Contig-U16520-1 |
Contig ID |
Contig-U16520-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
no gap |
Contig length |
1477 |
Chromosome number (1..6, M) |
1 |
Chromosome length |
4919822 |
Start point |
4681291 |
End point |
4679815 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
12 |
Number of EST |
14 |
Link to clone list |
U16520 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 4.11 |
Homology vs DNA |
Query= Contig-U16520-1 (Contig-U16520-1Q) /CSM_Contig/Contig-U16520-1Q.Seq.d (1477 letters)
Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ339806) Dictyostelium discoideum cDNA clone:dda10p07, 3' ... 1291 0.0 3 (BJ402359) Dictyostelium discoideum cDNA clone:dds16b16, 3' ... 1249 0.0 2 (BJ411374) Dictyostelium discoideum cDNA clone:ddv4l05, 5' e... 1132 0.0 1 (AU033943) Dictyostelium discoideum slug cDNA, clone SLB640. 1074 0.0 2 (BJ347424) Dictyostelium discoideum cDNA clone:dda27f05, 3' ... 1045 0.0 3 (C23789) Dictyostelium discoideum gamete cDNA, clone FC-AJ15. 650 0.0 3 (C23790) Dictyostelium discoideum gamete cDNA, clone FC-AJ15. 640 0.0 2 (BJ342785) Dictyostelium discoideum cDNA clone:dda1g15, 3' e... 496 e-174 2 (BJ341340) Dictyostelium discoideum cDNA clone:dda6a12, 3' e... 587 e-173 2 (BJ397991) Dictyostelium discoideum cDNA clone:dds10e14, 3' ... 517 e-145 2 (BJ429602) Dictyostelium discoideum cDNA clone:ddv4l05, 3' e... 509 e-140 1 (BJ340826) Dictyostelium discoideum cDNA clone:dda4e02, 3' e... 448 e-121 1 (BJ342867) Dictyostelium discoideum cDNA clone:dda15o04, 3' ... 438 e-118 1 (BJ341680) Dictyostelium discoideum cDNA clone:dda7o15, 3' e... 430 e-116 1 (BJ428623) Dictyostelium discoideum cDNA clone:ddv12j17, 3' ... 416 e-111 1 (BJ341097) Dictyostelium discoideum cDNA clone:dda5o02, 3' e... 381 e-101 1 (AU034642) Dictyostelium discoideum slug cDNA, clone SLE110. 283 6e-93 2 (FC810733) Sr_pASP6_05f16_SP6 S. ratti mixed stage pAMP Stro... 163 4e-74 5 (FC816177) Sr_pAMT7_05f16_T7 S. ratti mixed stage pAMP Stron... 163 7e-72 5 (EX814112) CBNA3871.rev CBNA Phycomyces blakesleeanus NRRL15... 94 5e-67 5 (FC814397) Sr_pASP6_017l22_SP6 S. ratti mixed stage pAMP Str... 157 3e-66 6 (EE006275) ROE00001242 Rhizopus oryzae Company Rhizopus oryz... 157 2e-65 4 (AE014830) Plasmodium falciparum 3D7 chromosome 10 section 2... 192 2e-65 7 (CA754855) BR030007002_BR030_B09_66_076.ab1 OA Oryza sativa ... 230 9e-65 4 (CZ546158) SRAA-aad66b12.b1 Strongyloides ratti whole genome... 163 1e-64 3 (BI741860) kt81h06.y1 Strongyloides ratti L1 pAMP1 v3 Chiape... 163 9e-63 3 (EL504291) C03_469_302.AB1 Blood stage Plasmodium falciparum... 192 2e-61 2 (BU495626) PfESToab75e05.y1 Plasmodium falciparum 3D7 asexua... 192 2e-61 2 (BU495625) PfESToab75e04.y1 Plasmodium falciparum 3D7 asexua... 192 2e-61 2 (BI815241) PfESToaa16c01.y1 Plasmodium falciparum 3D7 asexua... 192 2e-61 2 (BU498573) PfESToab99a02.y1 Plasmodium falciparum 3D7 asexua... 155 1e-59 3 (EX837315) CBNB6852.fwd CBNB Phycomyces blakesleeanus NRRL15... 