26-01-01-1... 80 3e-17 4
(EK571078) 1095521078419 Global-Ocean-Sampling_GS-32-01-01-1... 72 4e-17 2
(AL367673) Medicago truncatula EST MtBA16E06F1 : T3 end of c... 96 4e-17 3
(EW968135) LS_14_J14_T7 Headlice composite library with all ... 90 4e-17 2
(EK242902) 1095460241246 Global-Ocean-Sampling_GS-31-01-01-1... 90 4e-17 2
(EK014501) 1092955223819 Global-Ocean-Sampling_GS-31-01-01-1... 84 4e-17 2
(EJ520774) 1092955137782 Global-Ocean-Sampling_GS-29-01-01-1... 72 4e-17 2
(EK297152) 1095462351081 Global-Ocean-Sampling_GS-31-01-01-1... 74 4e-17 4
(FC678344) CAXX12516.fwd CAXX Lottia gigantea from male gona... 82 6e-17 2
(FC573159) CAXP10312.fwd CAXP Lottia gigantea from head, foo... 82 7e-17 2
(EK094621) 1092962026794 Global-Ocean-Sampling_GS-31-01-01-1... 56 7e-17 5
(EK209249) 1095460092807 Global-Ocean-Sampling_GS-31-01-01-1... 56 9e-17 4
(EK382419) 1095469467167 Global-Ocean-Sampling_GS-31-01-01-1... 66 9e-17 4
(EJ486982) 1095403508663 Global-Ocean-Sampling_GS-28-01-01-1... 92 1e-16 3
(EK078449) 1092961077759 Global-Ocean-Sampling_GS-31-01-01-1... 70 1e-16 3
(EK430726) 1095516149597 Global-Ocean-Sampling_GS-31-01-01-1... 50 1e-16 4
(FF438100) G142P60227RB6.T0 Acorn worm juvenile pCMVSport6 l... 68 1e-16 2
(FF433669) G142P60168RC8.T0 Acorn worm juvenile pCMVSport6 l... 68 1e-16 2
(FF431805) G142P60139RB6.T0 Acorn worm juvenile pCMVSport6 l... 68 1e-16 2
(CR925678) Ehrlichia ruminantium str. Welgevonden, complete ... 101 1e-16 1
(CR767821) Ehrlichia ruminantium strain Welgevonden, complet... 101 1e-16 1
(AP008981) Orientia tsutsugamushi str. Ikeda DNA, complete g... 101 1e-16 1
(AM494475) Orientia tsutsugamushi Boryong complete genome. 101 1e-16 1
(FF471395) G613P6072RC4.T0 Acorn worm blastula/gastrula pCMV... 68 1e-16 2
(FF472667) G613P6090RB11.T0 Acorn worm blastula/gastrula pCM... 68 1e-16 2
(EL779237) PUNC836TV Pythium ultimum ESTs Pythium ultimum DA... 78 1e-16 3
(FF496015) G708P537FD2.T0 Acorn worm normalized gastrula pEx... 68 1e-16 2
(FF477484) G613P6172RH9.T0 Acorn worm blastula/gastrula pCMV... 68 1e-16 2
(EJ162759) 1092344054520 Global-Ocean-Sampling_GS-27-01-01-1... 54 1e-16 3
(EX621153) 255414966 Pea aphid whole body normalized full le... 94 1e-16 2
(FF293769) 279297464 Pea aphid whole body normalized full le... 94 1e-16 2
(FF327153) 280432728 Pea aphid whole body normalized full le... 94 1e-16 2
(FF293615) 279294571 Pea aphid whole body normalized full le... 94 1e-16 2
(FF332263) 280450800 Pea aphid whole body normalized full le... 94 1e-16 2
(BP536322) Acyrthosiphon pisum cDNA clone:BCA011076, 5 prime... 94 1e-16 2
(FF293105) 279293689 Pea aphid whole body normalized full le... 94 1e-16 2
(EX627299) 255443914 Pea aphid whole body normalized full le... 94 1e-16 2
(EK126748) 1092987100309 Global-Ocean-Sampling_GS-31-01-01-1... 48 1e-16 5
(EJ870699) 1093018345130 Global-Ocean-Sampling_GS-30-02-01-1... 72 1e-16 2
(EJ832301) 1093017585054 Global-Ocean-Sampling_GS-30-02-01-1... 72 2e-16 2
(EJ236263) 1092432900687 Global-Ocean-Sampling_GS-27-01-01-1... 98 2e-16 2
(ER369439) 1093022169276 Global-Ocean-Sampling_GS-34-01-01-1... 80 2e-16 2
(EJ374504) 1092963736297 Global-Ocean-Sampling_GS-28-01-01-1... 66 2e-16 4
(ER509106) 1093015433405 Global-Ocean-Sampling_GS-35-01-01-1... 54 2e-16 5
(EJ734865) 1092961091904 Global-Ocean-Sampling_GS-30-02-01-1... 50 2e-16 4
(EK066714) 1092960132458 Global-Ocean-Sampling_GS-31-01-01-1... 56 3e-16 3
(EK284680) 1095462308894 Global-Ocean-Sampling_GS-31-01-01-1... 80 3e-16 3
(ER570523) 1093015790599 Global-Ocean-Sampling_GS-36-01-01-2... 64 3e-16 3
(EJ414109) 1093012169809 Global-Ocean-Sampling_GS-28-01-01-1... 60 4e-16 3
(BW655255) Glycine max cDNA clone: GMFL01-08-A12, 5'end, sim... 100 4e-16 1
(EK434088) 1095518005728 Global-Ocean-Sampling_GS-31-01-01-1... 82 5e-16 2
(FF044021) 408668_1118_1038 Pythium ultimum ESTs Pythium ult... 78 5e-16 3
(DT616358) ACAH-aaa65c01.g1 Hydra_EST_UCI-10 Hydra magnipapi... 66 7e-16 4
(EJ441611) 1093015306570 Global-Ocean-Sampling_GS-28-01-01-1... 68 7e-16 2
(DT616518) ACAH-aaa15d06.g1 Hydra_EST_UCI-10 Hydra magnipapi... 66 7e-16 4
(DN814770) ACAC-aac42e22.g1 Hydra EST UCI 7 Hydra magnipapil... 66 7e-16 4
(FE991080) 153906_1467_2290 Pythium ultimum ESTs Pythium ult... 78 8e-16 2
(FF025667) 326069_1412_1301 Pythium ultimum ESTs Pythium ult... 78 8e-16 2
(FF037083) 377656_1659_1987 Pythium ultimum ESTs Pythium ult... 78 8e-16 2
(FF059215) 494367_1273_3085 Pythium ultimum ESTs Pythium ult... 78 8e-16 2
(EK364287) 1095469390714 Global-Ocean-Sampling_GS-31-01-01-1... 66 1e-15 4
(FC695572) CAXX5048.fwd CAXX Lottia gigantea from male gonad... 82 1e-15 3
(CO513030) s13dSG09G1100084_121986 Glandular trichomes Medic... 96 1e-15 2
(AF288090) Rhodomonas salina mitochondrial DNA, complete gen... 80 1e-15 5
(EK074698) 1092961022526 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-15 3
(AP007820) Lotus japonicus genomic DNA, chromosome 6, clone:... 98 2e-15 1
(EK479892) 1095469511065 Global-Ocean-Sampling_GS-32-01-01-1... 48 2e-15 4
(ER483640) 1093015282615 Global-Ocean-Sampling_GS-35-01-01-1... 82 2e-15 3
(EJ490788) 1095403534633 Global-Ocean-Sampling_GS-28-01-01-1... 90 2e-15 3
(EL908437) INIT2_25_B11.b1_A006 G5 trophont cDNA (INIT2) Ich... 82 2e-15 3
(EJ354097) 1092963618892 Global-Ocean-Sampling_GS-28-01-01-1... 74 2e-15 4
(EJ194686) 1092344226980 Global-Ocean-Sampling_GS-27-01-01-1... 94 2e-15 2
(DW252505) UI-S-GB1-aag-e-23-0-UI.s1 UI-S-GB1 Euprymna scolo... 94 2e-15 2
(ER592287) 1093016203655 Global-Ocean-Sampling_GS-36-01-01-2... 68 2e-15 2
(EJ247758) 1095339010650 Global-Ocean-Sampling_GS-27-01-01-1... 42 2e-15 5
(EL908367) INIT2_24_C10.g1_A006 G5 trophont cDNA (INIT2) Ich... 82 4e-15 3
(DY605661) IMMUNEF045825A23 POSSUM_01-C-POSSUM-IMMUNE-2KB Tr... 80 5e-15 3
(EJ051999) 1095456003785 Global-Ocean-Sampling_GS-26-01-01-1... 54 5e-15 3
(EJ023454) 1095454011294 Global-Ocean-Sampling_GS-26-01-01-1... 76 5e-15 3
(EK302966) 1095462371076 Global-Ocean-Sampling_GS-31-01-01-1... 64 6e-15 3
(DY614197) IMMUNEF045805K15 POSSUM_01-C-POSSUM-IMMUNE-2KB Tr... 80 6e-15 3
(EJ103280) 1092343128043 Global-Ocean-Sampling_GS-27-01-01-1... 56 6e-15 4
(EK275441) 1095462274492 Global-Ocean-Sampling_GS-31-01-01-1... 58 6e-15 3
(ER560797) 1093015744018 Global-Ocean-Sampling_GS-36-01-01-2... 96 7e-15 1
(EK517859) 1095515506665 Global-Ocean-Sampling_GS-32-01-01-1... 72 8e-15 2
(AF287134) Ochromonas danica mitochondrial DNA, complete gen... 78 8e-15 4
(EJ084552) 1095460090859 Global-Ocean-Sampling_GS-26-01-01-1... 72 9e-15 4
(FF481985) G613P6321RE12.T0 Acorn worm blastula/gastrula pCM... 68 9e-15 4
(ER538833) 1093015892143 Global-Ocean-Sampling_GS-35-01-01-1... 74 1e-14 3
(EJ168087) 1092344073093 Global-Ocean-Sampling_GS-27-01-01-1... 84 2e-14 2
(EK102448) 1092963025918 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-14 4
(EJ733017) 1092960197326 Global-Ocean-Sampling_GS-30-02-01-1... 72 2e-14 3
(EJ948108) 1093018925068 Global-Ocean-Sampling_GS-30-02-01-1... 58 2e-14 4
(EJ661475) 1092955025487 Global-Ocean-Sampling_GS-30-02-01-1... 72 2e-14 3
(EK285478) 1095462311143 Global-Ocean-Sampling_GS-31-01-01-1... 94 3e-14 1
(CR925677) Ehrlichia ruminantium str. Gardel, complete genome. 94 3e-14 1
(ER501922) 1093015403492 Global-Ocean-Sampling_GS-35-01-01-1... 62 3e-14 2
(EJ686591) 1092955185942 Global-Ocean-Sampling_GS-30-02-01-1... 74 3e-14 4
(EK350594) 1095467926519 Global-Ocean-Sampling_GS-31-01-01-1... 66 3e-14 2
(EK059728) 1092960066798 Global-Ocean-Sampling_GS-31-01-01-1... 62 4e-14 3
(EK215114) 1095460116168 Global-Ocean-Sampling_GS-31-01-01-1... 58 6e-14 3
(EK120413) 1092963361159 Global-Ocean-Sampling_GS-31-01-01-1... 64 7e-14 4
(EJ942186) 1093018894386 Global-Ocean-Sampling_GS-30-02-01-1... 70 8e-14 3
(BI773130) kq46d04.y1 TBN95TM-SSR Strongyloides stercoralis ... 70 9e-14 3
(ER406750) 1095366020115 Global-Ocean-Sampling_GS-34-01-01-1... 76 9e-14 3
(EK352740) 1095468097793 Global-Ocean-Sampling_GS-31-01-01-1... 92 1e-13 1
(ES401019) MUT02-H22.x1d-t SHGC-MUT Mytilus californianus cD... 64 1e-13 4
(EJ639250) 1093010386616 Global-Ocean-Sampling_GS-29-01-01-1... 74 1e-13 2
(EJ843030) 1093017842716 Global-Ocean-Sampling_GS-30-02-01-1... 66 1e-13 2
(EJ416700) 1093012187888 Global-Ocean-Sampling_GS-28-01-01-1... 74 1e-13 3
(ER482843) 1093015277645 Global-Ocean-Sampling_GS-35-01-01-1... 60 1e-13 2
(EJ064115) 1095458019628 Global-Ocean-Sampling_GS-26-01-01-1... 90 1e-13 2
(FF002708) 216974_1629_2208 Pythium ultimum ESTs Pythium ult... 70 2e-13 2
(ER506669) 1093015423974 Global-Ocean-Sampling_GS-35-01-01-1... 66 3e-13 3
(CT806559) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 3e-13 3
(EJ689429) 1092955257433 Global-Ocean-Sampling_GS-30-02-01-1... 74 3e-13 3
(EJ381945) 1092963764955 Global-Ocean-Sampling_GS-28-01-01-1... 58 3e-13 3
(EK126230) 1092984401080 Global-Ocean-Sampling_GS-31-01-01-1... 56 4e-13 5
(CO746467) tah90g09.y1 Hydra EST UCI 5 Hydra magnipapillata ... 66 4e-13 3
(EK441830) 1092214977049 Global-Ocean-Sampling_GS-32-01-01-1... 86 4e-13 2
(DV036100) BRS1591 storage root cDNA library Ipomoea batatas... 90 4e-13 1
(CF448947) EST685292 normalized cDNA library of onion Allium... 90 4e-13 1
(EK190969) 1095460018494 Global-Ocean-Sampling_GS-31-01-01-1... 76 5e-13 2
(EJ660110) 1092955020575 Global-Ocean-Sampling_GS-30-02-01-1... 74 5e-13 2
(EK071019) 1092960192431 Global-Ocean-Sampling_GS-31-01-01-1... 64 5e-13 2
(EJ652169) 1092954004948 Global-Ocean-Sampling_GS-30-02-01-1... 74 5e-13 2
(EK288581) 1095462321012 Global-Ocean-Sampling_GS-31-01-01-1... 70 5e-13 2
(DN246369) ACAE-aaa28p17.g1 Hydra EST UCI 5 Hydra magnipapil... 66 5e-13 3
(EK441608) 1092214954697 Global-Ocean-Sampling_GS-32-01-01-1... 86 5e-13 2
(CF657092) tac68g08.y1 Hydra EST -IV Hydra magnipapillata cD... 66 5e-13 3
(EK442031) 1092215019499 Global-Ocean-Sampling_GS-32-01-01-1... 86 6e-13 2
(EK090523) 1092961215375 Global-Ocean-Sampling_GS-31-01-01-1... 64 6e-13 2
(AW696900) NF111H10ST1F1091 Developing stem Medicago truncat... 82 6e-13 3
(DT612092) ACAG-aab12d09.g1 Hydra_EST_UCI-9 Hydra magnipapil... 66 6e-13 3
(DT608650) ACAG-aaa26g06.g1 Hydra_EST_UCI-9 Hydra magnipapil... 66 6e-13 3
(GE382019) 292380169 Nasonia vitripennis Male Pupae Nasonia ... 58 7e-13 2
(DN812958) ACAC-aac47j11.g1 Hydra EST UCI 7 Hydra magnipapil... 66 7e-13 3
(CU440068) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 66 9e-13 4
(EK010586) 1092955170857 Global-Ocean-Sampling_GS-31-01-01-1... 58 1e-12 2
(ER626243) 1093018204172 Global-Ocean-Sampling_GS-36-01-01-2... 56 1e-12 3
(EK440101) 1095522071804 Global-Ocean-Sampling_GS-31-01-01-1... 72 1e-12 4
(EK416977) 1095515470896 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-12 3
(ER416629) 1092963673943 Global-Ocean-Sampling_GS-35-01-01-1... 88 2e-12 1
(DN502199) V058E04.5pR Populus male catkins cDNA library Pop... 88 2e-12 1
(DB897654) Populus nigra mRNA, clone: PnFL2-028_E02, 3'end. 88 2e-12 1
(DB880520) Populus nigra mRNA, clone: PnFL2-034_F19, 5'end. 88 2e-12 1
(DB879457) Populus nigra mRNA, clone: PnFL2-028_E02, 5'end. 88 2e-12 1
(BU879300) V058E04 Populus flower cDNA library Populus trich... 88 2e-12 1
(CV565144) taj72c02.y1 Hydra EST UCI 6 Hydra magnipapillata ... 64 2e-12 3
(EJ320362) 1095403357836 Global-Ocean-Sampling_GS-27-01-01-1... 62 2e-12 2
(EJ105803) 1092343136705 Global-Ocean-Sampling_GS-27-01-01-1... 68 2e-12 2
(EJ211300) 1092347003235 Global-Ocean-Sampling_GS-27-01-01-1... 68 2e-12 2
(EJ370367) 1092963722483 Global-Ocean-Sampling_GS-28-01-01-1... 72 2e-12 2
(BU909267) AGENCOURT_10481272 NICHD_XGC_Emb1 Xenopus laevis ... 50 3e-12 4
(EJ456422) 1093017489313 Global-Ocean-Sampling_GS-28-01-01-1... 56 4e-12 3
(EJ879976) 1093018391688 Global-Ocean-Sampling_GS-30-02-01-1... 78 4e-12 4
(EK387487) 1095469488647 Global-Ocean-Sampling_GS-31-01-01-1... 58 4e-12 4
(EK437991) 1095521106784 Global-Ocean-Sampling_GS-31-01-01-1... 60 4e-12 3
(EJ240140) 1095328032406 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-12 3
(EG579676) AGENCOURT_89900307 NICHD_XGC_int_m Xenopus laevis... 50 5e-12 4
>(U02291) Dictyostelium discoideum mitochondrial NADH:ubiquinone
oxidoreductase 80 kDa subunit gene, complete cds and
chain 5 gene, partial cds.