94 7e-58 5 (EX837314) CBNB6852.rev CBNB Phycomyces blakesleeanus NRRL15... 94 1e-53 4 (EX837749) CBNB7081.rev CBNB Phycomyces blakesleeanus NRRL15... 94 1e-53 4 (EX844577) CBNC5460.rev CBNC Phycomyces blakesleeanus NRRL15... 94 1e-53 4 (EX817737) CBNA5732.rev CBNA Phycomyces blakesleeanus NRRL15... 94 2e-53 4 (FD451857) EGGAE04TF Haematobia irritans eggs Haematobia irr... 121 6e-53 4 (EB827202) 1087191 KZ03 Plodia interpunctella cDNA clone 554... 153 1e-52 3 (EL494596) D03_PFBAMHI-M-T3-PLATE18A.AB1 Blood stage Plasmod... 192 5e-52 2 (EC389044) G09_G09gm2l17_pDNRf_490986 Myzus persicae, line G... 172 8e-52 3 (BI670760) PfESToaa03h11.y1 Plasmodium falciparum 3D7 asexua... 125 2e-51 3 (BM959492) PLATE_9_C08_06.AB1 GS Lambda-Triplex, 10 day germ... 161 2e-51 3 (EX815511) CBNA4568.rev CBNA Phycomyces blakesleeanus NRRL15... 94 3e-51 4 (DW267721) UI-S-GN1-aca-d-04-0-UI.s1 UI-S-GN1 Euprymna scolo... 200 7e-49 2 (BQ596467) PfESToab18c02.y1 Plasmodium falciparum 3D7 asexua... 117 1e-48 3 (EX817738) CBNA5732.fwd CBNA Phycomyces blakesleeanus NRRL15... 90 3e-48 4 (CU366909) Aphanomyces euteiches cDNA. 109 4e-48 5 (CU362407) Aphanomyces euteiches cDNA. 109 5e-48 5 (BF046998) EST1095 Manduca sexta male antennae Uni-ZAP XR li... 163 3e-47 3 (EH118776) Plt-13-M13R_F12_94 MS EST Hem Manduca sexta cDNA,... 163 3e-47 3 (FC759796) CBBN11673.rev CBBN Lottia gigantea 3,4,5,6.5d Lar... 101 1e-46 4 (FC720791) CBBG13648.fwd CBBG Lottia gigantea 12,15,18h embr... 103 2e-46 4 (FC741390) CBBI12443.rev CBBI Lottia gigantea 26h,37h,61h La... 103 2e-45 3 (FC808123) CBGC9445.rev CBGC Lottia gigantea 15h 18h embryos... 103 2e-45 3 (FC725571) CBBG2912.rev CBBG Lottia gigantea 12,15,18h embry... 103 2e-45 3 (FC720790) CBBG13648.rev CBBG Lottia gigantea 12,15,18h embr... 103 2e-45 3 (FC754824) CBBI8293.rev CBBI Lottia gigantea 26h,37h,61h Lar... 103 2e-45 3 (FC755134) CBBI8514.rev CBBI Lottia gigantea 26h,37h,61h Lar... 103 2e-45 3 (FE244693) CAPG8335.rev CAPG Naegleria gruberi amoeba stage ... 74 3e-45 6 (EC826578) SME00000199 esmbsro2 Sawyeria marylandensis cDNA,... 131 3e-45 4 (FC809501) Sr_pASP6_01d18_SP6 S. ratti mixed stage pAMP Stro... 113 5e-45 5 (BI815815) PfESToaa33a04.y1 Plasmodium falciparum 3D7 asexua... 103 5e-45 3 (DN307702) PL05014B1G10 cDNA from sexually mature hermaphodi... 100 6e-45 5 (EY120570) 2003K19 Heliothis virescens hemocyte Library Heli... 137 7e-45 3 (DN300361) PL04019A1D01 cDNA from sexually mature hermaphodi... 100 7e-45 5 (EH215912) USDA-FP_178714 WHMH (pink hibiscus mealybug) Maco... 135 7e-45 6 (CU351751) Aphanomyces euteiches cDNA. 101 1e-44 5 (DW264974) UI-S-GN1-abq-l-07-0-UI.s1 UI-S-GN1 Euprymna scolo... 186 1e-44 2 (CU353299) Aphanomyces euteiches cDNA. 101 1e-44 5 (AY967593) Schmidtea mediterranea clone NBE.3.05B mRNA seque... 100 2e-44 5 (BQ452229) PfESToaa93g12.y1 Plasmodium falciparum 3D7 asexua... 135 3e-44 2 (FC670627) CAXW7644.rev CAXW Lottia gigantea from female gon... 100 3e-44 3 (AZ539188) ENTGC32TR Entamoeba histolytica Sheared DNA Entam... 