Length = 3343
Score = 731 bits (369), Expect(3) = 0.0
Identities = 372/373 (99%)
Strand = Plus / Plus
Query: 706 tgtaatgattgaaagtgaattatccggaaatatcattgatttatgtcctgtaggagcatt 765
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1158 tgtaatgattgaaagtgaattatccggaaatatcattgatttatgtcctgtaggagcatt 1217
Query: 766 aacatccgcagtttatgcctataaaggacgaccttgggaattaaaaaatataaaaggaat 825
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1218 aacatccgcagtttatgcctataaaggacgaccttgggaattaaaaaatataaaaggaat 1277
Query: 826 cgatatctttgatactttattaacaccaatcaattatcaagtaaaaggaggagaaatctt 885
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1278 cgatatctttgatactttattaacaccaatcaattatcaagtaaaaggaggagaaatctt 1337
Query: 886 taggatattaccaagaataaatgatagaatcaatgaagaatggattacagataaagtaag 945
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1338 taggatattaccaagaataaatgatagaatcaatgaagaatggattacagataaagtaag 1397
Query: 946 atttcattatgaaagttataaaattatcgaaaaaataagaaaggaaacaccaagttataa 1005
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1398 atttcattatgaaagttataaaattatcgaaaaaataagaaaggaaacaccaagttataa 1457
Query: 1006 aatacaagcaaataaatttatagaattaagttggaaaaccgcattaaaaatggtatttaa 1065
||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||
Sbjct: 1458 aatacaagcaaataaatttatagaattaacttggaaaaccgcattaaaaatggtatttaa 1517
Query: 1066 agtgttattaaat 1078
|||||||||||||
Sbjct: 1518 agtgttattaaat 1530
Score = 676 bits (341), Expect(3) = 0.0
Identities = 341/341 (100%)
Strand = Plus / Plus
Query: 194 gaagatataacaatattacaagcgtgtacggcaaatggaatagaaatcccacgattttgt 253
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 646 gaagatataacaatattacaagcgtgtacggcaaatggaatagaaatcccacgattttgt 705
Query: 254 tatcatgaaaagttaacaatagcaggaaattgtcgaatgtgtttagtatatgttacaaat 313
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 706 tatcatgaaaagttaacaatagcaggaaattgtcgaatgtgtttagtatatgttacaaat 765
Query: 314 gaagaaaaattattagccgcttgtggaataccgttagatgagaattttgacgatgaaagt 373
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 766 gaagaaaaattattagccgcttgtggaataccgttagatgagaattttgacgatgaaagt 825
Query: 374 atagaaacggaaatagatgaaatattaaaagcaagagaaggagtaatggaatttttatta 433
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 826 atagaaacggaaatagatgaaatattaaaagcaagagaaggagtaatggaatttttatta 885
Query: 434 ataaatcatccattagattgtccaatttgtgatcaaggaggagaatgtgatttacaagag 493
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 886 ataaatcatccattagattgtccaatttgtgatcaaggaggagaatgtgatttacaagag 945
Query: 494 caaacactagcgtatggattagatactggaagattttatat 534
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 946 caaacactagcgtatggattagatactggaagattttatat 986
Score = 418 bits (211), Expect(10) = 0.0
Identities = 211/211 (100%)
Strand = Plus / Plus
Query: 1524 taggaccaagtttattaactagaatttcattaacattacaagaaatgcgagcgattttca 1583
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1973 taggaccaagtttattaactagaatttcattaacattacaagaaatgcgagcgattttca 2032
Query: 1584 tgaaagcatgtaatttaaaaccagaaaatatattaataataacacaaggagcaaattttg 1643
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2033 tgaaagcatgtaatttaaaaccagaaaatatattaataataacacaaggagcaaattttg 2092
Query: 1644 gaatggcattagaagaaggactatttaaagaaaagtttagtataggaggaaatgtcttat 1703
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2093 gaatggcattagaagaaggactatttaaagaaaagtttagtataggaggaaatgtcttat 2152
Query: 1704 atagtatagatagtaatgaagtacaagtaac 1734
|||||||||||||||||||||||||||||||
Sbjct: 2153 atagtatagatagtaatgaagtacaagtaac 2183
Score = 357 bits (180), Expect(10) = 0.0
Identities = 180/180 (100%)
Strand = Plus / Plus
Query: 1194 tttaatgtttaaaaaatttaattatgatttaagagaaaattatattaatagtaatgattt 1253
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1644 tttaatgtttaaaaaatttaattatgatttaagagaaaattatattaatagtaatgattt 1703
Query: 1254 atataatgttgataaaaatgatttagtattattatgtggaataaatttacgagtggaaag 1313
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1704 atataatgttgataaaaatgatttagtattattatgtggaataaatttacgagtggaaag 1763
Query: 1314 tcctttactaaatataaaattaagaaatgtaaattttggtgatgatgaaatagaatctgt 1373
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1764 tcctttactaaatataaaattaagaaatgtaaattttggtgatgatgaaatagaatctgt 1823
Score = 325 bits (164), Expect(10) = 0.0
Identities = 164/164 (100%)
Strand = Plus / Plus
Query: 1795 cgatttatatttaccaagtaaacattattttgaagattttgaaggagatagagaagttta 1854
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2244 cgatttatatttaccaagtaaacattattttgaagattttgaaggagatagagaagttta 2303
Query: 1855 tatgaatacttttggacaacgaagtgaaattgagaaattaagcataagtaaaggaaataa 1914
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2304 tatgaatacttttggacaacgaagtgaaattgagaaattaagcataagtaaaggaaataa 2363
Query: 1915 aataaaagaaaatagcatgattggatatatccaattaatgtatt 1958
||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2364 aataaaagaaaatagcatgattggatatatccaattaatgtatt 2407
Score = 307 bits (155), Expect(3) = 0.0
Identities = 155/155 (100%)
Strand = Plus / Plus
Query: 543 gagcagtagaaataaaaacatttggacgattaataaaaggaataatgacgagatgtattc 602
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 995 gagcagtagaaataaaaacatttggacgattaataaaaggaataatgacgagatgtattc 1054
Query: 603 attgtacacgatgtgtaagatttttaacagaaatagcaggtgtaaatgaattaggagttt 662
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1055 attgtacacgatgtgtaagatttttaacagaaatagcaggtgtaaatgaattaggagttt 1114
Query: 663 taggtagaggttataatatggaaataggaacttat 697
|||||||||||||||||||||||||||||||||||
Sbjct: 1115 taggtagaggttataatatggaaataggaacttat 1149
Score = 236 bits (119), Expect(10) = 0.0
Identities = 119/119 (100%)
Strand = Plus / Plus
Query: 1 gcgaaaagtcagaggttcgaatcctctttaggagaatgaaattttgagggtatagcttaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 453 gcgaaaagtcagaggttcgaatcctctttaggagaatgaaattttgagggtatagcttaa 512
Query: 61 gtggttagagtattggattgtgacttcaaagataccggttcgagtccggttaccttccc 119
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 513 gtggttagagtattggattgtgacttcaaagataccggttcgagtccggttaccttccc 571
Score = 222 bits (112), Expect(10) = 0.0
Identities = 112/112 (100%)
Strand = Plus / Plus
Query: 1382 taggaattattggaaataaatttgattggaaacacgaaagtgaatatataggagcaacct 1441
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1832 taggaattattggaaataaatttgattggaaacacgaaagtgaatatataggagcaacct 1891
Query: 1442 taaatagtatgttaaaattatttgaaggacgattaccttattgtcaacaaat 1493
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1892 taaatagtatgttaaaattatttgaaggacgattaccttattgtcaacaaat 1943
Score = 63.9 bits (32), Expect(10) = 0.0
Identities = 32/32 (100%)
Strand = Plus / Plus
Query: 1164 ggaagtaaaaattatatcacagaaaatggttt 1195
||||||||||||||||||||||||||||||||
Sbjct: 1615 ggaagtaaaaattatatcacagaaaatggttt 1646
Score = 42.1 bits (21), Expect(10) = 0.0
Identities = 21/21 (100%)
Strand = Plus / Plus
Query: 1502 gcaaagcgcctttaattatag 1522
|||||||||||||||||||||
Sbjct: 1952 gcaaagcgcctttaattatag 1972
Score = 40.1 bits (20), Expect(10) = 0.0
Identities = 20/20 (100%)
Strand = Plus / Plus
Query: 1145 gaattaatgaatcgattagg 1164
||||||||||||||||||||
Sbjct: 1597 gaattaatgaatcgattagg 1616
Score = 34.2 bits (17), Expect(10) = 0.0
Identities = 17/17 (100%)
Strand = Plus / Plus
Query: 2137 gataaccggacaattaa 2153
|||||||||||||||||
Sbjct: 2586 gataaccggacaattaa 2602
Score = 26.3 bits (13), Expect(10) = 0.0
Identities = 13/13 (100%)
Strand = Plus / Plus
Query: 310 aaatgaagaaaaa 322
|||||||||||||
Sbjct: 633 aaatgaagaaaaa 645
Score = 63.9 bits (32), Expect(3) = 2e-06
Identities = 35/36 (97%)
Strand = Plus / Plus
Query: 1 gcgaaaagtcagaggttcgaatcctctttaggagaa 36
||||||||||||||||||||||||||||| ||||||
Sbjct: 380 gcgaaaagtcagaggttcgaatcctctttgggagaa 415
Score = 30.2 bits (15), Expect(3) = 2e-06
Identities = 15/15 (100%)
Strand = Plus / Plus
Query: 1008 tacaagcaaataaat 1022
|||||||||||||||
Sbjct: 3121 tacaagcaaataaat 3135
Score = 26.3 bits (13), Expect(3) = 2e-06
Identities = 13/13 (100%)
Strand = Plus / Plus
Query: 62 tggttagagtatt 74
|||||||||||||
Sbjct: 430 tggttagagtatt 442
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 2,487,276,503
Number of extensions: 160602487
Number of successful extensions: 15379374
Number of sequences better than 10.0: 1597
Length of query: 2153
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 2129
Effective length of database: 99,340,224,878
Effective search space: 211495338765262
Effective search space used: 211495338765262
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 7.28 |
| Homology vs Protein |
Query= Contig-U16566-1 (Contig-U16566-1Q) /CSM_Contig/Contig-U16566-1Q.Seq.d
(2153 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q2LCP5) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa sub... 590 0.0
AY700145_25(AY700145|pid:none) Polysphondylium pallidum mitochon... 457 0.0
EU275727_44(EU275727|pid:none) Dictyostelium fasciculatum strain... 444 0.0
(O21241) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa sub... 329 e-104
EU971455_1(EU971455|pid:none) Zea mays clone 365245 NADH-ubiquin... 308 5e-95
BT033543_1(BT033543|pid:none) Zea mays full-length cDNA clone ZM... 308 5e-95
BT054003_1(BT054003|pid:none) Zea mays full-length cDNA clone ZM... 308 5e-95
AC090882_26(AC090882|pid:none) Oryza sativa chromosome 3 BAC OSJ... 306 9e-94
(Q43644) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa sub... 310 1e-93
AB025630_5(AB025630|pid:none) Arabidopsis thaliana genomic DNA, ... 310 1e-93
EF677053_1(EF677053|pid:none) Picea sitchensis clone WS02760_O10... 308 4e-93
CP001333_287(CP001333|pid:none) Micromonas sp. RCC299 chromosome... 306 1e-92
BC049394_1(BC049394|pid:none) Xenopus laevis NADH dehydrogenase ... 314 1e-92
(Q0MQG2) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa sub... 305 2e-92
AB169274_1(AB169274|pid:none) Macaca fascicularis testis cDNA, c... 305 2e-92
(Q5R911) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa sub... 305 3e-92
CR954212_45(CR954212|pid:none) Ostreococcus tauri strain OTTH059... 307 6e-92
AJ720577_1(AJ720577|pid:none) Gallus gallus mRNA for hypothetica... 311 8e-92
BC030833_1(BC030833|pid:none) Homo sapiens NADH dehydrogenase (u... 304 8e-92
S17854(S17854;S16382) NADH2 dehydrogenase (ubiquinone) (EC 1.6.5... 305 1e-91
CR859585_1(CR859585|pid:none) Pongo abelii mRNA; cDNA DKFZp468M1... 303 1e-91
AY898628_32(AY898628|pid:none) Phytophthora infestans haplotype ... 291 3e-91
CR925677_440(CR925677|pid:none) Ehrlichia ruminantium str. Garde... 313 6e-90
CR767821_445(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 313 6e-90
L36813_1(L36813|pid:none) Neurospora crassa NADH dehydrogenase g... 297 1e-88
AM920437_1112(AM920437|pid:none) Penicillium chrysogenum Wiscons... 301 1e-88
(P24918) RecName: Full=NADH-ubiquinone oxidoreductase 78 kDa sub... 296 2e-88
Y09063_1(Y09063|pid:none) D.melanogaster mRNA for NADH:ubiquinon... 302 2e-88
CP000084_879(CP000084|pid:none) Candidatus Pelagibacter ubique H... 307 4e-88
(Q94511) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa sub... 300 9e-88
AY075015_1(AY075015|pid:none) Drosophila simulans strain NC48 NA... 300 9e-88
AY074996_1(AY074996|pid:none) Drosophila simulans strain DSR NAD... 300 9e-88
AY075007_1(AY075007|pid:none) Drosophila simulans strain RU07 NA... 300 9e-88
AY074994_1(AY074994|pid:none) Drosophila melanogaster strain Ore... 300 9e-88
S17664(S17664;S20224) NADH2 dehydrogenase (ubiquinone) (EC 1.6.5... 293 2e-87
AE017342_129(AE017342|pid:none) Cryptococcus neoformans var. neo... 299 7e-87
CR382139_267(CR382139|pid:none) Debaryomyces hansenii strain CBS... 293 3e-86
CP000449_1357(CP000449|pid:none) Maricaulis maris MCS10, complet... 290 3e-85
AE005673_1933(AE005673|pid:none) Caulobacter crescentus CB15, co... 289 6e-84
AP009384_1674(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 296 1e-83
EU651892_4(EU651892|pid:none) Hemiselmis andersenii strain CCMP ... 313 2e-83
CP000774_3203(CP000774|pid:none) Parvibaculum lavamentivorans DS... 312 4e-83
CP000030_440(CP000030|pid:none) Anaplasma marginale str. St. Mar... 311 5e-83
AE017321_372(AE017321|pid:none) Wolbachia endosymbiont strain TR... 311 5e-83
CP000158_1721(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 288 2e-82
CP000409_980(CP000409|pid:none) Rickettsia canadensis str. McKie... 287 4e-82
(Q9ZCF6) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 284 7e-82
CP001391_75(CP001391|pid:none) Wolbachia sp. wRi, complete genome. 306 2e-81
AE017196_143(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 306 2e-81
(Q68VV2) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 281 2e-81
FN392320_483(FN392320|pid:none) Pichia pastoris GS115 chromosome... 306 3e-81
AK034597_1(AK034597|pid:none) Mus musculus 12 days embryo embryo... 304 8e-81
AK167705_1(AK167705|pid:none) Mus musculus 12 days pregnant adul... 304 8e-81
AK146814_1(AK146814|pid:none) Mus musculus 16 days embryo heart ... 303 1e-80
AE006914_1231(AE006914|pid:none) Rickettsia conorii str. Malish ... 288 3e-80
(Q92G92) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 288 3e-80
AY367780_1(AY367780|pid:none) Chlamydomonas reinhardtii NADH:ubi... 302 3e-80
CP000235_654(CP000235|pid:none) Anaplasma phagocytophilum HZ, co... 301 5e-80
FN357385_11(FN357385|pid:none) Schistosoma mansoni genome sequen... 299 3e-79
CP000697_917(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 298 5e-79
CP000390_1020(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 298 7e-79
CP000237_51(CP000237|pid:none) Neorickettsia sennetsu strain Miy... 297 1e-78
CP001074_1659(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 296 2e-78
CP001622_1339(CP001622|pid:none) Rhizobium leguminosarum bv. tri... 296 2e-78
CP001191_1258(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 296 3e-78
CP001196_1898(CP001196|pid:none) Oligotropha carboxidovorans OM5... 296 3e-78
AP008981_1592(AP008981|pid:none) Orientia tsutsugamushi str. Ike... 295 4e-78
CP000758_2399(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 294 8e-78
AP007162_538(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 294 1e-77
CP000633_1266(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 293 1e-77
CP000524_737(CP000524|pid:none) Bartonella bacilliformis KC583, ... 293 1e-77
CP000699_2969(CP000699|pid:none) Sphingomonas wittichii RW1, com... 293 2e-77
BA000012_1071(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 293 2e-77
CP001389_1038(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 293 2e-77
CP000494_4281(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 293 2e-77
CP000230_1556(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 292 3e-77
BX897699_869(BX897699|pid:none) Bartonella henselae strain Houst... 292 4e-77
CP000738_891(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 292 4e-77
CP000781_4588(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 291 5e-77
AM260525_1076(AM260525|pid:none) Bartonella tribocorum CIP 10547... 291 5e-77
BX572602_175(BX572602|pid:none) Rhodopseudomonas palustris CGA00... 290 1e-76
CP000250_2571(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 290 1e-76
BA000040_4911(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 290 2e-76
CP000847_1126(CP000847|pid:none) Rickettsia akari str. Hartford,... 290 2e-76
AP007255_2781(AP007255|pid:none) Magnetospirillum magneticum AMB... 290 2e-76
CP000848_1201(CP000848|pid:none) Rickettsia rickettsii str. 'She... 288 6e-76
CP000613_1200(CP000613|pid:none) Rhodospirillum centenum SW, com... 288 7e-76
CP001612_929(CP001612|pid:none) Rickettsia africae ESF-5, comple... 287 1e-75
CP000463_2506(CP000463|pid:none) Rhodopseudomonas palustris BisA... 286 2e-75
CP000301_2383(CP000301|pid:none) Rhodopseudomonas palustris BisB... 286 2e-75
(Q1RKD2) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 286 2e-75
CP001001_2021(CP001001|pid:none) Methylobacterium radiotolerans ... 286 2e-75
CP000766_1240(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 286 2e-75
CP000849_1372(CP000849|pid:none) Rickettsia bellii OSU 85-389, c... 285 4e-75
CP000394_1296(CP000394|pid:none) Granulibacter bethesdensis CGDN... 285 5e-75
F97514(F97514)NADH-ubiquinone oxidoreductase chain 3 (NADH dehyd... 285 5e-75
CP000143_1113(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 284 8e-75
CP001150_835(CP001150|pid:none) Rhodobacter sphaeroides KD131 ch... 284 8e-75
CP001349_3958(CP001349|pid:none) Methylobacterium nodulans ORS 2... 284 1e-74
AJ249781_1(AJ249781|pid:none) Yarrowia lipolytica nuam gene for ... 283 1e-74
CP000031_2708(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 282 3e-74
CP000264_1183(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 281 7e-74
(P29915) RecName: Full=NADH-quinone oxidoreductase chain 3; ... 280 2e-73
CP000943_4150(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 280 2e-73
AY534144_1(AY534144|pid:none) Saprolegnia ferax strain ATCC 3605... 279 3e-73
CP000908_1054(CP000908|pid:none) Methylobacterium extorquens PA1... 279 3e-73
CP001510_797(CP001510|pid:none) Methylobacterium extorquens AM1,... 279 3e-73
CP001298_1126(CP001298|pid:none) Methylobacterium chloromethanic... 279 3e-73
CP000362_3047(CP000362|pid:none) Roseobacter denitrificans OCh 1... 277 1e-72