82 5e-44 5 (DW262564) UI-S-GN0-abl-k-07-0-UI.s1 UI-S-GN0 Euprymna scolo... 139 1e-43 3 (FE232025) CAPG1532.rev CAPG Naegleria gruberi amoeba stage ... 74 1e-43 5 (ES218390) MpFVN_ag3_L06 Myzus persicae, line F001, PLRV fre... 172 4e-43 2 (FC787531) CBGC17797.fwd CBGC Lottia gigantea 15h 18h embryo... 96 4e-43 3 (FC718608) CBBG12250.rev CBBG Lottia gigantea 12,15,18h embr... 103 5e-43 3 (FC567537) CAWF7197.rev CAWF Lottia gigantea from mantle (H)... 103 5e-43 3 (FC624204) CAXT3794.rev CAXT Lottia gigantea from mantle Lot... 103 6e-43 3 (FC623931) CAXT3624.rev CAXT Lottia gigantea from mantle Lot... 103 6e-43 3 (CU357166) Aphanomyces euteiches cDNA. 109 3e-42 5 (DL174188) Methods for Identifying the Target of a Compound ... 74 3e-42 7 (AX489380) Sequence 6680 from Patent WO02053728. 74 3e-42 7 (FE232581) CAPG1826.rev CAPG Naegleria gruberi amoeba stage ... 68 6e-42 5 (AL115143) Botrytis cinerea strain T4 cDNA library. 101 6e-42 4 (CU440002) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 70 1e-41 6 (FE263539) CAZO3319.rev CAZO Naegleria gruberi Flagellate St... 68 2e-41 5 (FE239684) CAPG5488.rev CAPG Naegleria gruberi amoeba stage ... 68 3e-41 5 (CT782767) Paramecium tetraurelia 5-PRIME EST from clone LK0... 100 3e-41 5 (EY183752) CBTI9227.g1_E03.ab1:P Triphysaria pusilla root ti... 80 3e-41 5 (FE251681) CAPH3592.rev CAPH Naegleria gruberi amoeba stage ... 68 8e-41 5 (EY125602) CBTH10226.b1_C14.ab1:P Triphysaria pusilla root t... 80 8e-41 5 (FE245060) CAPG8584.rev CAPG Naegleria gruberi amoeba stage ... 68 8e-41 5 (FE232937) CAPG2015.rev CAPG Naegleria gruberi amoeba stage ... 68 8e-41 5 (CJ364947) Molgula tectiformis cDNA, cleaving embryo clone:m... 111 9e-41 2 (CJ402039) Molgula tectiformis cDNA, gonad clone:mtgd016l12,... 111 9e-41 2 (CJ400272) Molgula tectiformis cDNA, gonad clone:mtgd011l03,... 111 9e-41 2 (CJ429039) Molgula tectiformis cDNA, larva clone:mtlv013g17,... 111 9e-41 2 (CJ421622) Molgula tectiformis cDNA, larva clone:mtlv007n10,... 111 9e-41 2 (CJ407832) Molgula tectiformis cDNA, gonad clone:mtgd030b07,... 111 9e-41 2 (CJ407495) Molgula tectiformis cDNA, gonad clone:mtgd029c06,... 111 9e-41 2 (ES218025) MpFVN_ag2_J08 Myzus persicae, line F001, PLRV fre... 153 6e-40 2 (CV175877) Gryllus5POLYT_C10_1_070 Gryllus bimaculatus cDNA ... 100 2e-39 3 (CN874114) 010129AARA002958HT (AARA) Royal Gala partially se... 66 7e-39 5 (EH630697) EST1804 LK04 Laupala kohalensis cDNA clone 106102... 100 1e-38 4 (BJ817055) Caenorhabditis elegans cDNA clone:yk1641b08 : 3' ... 101 1e-38 4 (EE005636) ROE00000066 Rhizopus oryzae Company Rhizopus oryz... 131 2e-38 3 (BJ816337) Caenorhabditis elegans cDNA clone:yk1621b08 : 3' ... 101 2e-38 4 (BB994650) Bombyx mori cDNA, clone:E_ET_psgV_30H10_R_0, 3' e... 149 3e-38 2 (BP120902) Bombyx mori cDNA, clone:ceN-3859, 5' end sequence. 149 4e-38 2 (GO098843) CAFZ2354.rev CAFZ Alvinella pompejana Incyte regu... 92 6e-38 3 (CO854832) LM_SL5_000230 Locusta migratoria solitarious phas... 123 8e-38 2 (EY132702) CBTH3686.g1_K10.ab1:P Triphysaria pusilla root ti... 80 4e-37 4 (CU362055) Aphanomyces euteiches cDNA. 109 5e-37 4 (CU349646) Aphanomyces euteiches cDNA. 109 5e-37 4 (CU366252) Aphanomyces euteiches cDNA. 109 5e-37 4 (CU366058) Aphanomyces euteiches cDNA. 109 6e-37 4 (CU357078) Aphanomyces euteiches cDNA. 109 7e-37 4 (EL504310) C04_470_1.AB1 Blood stage Plasmodium falciparum c... 157 1e-36 3 (EL504266) C02_469_1.AB1 Blood stage Plasmodium falciparum c... 157 1e-36 3 (CJ398883) Molgula tectiformis cDNA, gonad clone:mtgd004k01,... 98 1e-36 2 (FC856925) CAMHEP428e02 CAMHE Biomphalaria glabrata cDNA clo... 78 5e-36 4 (DV184690) CT038_G11_CT038_3700_91.ab1 C. tentans tissue cul... 100 7e-36 6 (CJ405204) Molgula tectiformis cDNA, gonad clone:mtgd022k17,... 111 2e-35 2 (FF293545) 279296240 Pea aphid whole body normalized full le... 84 2e-35 3 (EX612245) 255378770 Pea aphid whole body normalized full le... 84 2e-35 3 (EX630940) 255478112 Pea aphid whole body normalized full le... 84 2e-35 3 (FF317717) 280391701 Pea aphid whole body normalized full le... 84 2e-35 3 (EH636643) EST7751 LK04 Laupala kohalensis cDNA clone 106102... 92 9e-35 3 (EB998846) 7619697 CE04 Caenorhabditis elegans cDNA clone 27... 101 1e-34 3 (CB404685) OSTR026H8_1 AD-wrmcDNA Caenorhabditis elegans cDN... 101 2e-34 3 (BJ768581) Caenorhabditis elegans cDNA clone:yk1671h01 : 5' ... 101 2e-34 3 (BJ769037) Caenorhabditis elegans cDNA clone:yk1689f10 : 5' ... 101 2e-34 3 (BJ783429) Caenorhabditis elegans cDNA clone:yk1522e05 : 3' ... 101 3e-34 3 (FB894472) Sequence 113745 from Patent WO2008034648. 98 3e-34 3 (FB882377) Sequence 101650 from Patent WO2008034648. 98 3e-34 3 (FB876568) Sequence 95841 from Patent WO2008034648. 98 3e-34 3 (FB873621) Sequence 92894 from Patent WO2008034648. 98 3e-34 3 (FB869974) Sequence 89247 from Patent WO2008034648. 98 3e-34 3 (FB861999) Sequence 81272 from Patent WO2008034648. 98 3e-34 3 (FB855025) Sequence 74298 from Patent WO2008034648. 98 3e-34 3 (FB840488) Sequence 59761 from Patent WO2008034648. 98 3e-34 3 (FB825480) Sequence 44753 from Patent WO2008034648. 98 3e-34 3 (FB822904) Sequence 42177 from Patent WO2008034648. 98 3e-34 3 (FB815343) Sequence 34616 from Patent WO2008034648. 98 3e-34 3 (FB805931) Sequence 25204 from Patent WO2008034648. 98 3e-34 3 (FB781708) Sequence 981 from Patent WO2008034648. 98 3e-34 3 (CQ804018) Sequence 429 from Patent WO2004035798. 98 3e-34 3 (AX651401) Sequence 196 from Patent WO03000898. 98 3e-34 3 (BJ812044) Caenorhabditis elegans cDNA clone:yk1463b12 : 3' ... 101 3e-34 3 (BJ793569) Caenorhabditis elegans cDNA clone:yk1689f10 : 3' ... 101 3e-34 3 (BJ793073) Caenorhabditis elegans cDNA clone:yk1671h01 : 3' ... 101 3e-34 3 (BJ132123) Caenorhabditis elegans cDNA clone:yk1062d09 : 3' ... 101 3e-34 3 (BJ785163) Caenorhabditis elegans cDNA clone:yk1567e03 : 3' ... 101 3e-34 3 (BJ813263) Caenorhabditis elegans cDNA clone:yk1477b03 : 3' ... 101 3e-34 3 (AF123391) Arabidopsis thaliana 26S proteasome AAA-ATPase su... 98 4e-34 3 (AB161192) Arabidopsis thaliana HLR mRNA for 26S proteasome ... 