AK295966_1(AK295966|pid:none) Homo sapiens cDNA FLJ60586 complet... 235 3e-71
AF287134_3(AF287134|pid:none) Ochromonas danica mitochondrial DN... 271 5e-71
DQ186202_30(DQ186202|pid:none) Thalassiosira pseudonana mitochon... 271 5e-71
CP000116_1148(CP000116|pid:none) Thiobacillus denitrificans ATCC... 260 1e-67
CP000937_935(CP000937|pid:none) Francisella philomiragia subsp. ... 259 3e-67
CP000915_81(CP000915|pid:none) Francisella tularensis subsp. med... 255 4e-66
CP001339_975(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 255 4e-66
CP000608_83(CP000608|pid:none) Francisella tularensis subsp. tul... 255 4e-66
AM233362_1823(AM233362|pid:none) Francisella tularensis subsp. h... 255 5e-66
CP001025_2136(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 254 9e-66
AE017354_2725(AE017354|pid:none) Legionella pneumophila subsp. p... 254 9e-66
CP000450_895(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 253 2e-65
CP000941_244(CP000941|pid:none) Xylella fastidiosa M12, complete... 253 2e-65
CP000675_2956(CP000675|pid:none) Legionella pneumophila str. Cor... 253 2e-65
CR628337_2710(CR628337|pid:none) Legionella pneumophila str. Len... 253 2e-65
AP009385_2178(AP009385|pid:none) Burkholderia multivorans ATCC 1... 253 3e-65
CR628336_2835(CR628336|pid:none) Legionella pneumophila str. Par... 253 3e-65
CP000378_1620(CP000378|pid:none) Burkholderia cenocepacia AU 105... 252 4e-65
CP000958_2247(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 252 4e-65
AM747720_2334(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 252 4e-65
CP000010_1567(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 251 6e-65
CP000124_1427(CP000124|pid:none) Burkholderia pseudomallei 1710b... 251 6e-65
AL954747_1772(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 251 6e-65
CP000570_1289(CP000570|pid:none) Burkholderia pseudomallei 668 c... 251 6e-65
CP001408_1310(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 251 6e-65
AM260479_1045(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 251 6e-65
CP000270_1234(CP000270|pid:none) Burkholderia xenovorans LB400 c... 249 2e-64
CP000544_1728(CP000544|pid:none) Halorhodospira halophila SL1, c... 249 3e-64
CP000352_933(CP000352|pid:none) Ralstonia metallidurans CH34, co... 249 3e-64
CU633749_1014(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 249 3e-64
CR555306_2745(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 249 4e-64
CP000109_824(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 248 6e-64
AE013598_3158(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 247 1e-63
AM039952_2847(AM039952|pid:none) Xanthomonas campestris pv. vesi... 247 1e-63
AE008923_2652(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 247 1e-63
CP000967_3420(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 247 1e-63
AE016825_947(AE016825|pid:none) Chromobacterium violaceum ATCC 1... 247 1e-63
CP001132_2192(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 247 1e-63
CU914168_933(CU914168|pid:none) Ralstonia solanacearum strain IP... 246 2e-63
CP000381_1805(CP000381|pid:none) Neisseria meningitidis 053442, ... 245 4e-63
CP000539_947(CP000539|pid:none) Acidovorax sp. JS42, complete ge... 245 4e-63
CP001050_2147(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945... 245 4e-63
CP000316_3197(CP000316|pid:none) Polaromonas sp. JS666, complete... 244 7e-63
CP000529_1417(CP000529|pid:none) Polaromonas naphthalenivorans C... 243 2e-62
CP000512_1242(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 243 3e-62
CP001010_700(CP001010|pid:none) Polynucleobacter necessarius sub... 242 4e-62
CP001013_1499(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 242 5e-62
AM902716_1691(AM902716|pid:none) Bordetella petrii strain DSM 12... 241 6e-62
BX640433_163(BX640433|pid:none) Bordetella parapertussis strain ... 241 8e-62
BX640413_162(BX640413|pid:none) Bordetella pertussis strain Toha... 239 2e-61
DQ167764_1(DQ167764|pid:none) Drosophila erecta putative NADH:ub... 211 5e-61
DQ167767_1(DQ167767|pid:none) Drosophila teissieri putative NADH... 211 5e-61
CP000555_1409(CP000555|pid:none) Methylibium petroleiphilum PM1,... 238 9e-61
DQ167765_1(DQ167765|pid:none) Drosophila orena putative NADH:ubi... 209 2e-60
CP000267_1470(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 236 3e-60
DQ167766_1(DQ167766|pid:none) Drosophila simulans putative NADH:... 207 6e-60
CP000471_3585(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 232 5e-59
AE016828_1246(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 231 6e-59
CP000890_1386(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 231 6e-59
CP000733_510(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1... 231 6e-59
AP009247_226(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 228 9e-58
EF494739_23(EF494739|pid:none) Blastocystis sp. DMP/02-328 mitoc... 222 4e-56
AF288091_24(AF288091|pid:none) Thraustochytrium aureum mitochond... 219 2e-55
AY500368_35(AY500368|pid:none) Dictyota dichotoma mitochondrion,... 205 6e-51
AY500367_33(AY500367|pid:none) Desmarestia viridis mitochondrion... 195 5e-48
AY494079_32(AY494079|pid:none) Fucus vesiculosus mitochondrion, ... 195 5e-48
AJ344328_33(AJ344328|pid:none) Laminaria digitata complete mitoc... 195 7e-48
AF110139_2(AF110139|pid:none) Pilayella littoralis NADH:ubiquino... 192 6e-47
BX908798_565(BX908798|pid:none) Parachlamydia-related symbiont U... 190 2e-46
AP006840_1592(AP006840|pid:none) Symbiobacterium thermophilum IA... 184 9e-45
CP000473_113(CP000473|pid:none) Solibacter usitatus Ellin6076, c... 178 6e-43
CP001131_1272(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 176 2e-42
AP009493_2978(AP009493|pid:none) Streptomyces griseus subsp. gri... 176 4e-42
AF193903_32(AF193903|pid:none) Cafeteria roenbergensis mitochond... 174 9e-42
CP000769_1282(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 173 2e-41
AE010300_160(AE010300|pid:none) Leptospira interrogans serovar l... 173 2e-41
CP000348_2623(CP000348|pid:none) Leptospira borgpetersenii serov... 172 6e-41
CP000804_3300(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 171 1e-40
CP001100_1991(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 169 3e-40
CP000487_157(CP000487|pid:none) Campylobacter fetus subsp. fetus... 168 9e-40
CP000360_1306(CP000360|pid:none) Acidobacteria bacterium Ellin34... 166 4e-39
AY972100_8(AY972100|pid:none) Rhodothermus marinus strain PRQ 62... 165 7e-39
CP000850_4295(CP000850|pid:none) Salinispora arenicola CNS-205, ... 165 7e-39
CP001618_3201(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 164 2e-38
CP000667_4004(CP000667|pid:none) Salinispora tropica CNB-440, co... 161 1e-37
CP000481_271(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 160 1e-37
AM420293_6705(AM420293|pid:none) Saccharopolyspora erythraea NRR... 160 1e-37
CP000478_1935(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 160 1e-37
CP000431_5856(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 160 1e-37
CP000113_2659(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 160 2e-37
EF607211_1(EF607211|pid:none) Mycobacterium kansasii strain Haud... 158 7e-37
(Q89AU1) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 158 7e-37
CP000479_3888(CP000479|pid:none) Mycobacterium avium 104, comple... 158 9e-37
AE000516_3355(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 158 9e-37
(P95175) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 158 9e-37
CP000088_2682(CP000088|pid:none) Thermobifida fusca YX, complete... 157 2e-36
CT573213_1006(CT573213|pid:none) Frankia alni str. ACN14A chromo... 156 3e-36
CP000384_1563(CP000384|pid:none) Mycobacterium sp. MCS, complete... 155 6e-36
CP000482_1603(CP000482|pid:none) Pelobacter propionicus DSM 2379... 155 7e-36
BX842654_194(BX842654|pid:none) Bdellovibrio bacteriovorus compl... 155 7e-36
CP000325_2033(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 155 7e-36
CP000249_533(CP000249|pid:none) Frankia sp. CcI3, complete genome. 155 7e-36
CP000698_4163(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 154 1e-35
CP000361_299(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 154 1e-35
CP000133_3693(CP000133|pid:none) Rhizobium etli CFN 42, complete... 154 2e-35
CP000383_1354(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 154 2e-35
CP001157_2753(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 154 2e-35
AE017180_3419(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 152 4e-35
(P56914) RecName: Full=NADH-quinone oxidoreductase subunit G 2; ... 152 5e-35