98 4e-34 3 (BP119878) Bombyx mori cDNA, clone:ceN-1456, 5' end sequence. 135 4e-34 2 (AY034975) Arabidopsis thaliana putative 26S proteasome subu... 98 4e-34 3 (DY830087) CTOY569.b1_B23.ab1 CTO(XYZ) dandelion Taraxacum o... 101 4e-34 6 (DR400900) TKN063H10_629322 Taraxacum kok-saghyz root cDNA l... 101 5e-34 6 (EY371462) CAXA13459.fwd CAXA Helobdella robusta Subtracted ... 64 5e-34 4 (EA381204) Sequence 30028 from patent US 7314974. 101 5e-34 3 (FE390383) CBTO2601.fwd CBTO_Daphnia_pulex_Chosen_One_Librar... 96 6e-34 4 (FE348572) CBIB7881.rev CBIB_Daphnia_pulex_Chosen_One_Librar... 92 6e-34 5 (FE390382) CBTO2601.rev CBTO_Daphnia_pulex_Chosen_One_Librar... 96 1e-33 4 (EB996741) 7432637 CE04 Caenorhabditis elegans cDNA clone 27... 101 1e-33 2 (DT582137) ram01-3ms1-h16 Ram01 Ribes americanum cDNA clone ... 74 1e-33 5 (FC808124) CBGC9445.fwd CBGC Lottia gigantea 15h 18h embryos... 103 2e-33 5 (EG017164) EST01843_0906 Sporophyte cDNA Library Porphyra ha... 78 2e-33 3 (GE598430) CCPW690.b1_D06.ab1 CCP(UWX) Globe Artichoke Cynar... 62 3e-33 6 (FF676970) G826P576RB11.T0 Acorn worm normalized juvenile pE... 125 4e-33 3 (DV704016) CGN-50703 Seed of Late Development Stage Coffea c... 72 4e-33 5 (FC814792) Sr_pAMT7_01d18_T7 S. ratti mixed stage pAMP Stron... 155 6e-33 1 (EL504335) C05_470_603.AB1 Blood stage Plasmodium falciparum... 78 6e-33 4 (CU366564) Aphanomyces euteiches cDNA. 109 1e-32 3 (BH158528) ENTQT70TF Entamoeba histolytica Sheared DNA Entam... 80 1e-32 5 (EV435388) 35065_471 Quinqueloculina sp. cDNA library Quinqu... 88 1e-32 5 (CU424623) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 78 2e-32 5 (EE121138) G710P5363RH10.T0 Acorn worm normalized juvenile p... 125 2e-32 2 (AF016440) Caenorhabditis elegans cosmid F29G9, complete seq... 101 2e-32 5 (DV672948) CGN-8788 Pericarp Coffea canephora cDNA clone ccc... 72 2e-32 6 (AR550142) Sequence 5273 from patent US 6747137. 74 2e-32 5 (ES492301) BIG_AF_116 Brine Shrimp diapaused embryos (cysts)... 76 4e-32 5 (BG321590) Ds01_01a08_A Ds01_AAFC_ECORC_cold_stressed_Flixwe... 113 5e-32 5 (EE116104) G708P5185RE1.T0 Acorn worm normalized gastrula pE... 125 7e-32 2 (DY353829) ZO__Ec0006D11.r ZO__Ec Zingiber officinale cDNA c... 86 7e-32 4 (CU363938) Aphanomyces euteiches cDNA. 109 8e-32 3 (CU362639) Aphanomyces euteiches cDNA. 109 9e-32 3 (CA754805) BR030007000_PLATE_B09_66_076.ab1 OA Oryza sativa ... 151 9e-32 1 (AX507058) Sequence 1753 from Patent WO0216655. 56 1e-31 7 (FC808778) CBGC9888.fwd CBGC Lottia gigantea 15h 18h embryos... 84 2e-31 3 (AY056335) Arabidopsis thaliana putative 26S proteasome subu... 56 2e-31 7 (DV184757) CT039_F03_CT039_3700_91.ab1 C. tentans tissue cul... 70 2e-31 7 (CO126305) GR__Eb10E04.f GR__Eb Gossypium raimondii cDNA clo... 72 2e-31 6 (CJ404858) Molgula tectiformis cDNA, gonad clone:mtgd021l04,... 90 2e-31 4 (BU495950) PfESToab79g10.y1 Plasmodium falciparum 3D7 asexua... 