CP000521_786(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 151 8e-35
AM502236_147(AM502236|pid:none) Leishmania infantum chromosome 18. 151 1e-34
AM181176_3738(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 151 1e-34
CR543861_655(CR543861|pid:none) Acinetobacter sp. ADP1 complete ... 151 1e-34
AE017180_343(AE017180|pid:none) Geobacter sulfurreducens PCA, co... 150 1e-34
AP010872_46(AP010872|pid:none) Candidatus Ishikawaella capsulata... 150 1e-34
AM494955_151(AM494955|pid:none) Leishmania braziliensis chromoso... 150 1e-34
CP000744_2532(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 150 2e-34
CP000438_2397(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 150 2e-34
CP001124_654(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 150 2e-34
FM209186_2462(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 150 2e-34
CP001389_2162(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 150 2e-34
CP000739_42(CP000739|pid:none) Sinorhizobium medicae WSM419 plas... 150 2e-34
CP000082_589(CP000082|pid:none) Psychrobacter arcticus 273-4, co... 149 4e-34
CP000076_3851(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 149 5e-34
(Q87ZQ4) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 148 7e-34
CP000058_2972(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 148 7e-34
CP001616_2609(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 147 1e-33
CP000926_3671(CP000926|pid:none) Pseudomonas putida GB-1, comple... 147 1e-33
CP000026_504(CP000026|pid:none) Salmonella enterica subsp. enter... 147 2e-33
AM933173_2272(AM933173|pid:none) Salmonella enterica subsp. ente... 146 3e-33
CP001138_2302(CP001138|pid:none) Salmonella enterica subsp. ente... 146 3e-33
AE014613_513(AE014613|pid:none) Salmonella enterica subsp. enter... 146 3e-33
CP000857_1353(CP000857|pid:none) Salmonella enterica subsp. ente... 146 3e-33
L22504_4(L22504|pid:none) Salmonella typhimurium NADH dehydrogen... 146 3e-33
CP000886_637(CP000886|pid:none) Salmonella enterica subsp. enter... 146 3e-33
AE017220_2323(AE017220|pid:none) Salmonella enterica subsp. ente... 146 3e-33
CP001127_2383(CP001127|pid:none) Salmonella enterica subsp. ente... 146 3e-33
CP001144_2438(CP001144|pid:none) Salmonella enterica subsp. ente... 146 3e-33
AE006468_2260(AE006468|pid:none) Salmonella enterica subsp. ente... 146 3e-33
(P0A1Y4) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 146 3e-33
BX950851_2998(BX950851|pid:none) Erwinia carotovora subsp. atros... 146 3e-33
CP000970_2364(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 145 5e-33
(Q8XCX2) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 145 5e-33
(Q7UC56) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 145 5e-33
AE017283_1884(AE017283|pid:none) Propionibacterium acnes KPA1712... 145 5e-33
CP001390_459(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 145 5e-33
CU928158_835(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 145 5e-33
(Q8FFJ9) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 145 5e-33
CU928162_2687(CU928162|pid:none) Escherichia coli ED1a chromosom... 145 5e-33
AM942759_1740(AM942759|pid:none) Proteus mirabilis strain HI4320... 145 5e-33
A65000(A65000;S65638;S38316;S37064) NADH2 dehydrogenase (ubiquin... 145 5e-33
AE014075_2753(AE014075|pid:none) Escherichia coli CFT073, comple... 145 5e-33
CP000232_2258(CP000232|pid:none) Moorella thermoacetica ATCC 390... 145 5e-33
FP236842_1265(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 145 5e-33
CP000038_2188(CP000038|pid:none) Shigella sonnei Ss046, complete... 145 5e-33
CP001063_2283(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 145 5e-33
CP000034_2313(CP000034|pid:none) Shigella dysenteriae Sd197, com... 145 5e-33
CU651637_2208(CU651637|pid:none) Escherichia coli LF82 chromosom... 145 5e-33
CU468135_1209(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 145 5e-33
(P33602) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 145 5e-33
AE000513_1472(AE000513|pid:none) Deinococcus radiodurans R1 chro... 145 5e-33
X68301_7(X68301|pid:none) E.coli DNA sequence of nuo operon. 145 6e-33
CP000647_2629(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 145 6e-33
AM398681_2162(AM398681|pid:none) Flavobacterium psychrophilum JI... 145 6e-33
CP001654_2503(CP001654|pid:none) Dickeya dadantii Ech703, comple... 145 6e-33
CP000964_1444(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 145 6e-33
CP000653_2802(CP000653|pid:none) Enterobacter sp. 638, complete ... 145 6e-33
DQ780208_1(DQ780208|pid:none) Endoriftia persephone 'Hot96_1+Hot... 145 6e-33
CP001277_1448(CP001277|pid:none) Candidatus Hamiltonella defensa... 145 8e-33
(Q56223) RecName: Full=NADH-quinone oxidoreductase subunit 3; ... 144 1e-32
CU928164_2415(CU928164|pid:none) Escherichia coli IAI39 chromoso... 144 1e-32
T11904(T11904) NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) cha... 144 1e-32
CP000822_490(CP000822|pid:none) Citrobacter koseri ATCC BAA-895,... 144 1e-32
CP000285_3106(CP000285|pid:none) Chromohalobacter salexigens DSM... 144 1e-32
(Q8EI34) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 144 2e-32
BX936398_2580(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 143 2e-32
AP010904_1338(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 143 2e-32
CP000720_1433(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 143 2e-32
(Q8ZDL2) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 143 2e-32
CP001089_648(CP001089|pid:none) Geobacter lovleyi SZ, complete g... 143 3e-32
CP000961_2839(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 143 3e-32
CP001114_555(CP001114|pid:none) Deinococcus deserti VCD115, comp... 142 4e-32
CP000103_1012(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 142 7e-32
CP000148_2987(CP000148|pid:none) Geobacter metallireducens GS-15... 142 7e-32
AB171341_1(AB171341|pid:none) Macaca fascicularis brain cDNA clo... 110 7e-32
CP000448_1770(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 141 9e-32
AP008232_1596(AP008232|pid:none) Sodalis glossinidius str. 'mors... 141 9e-32
CP000698_3574(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 140 1e-31
EF659944_1(EF659944|pid:none) Bartonella vinsonii subsp. vinsoni... 140 2e-31
EF659936_1(EF659936|pid:none) Bartonella vinsonii subsp. arupens... 140 2e-31
AP009389_2646(AP009389|pid:none) Pelotomaculum thermopropionicum... 140 2e-31
EF659940_1(EF659940|pid:none) Bartonella elizabethae NADH dehydr... 140 2e-31
CP000016_473(CP000016|pid:none) Candidatus Blochmannia pennsylva... 139 3e-31
BX571869_121(BX571869|pid:none) Photorhabdus luminescens subsp. ... 139 3e-31
CP000612_1828(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 139 6e-31
EF659941_1(EF659941|pid:none) Bartonella grahamii NADH dehydroge... 139 6e-31
EF659937_1(EF659937|pid:none) Bartonella vinsonii subsp. berkhof... 139 6e-31
EF659942_1(EF659942|pid:none) Bartonella koehlerae NADH dehydrog... 139 6e-31
EF659945_1(EF659945|pid:none) Bartonella washoensis NADH dehydro... 137 1e-30
AM889285_2466(AM889285|pid:none) Gluconacetobacter diazotrophicu... 137 1e-30
EF659939_1(EF659939|pid:none) Bartonella clarridgeiae NADH dehyd... 136 4e-30
AJ871573_1(AJ871573|pid:none) Nyctotherus ovalis nuoG gene for p... 135 5e-30
AE017282_1275(AE017282|pid:none) Methylococcus capsulatus str. B... 134 2e-29
CP000283_1329(CP000283|pid:none) Rhodopseudomonas palustris BisB... 133 3e-29
(Q7VRV7) RecName: Full=NADH-quinone oxidoreductase subunit G; ... 132 4e-29
CP001034_100(CP001034|pid:none) Natranaerobius thermophilus JW/N... 132 4e-29
CP000463_1703(CP000463|pid:none) Rhodopseudomonas palustris BisA... 130 2e-28
AY458641_79(AY458641|pid:none) Uncultured marine bacterium 463 c... 129 4e-28
CP001096_4666(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 129 6e-28
CP001150_1421(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 128 7e-28
CP000143_1712(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 128 7e-28
CP000661_1675(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 128 1e-27
CP000577_1731(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 128 1e-27
CP000250_1350(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 127 1e-27
CP000153_1815(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 125 5e-27
AJ312125_2(AJ312125|pid:none) Eubacterium acidaminophilum fdhB-I... 124 2e-26
CP001229_443(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 123 2e-26
AM746676_527(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ... 123 3e-26
AP009178_294(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 121 9e-26
CP000724_3937(CP000724|pid:none) Alkaliphilus metalliredigens QY... 121 1e-25
AP009179_2226(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 120 3e-25
CP000478_3476(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 119 6e-25
CP000448_747(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 117 1e-24
CP001080_710(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 117 2e-24
CP001130_422(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 116 4e-24
AP008971_1152(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 115 9e-24
AP008230_3969(AP008230|pid:none) Desulfitobacterium hafniense Y5... 114 1e-23
CP000478_2679(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 114 2e-23
BX571658_118(BX571658|pid:none) Wolinella succinogenes, complete... 113 3e-23
CP001336_3723(CP001336|pid:none) Desulfitobacterium hafniense DC... 113 3e-23
AP008230_2616(AP008230|pid:none) Desulfitobacterium hafniense Y5... 112 4e-23
CP000448_972(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 112 6e-23
EU306860_1(EU306860|pid:none) Drosophila silvestris clone sv3E-X... 110 2e-22
CP001322_2540(CP001322|pid:none) Desulfatibacillum alkenivorans ... 109 4e-22
CP000252_142(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 107 1e-21
CP000153_1814(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 107 2e-21
AJ312125_1(AJ312125|pid:none) Eubacterium acidaminophilum fdhB-I... 105 9e-21
CP001034_697(CP001034|pid:none) Natranaerobius thermophilus JW/N... 104 2e-20
AY214929_5(AY214929|pid:none) Thiocapsa roseopersicina N-acetyl-... 103 3e-20
CP001348_2252(CP001348|pid:none) Clostridium cellulolyticum H10,... 103 3e-20
CP000853_2213(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 102 6e-20
CP000975_1223(CP000975|pid:none) Methylacidiphilum infernorum V4... 102 6e-20
CP000633_3003(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 102 8e-20
L25055_4(L25055|pid:none) Escherichia coli NADH dehydrogenase (n... 101 1e-19
CP001078_1966(CP001078|pid:none) Clostridium botulinum E3 str. A... 101 1e-19
CP001616_1488(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 101 1e-19
CP000776_173(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 101 1e-19
CP000252_1078(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 101 1e-19
CP001098_180(CP001098|pid:none) Halothermothrix orenii H 168, co... 100 2e-19
BA000040_3136(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 100 3e-19
AP008971_1154(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 100 3e-19
CP001389_3019(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 100 4e-19
CP000860_1481(CP000860|pid:none) Candidatus Desulforudis audaxvi... 100 4e-19
CP000270_3444(CP000270|pid:none) Burkholderia xenovorans LB400 c... 99 6e-19
CP000697_829(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 99 8e-19
AL591688_3019(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 99 8e-19
CP000480_154(CP000480|pid:none) Mycobacterium smegmatis str. MC2... 99 8e-19
AF298190_5(AF298190|pid:none) Sinorhizobium meliloti putative tr... 98 1e-18
CP001080_30(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1,... 98 1e-18
CP000449_2674(CP000449|pid:none) Maricaulis maris MCS10, complet... 98 1e-18
CP000884_1854(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 98 1e-18
CP000699_1464(CP000699|pid:none) Sphingomonas wittichii RW1, com... 97 2e-18
CP001074_4079(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 97 2e-18
CP000301_4588(CP000301|pid:none) Rhodopseudomonas palustris BisB... 97 2e-18
CP000680_387(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 97 2e-18
AM260479_638(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 97 2e-18
CP001280_3556(CP001280|pid:none) Methylocella silvestris BL2, co... 97 2e-18
CP000083_2004(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 97 2e-18
CP000570_2865(CP000570|pid:none) Burkholderia pseudomallei 668 c... 97 3e-18
CP000352_555(CP000352|pid:none) Ralstonia metallidurans CH34, co... 97 3e-18
AY033895_1(AY033895|pid:none) Neocallimastix frontalis hydrogena... 97 3e-18
AE015451_2164(AE015451|pid:none) Pseudomonas putida KT2440 compl... 97 3e-18
CP001408_3054(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 97 3e-18
CP000712_3500(CP000712|pid:none) Pseudomonas putida F1, complete... 97 3e-18
CP001013_2739(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 97 3e-18
CP001146_407(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 97 3e-18
BX571965_2554(BX571965|pid:none) Burkholderia pseudomallei strai... 96 4e-18
CP000010_398(CP000010|pid:none) Burkholderia mallei ATCC 23344 c... 96 4e-18
CP000572_2924(CP000572|pid:none) Burkholderia pseudomallei 1106a... 96 5e-18
AM236080_4391(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 96 5e-18
AY827554_3(AY827554|pid:none) Clostridium saccharoperbutylaceton... 96 5e-18
CU633749_591(CU633749|pid:none) Cupriavidus taiwanensis str. LMG... 96 5e-18
CP001634_169(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 96 5e-18
CP000463_4606(CP000463|pid:none) Rhodopseudomonas palustris BisA... 96 5e-18
AE016830_1296(AE016830|pid:none) Enterococcus faecalis V583, com... 96 5e-18
AJ965256_143(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 96 5e-18
CU459003_554(CU459003|pid:none) Magnetospirillum gryphiswaldense... 96 7e-18
AE007870_1665(AE007870|pid:none) Agrobacterium tumefaciens str. ... 95 9e-18
AE008215_9(AE008215|pid:none) Agrobacterium tumefaciens str. C58... 95 9e-18
CP000628_3231(CP000628|pid:none) Agrobacterium radiobacter K84 c... 95 9e-18
CP000542_2336(CP000542|pid:none) Verminephrobacter eiseniae EF01... 95 1e-17
CP001096_800(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 94 2e-17
CP001001_4929(CP001001|pid:none) Methylobacterium radiotolerans ... 94 2e-17
CP000283_621(CP000283|pid:none) Rhodopseudomonas palustris BisB5... 94 2e-17
CP001251_509(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 94 3e-17
CP001510_4484(CP001510|pid:none) Methylobacterium extorquens AM1... 94 3e-17
AF516682_1(AF516682|pid:none) Neocallimastix frontalis iron hydr... 94 3e-17
CP000908_4345(CP000908|pid:none) Methylobacterium extorquens PA1... 94 3e-17
CP000133_3800(CP000133|pid:none) Rhizobium etli CFN 42, complete... 94 3e-17
AM180355_3496(AM180355|pid:none) Clostridium difficile 630 compl... 93 3e-17
AM167904_815(AM167904|pid:none) Bordetella avium 197N complete g... 93 3e-17
CP000969_1301(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 93 3e-17
CP000478_2130(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 93 5e-17
CP000490_24(CP000490|pid:none) Paracoccus denitrificans PD1222 c... 93 5e-17
CP000614_935(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 92 6e-17
DQ531485_3(DQ531485|pid:none) Xanthobacter flavus WM2814 fds/htx... 92 6e-17
CP000916_485(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 92 6e-17
CP000612_1630(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 92 6e-17
CP000702_1352(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 92 8e-17
AP009384_3454(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 92 8e-17
CP000440_891(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 91 1e-16
CP000721_4030(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 91 1e-16
CP000724_623(CP000724|pid:none) Alkaliphilus metalliredigens QYM... 91 1e-16
CP000767_152(CP000767|pid:none) Campylobacter curvus 525.92, com... 91 1e-16
CP000248_733(CP000248|pid:none) Novosphingobium aromaticivorans ... 91 1e-16
CP000885_86(CP000885|pid:none) Clostridium phytofermentans ISDg,... 91 1e-16
CT573326_1672(CT573326|pid:none) Pseudomonas entomophila str. L4... 91 2e-16
BX640426_133(BX640426|pid:none) Bordetella parapertussis strain ... 91 2e-16
CP000749_2253(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 91 2e-16
CP000702_714(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 91 2e-16
CP000792_191(CP000792|pid:none) Campylobacter concisus 13826, co... 90 3e-16
CP000771_219(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 90 3e-16
CP000923_2086(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 90 3e-16
AE015928_124(AE015928|pid:none) Bacteroides thetaiotaomicron VPI... 90 3e-16
CP000577_2723(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 90 4e-16
CP000076_322(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 90 4e-16
CP000721_3708(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 90 4e-16
CP000143_2696(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 90 4e-16
CP000394_1934(CP000394|pid:none) Granulibacter bethesdensis CGDN... 90 4e-16
CP000939_1769(CP000939|pid:none) Clostridium botulinum B1 str. O... 90 4e-16
AM412317_1833(AM412317|pid:none) Clostridium botulinum A str. AT... 90 4e-16
CP000962_1837(CP000962|pid:none) Clostridium botulinum A3 str. L... 90 4e-16
CP001150_2476(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 90 4e-16
CP000264_2558(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 89 5e-16
CP000716_475(CP000716|pid:none) Thermosipho melanesiensis BI429,... 89 5e-16
AM747720_2981(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 89 5e-16
CP001025_895(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 89 5e-16
CP000151_958(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 89 5e-16
CP001055_520(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 89 7e-16
AP009389_2010(AP009389|pid:none) Pelotomaculum thermopropionicum... 89 7e-16
CP001393_1233(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 89 9e-16
CP000969_737(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 89 9e-16
CP000140_1015(CP000140|pid:none) Parabacteroides distasonis ATCC... 89 9e-16
CP001581_1869(CP001581|pid:none) Clostridium botulinum A2 str. K... 88 1e-15
CP000930_920(CP000930|pid:none) Heliobacterium modesticaldum Ice... 88 1e-15
AB237641_3(AB237641|pid:none) Nostoc sp. PCC 7422 hoxF, hoxE, ho... 88 1e-15
CP000679_1784(CP000679|pid:none) Caldicellulosiruptor saccharoly... 88 1e-15
AY536043_5(AY536043|pid:none) Lyngbya majuscula CCAP 1446/4 puta... 87 3e-15
CP001251_73(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, c... 87 3e-15
EU313771_5(EU313771|pid:none) Thermoanaerobacterium saccharolyti... 87 3e-15
D57150(D57150) hydrogenase (EC 1.18.99.1) (Fe) large chain [simi... 86 4e-15
CP000924_1433(CP000924|pid:none) Thermoanaerobacter pseudethanol... 86 4e-15
CP001098_627(CP001098|pid:none) Halothermothrix orenii H 168, co... 86 4e-15
CP001185_762(CP001185|pid:none) Thermosipho africanus TCF52B, co... 86 4e-15
CP000716_1563(CP000716|pid:none) Thermosipho melanesiensis BI429... 86 4e-15
CP001185_1771(CP001185|pid:none) Thermosipho africanus TCF52B, c... 86 4e-15
CP001348_2408(CP001348|pid:none) Clostridium cellulolyticum H10,... 86 6e-15
AE017125_1597(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 86 6e-15
CP001083_1931(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 86 7e-15
CP001146_1705(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 86 7e-15
CP000812_1334(CP000812|pid:none) Thermotoga lettingae TMO, compl... 85 1e-14
AP010904_248(AP010904|pid:none) Desulfovibrio magneticus RS-1 DN... 85 1e-14
CP001145_179(CP001145|pid:none) Coprothermobacter proteolyticus ... 85 1e-14
BA000022_1517(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 85 1e-14
CR522870_682(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 85 1e-14
CP001217_1225(CP001217|pid:none) Helicobacter pylori P12, comple... 84 2e-14
AE001439_1183(AE001439|pid:none) Helicobacter pylori J99, comple... 84 2e-14
AJ312124_8(AJ312124|pid:none) Eubacterium acidaminophilum ORF1 (... 84 2e-14
CP001173_1184(CP001173|pid:none) Helicobacter pylori G27, comple... 84 2e-14
AB057405_3(AB057405|pid:none) Anabaena variabilis hoxF, ORF, hox... 84 2e-14
CP000241_1211(CP000241|pid:none) Helicobacter pylori HPAG1, comp... 84 2e-14
CP000860_109(CP000860|pid:none) Candidatus Desulforudis audaxvia... 84 2e-14
AE008691_833(AE008691|pid:none) Thermoanaerobacter tengcongensis... 84 2e-14
CP000252_1095(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 84 3e-14
CP000100_2555(CP000100|pid:none) Synechococcus elongatus PCC 794... 84 3e-14
AE016827_732(AE016827|pid:none) Mannheimia succiniciproducens MB... 83 4e-14
CP000478_2688(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 83 4e-14
AF148212_1(AF148212|pid:none) Clostridium thermocellum hydrogena... 83 4e-14
CP000860_151(CP000860|pid:none) Candidatus Desulforudis audaxvia... 83 4e-14
CP001344_3772(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 83 4e-14
AE000511_1249(AE000511|pid:none) Helicobacter pylori 26695, comp... 83 4e-14
AM162647_2(AM162647|pid:none) Heliobacillus mobilis hoxEF gene f... 83 5e-14
CU466930_1124(CU466930|pid:none) Candidatus Cloacamonas acidamin... 82 8e-14
CP000025_1688(CP000025|pid:none) Campylobacter jejuni RM1221, co... 82 1e-13
CP000148_1101(CP000148|pid:none) Geobacter metallireducens GS-15... 82 1e-13
AL111168_1489(AL111168|pid:none) Campylobacter jejuni subsp. jej... 82 1e-13
CP000482_1465(CP000482|pid:none) Pelobacter propionicus DSM 2379... 81 2e-13
CP001032_1536(CP001032|pid:none) Opitutus terrae PB90-1, complet... 81 2e-13
CP000142_2670(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 80 3e-13
CP000084_673(CP000084|pid:none) Candidatus Pelagibacter ubique H... 80 3e-13
AE017285_1764(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 80 3e-13
>(Q2LCP5) RecName: Full=NADH-ubiquinone oxidoreductase 75 kDa subunit;
EC=1.6.5.3; EC=1.6.99.3; AltName:
Full=Complex I-75kD; Short=CI-75kD;
&DQ336395_47(DQ336395|pid:none)
Length = 688
Score = 590 bits (1521), Expect(4) = 0.0
Identities = 291/342 (85%), Positives = 300/342 (87%)
Frame = +2
Query: 140 MIIRFXXXXXXXXXXXXXXDITILQACTANGIEIPRFCYHEKLTIAGNCRMCLVYVTNEE 319
M+IRF D+TILQACTANGIEIPRFCYHEKLTIAGNCRMCLVYVTNEE
Sbjct: 1 MLIRFKINEIECEVDEEKEDLTILQACTANGIEIPRFCYHEKLTIAGNCRMCLVYVTNEE 60
Query: 320 KLLAACGIPLDENFXXXXXXXXXXXXLKAREGVMEFLLINHPLDCPICDQGGECDLQEQT 499
KLLAACGIPLDENF LKAREGVMEFLLINHPLDCPICDQGGECDLQEQT
Sbjct: 61 KLLAACGIPLDENFDDESIETEIDEILKAREGVMEFLLINHPLDCPICDQGGECDLQEQT 120
Query: 500 LAYGLDTGRFYIKKRAVEIKTFGRLIKGIMTRCIHCTRCVRFLTEIAGVNELGVLGRGYN 679
+AYGLDTGRFYIKKRAVE+K FGRLIKGIMTRCIHCTRCVRFLTEIAGVNELGVLGRGYN
Sbjct: 121 IAYGLDTGRFYIKKRAVEVKAFGRLIKGIMTRCIHCTRCVRFLTEIAGVNELGVLGRGYN 180
Query: 680 MEIGTYKKNVMIESELSGNIIDLCPVGALTSAVYAYKGRPWELKNIKGIDIFDTLLTPIN 859
MEIGTYKKNV+IESELSGNIIDLCPVGALTSAVYAYKGRPWELKNIKGIDIFDT+LTPIN
Sbjct: 181 MEIGTYKKNVIIESELSGNIIDLCPVGALTSAVYAYKGRPWELKNIKGIDIFDTVLTPIN 240
Query: 860 YQVKGGEIFRILPRINDRINEEWITDKVRFHYESYKIIEKIRKETPSYKIQANKFIELSW 1039
YQVKGGEIFRILPRINDR+NEEWITDKVRFHYESYKIIEK+RK+TPSYKIQANKFIELSW
Sbjct: 241 YQVKGGEIFRILPRINDRLNEEWITDKVRFHYESYKIIEKMRKDTPSYKIQANKFIELSW 300
Query: 1040 KTAXXXXXXXXXXXXXXXDLIIGSKINSTNLRIYKELMNRLG 1165
KTA DLIIGSKINSTNLRIYKELMNRLG
Sbjct: 301 KTALKMVFKVLLNKKNKVDLIIGSKINSTNLRIYKELMNRLG 342
Score = 315 bits (806), Expect(4) = 0.0
Identities = 158/219 (72%), Positives = 178/219 (81%)
Frame = +2
Query: 1496 KKAKRXXXXXXXXXXTRISLTLQEMRAIFMKACNLKPENILIITQGANFGMALEEGLFKE 1675
KK+K +RI+++LQE+RA F A N+KPEN+L+ITQGANFGMALEEG+FKE
Sbjct: 452 KKSKAPLILVGSSLLSRIAISLQEIRAAFEIASNIKPENVLLITQGANFGMALEEGIFKE 511
Query: 1676 KFSIGGNVLYSIDSNEVQVTNKINYVIYQGIINDKFENKIDLYLPSKHYFEDFEGDREVY 1855
FS GGNVLYSIDSNE +V+ INY+IYQGI+ND FENKIDLYLPSKHYFEDFE DRE+Y
Sbjct: 512 NFSKGGNVLYSIDSNEYKVSKTINYIIYQGILNDTFENKIDLYLPSKHYFEDFESDREIY 571
Query: 1856 MNTFGQRSEIEKLSISKGNKIKENSMIGYIQLMYLNNKEMTRKEKEQKDIKLSYRXXXXX 2035
+NTFGQRSEIEKL ISKGNKIKENSMIGYIQLMYLN KEM RKEKEQK+IK++YR
Sbjct: 572 VNTFGQRSEIEKLRISKGNKIKENSMIGYIQLMYLNKKEMNRKEKEQKEIKITYRGIKQK 631
Query: 2036 XXXXXXXXXYLTINNIIENYYMTDINIRLSKNLMITGQL 2152
LTINNII+NYYMTDIN RLSKNLMITGQL
Sbjct: 632 EKRQVKINKNLTINNIIDNYYMTDINSRLSKNLMITGQL 670
Score = 205 bits (522), Expect(4) = 0.0
Identities = 96/109 (88%), Positives = 105/109 (96%)
Frame = +1
Query: 1195 LMFKKFNYDLRENYINSNDLYNVDKNDLVLLCGINLRVESPLLNIKLRNVNFGDDEIESV 1374
L+FKKFNYD RENYINSNDLYNVD+NDLVLLCGINLRVESPLLNIKLRN+NFGDDEIE+
Sbjct: 352 LLFKKFNYDFRENYINSNDLYNVDQNDLVLLCGINLRVESPLLNIKLRNINFGDDEIETR 411
Query: 1375 KKIGIIGNKFDWKHESEYIGATLNSMLKLFEGRLPYCQQIKKSKAPLII 1521
KKIGIIGNKFDWK ESEY+G+T+NSMLK+FEGR PYCQQIKKSKAPLI+
Sbjct: 412 KKIGIIGNKFDWKQESEYLGSTVNSMLKVFEGRFPYCQQIKKSKAPLIL 460
Score = 25.4 bits (54), Expect(4) = 0.0
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +3
Query: 1164 GSKNYITENG 1193
GSKNYITENG
Sbjct: 342 GSKNYITENG 351
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 2,526,925,014
Number of extensions: 44065146
Number of successful extensions: 121972
Number of sequences better than 10.0: 664
Number of HSP's gapped: 120564
Number of HSP's successfully gapped: 791
Length of query: 717
Length of database: 1,061,185,681
Length adjustment: 136
Effective length of query: 581
Effective length of database: 616,676,753
Effective search space: 358289193493
Effective search space used: 358289193493
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
4 |
| VH (FL, L) |
0 |
| VF (FL, S) |
3 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
3 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
5 |
| FC-IC (SUB) |
5 |