78 3e-31 3 (AF372977) Arabidopsis thaliana At2g20140/T2G17.6 mRNA, comp... 56 4e-31 7 (AY035072) Arabidopsis thaliana putative 26S proteasome subu... 56 4e-31 7 (Z29366) S.pombe(972) mts2 mRNA for 26S protease subunit. 82 4e-31 5 (BX819727) Arabidopsis thaliana Full-length cDNA Complete se... 56 9e-31 7 (EX644097) 256651772 Pea aphid whole body normalized full le... 82 1e-30 4 (FC820454) Sr_pAMT7_017l22_T7 S. ratti mixed stage pAMP Stro... 117 1e-30 2 (EW968032) LS_14_F01_T7 Headlice composite library with all ... 121 1e-30 2 (DV184847) CT041_G02_CT041_3700_91.ab1 C. tentans tissue cul... 54 1e-30 8 (DW270352) UI-S-GS0-ach-g-12-0-UI.s1 UI-S-GS0 Euprymna scolo... 139 1e-30 2 (CR382126) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 105 2e-30 4 (FB894448) Sequence 113721 from Patent WO2008034648. 68 4e-30 5 (FB882353) Sequence 101626 from Patent WO2008034648. 68 4e-30 5 (FB876544) Sequence 95817 from Patent WO2008034648. 68 4e-30 5 (FB873597) Sequence 92870 from Patent WO2008034648. 68 4e-30 5 (FB869950) Sequence 89223 from Patent WO2008034648. 68 4e-30 5 (FB861975) Sequence 81248 from Patent WO2008034648. 68 4e-30 5 (FB855001) Sequence 74274 from Patent WO2008034648. 68 4e-30 5 (FB840464) Sequence 59737 from Patent WO2008034648. 68 4e-30 5 (FB825456) Sequence 44729 from Patent WO2008034648. 68 4e-30 5 (FB822880) Sequence 42153 from Patent WO2008034648. 68 4e-30 5 (FB815319) Sequence 34592 from Patent WO2008034648. 68 4e-30 5 (FB805907) Sequence 25180 from Patent WO2008034648. 68 4e-30 5 (FB781684) Sequence 957 from Patent WO2008034648. 68 4e-30 5 (EY125603) CBTH10226.g1_C14.ab1:P Triphysaria pusilla root t... 80 4e-30 3 (CO854831) LM_SL5_000229 Locusta migratoria solitarious phas... 137 4e-30 2 (DV182214) CT001_H10_CT001_3700_91.ab1 C. tentans tissue cul... 54 5e-30 8 (DB764794) Apis mellifera head cDNA, RIKEN full-length enric... 66 6e-30 4 (DT981554) CLJ195-D06.x1d-t SHGC-CLJ Gasterosteus aculeatus ... 80 7e-30 4 (D50696) Rattus norvegicus mRNA for proteasomal ATPase (S4),... 60 7e-30 5 (GC671888) Sequence 2480 from patent US 7447594. 60 7e-30 5 (GC590734) Sequence 2067 from patent US 7426441. 60 7e-30 5 (GC554748) Sequence 2067 from patent US 7415358. 60 7e-30 5 (DD269459) Molecular Hepatotoxicology Modeling. 60 7e-30 5 (CD004630) VVB040B02_323814 An expressed sequence tag databa... 86 7e-30 4 (DY327592) OB_MEa0001K23.r OB_MEa Ocimum basilicum cDNA clon... 103 7e-30 4 (BC063157) Rattus norvegicus protease (prosome, macropain) 2... 60 7e-30 5 (CB003052) VVB023H03_132962 An expressed sequence tag databa... 86 8e-30 4 (CB003570) VVB026F09_133998 An expressed sequence tag databa... 86 8e-30 4 (CB003301) VVB028F09_133460 An expressed sequence tag databa... 86 8e-30 4 (CB002671) VVB019D12_132200 An expressed sequence tag databa... 86 8e-30 4 (FG073989) UI-FF-IF0-abh-k-14-0-UI.r1 Ceratitis capitata emb... 66 1e-29 4 (CB974101) CAB30004_IIa_Fa_E08 Cabernet Sauvignon Berry Stag... 86 1e-29 4 (GE907526) 9549023_E22.ab1_c Past_norm2007 Porites astreoide... 60 1e-29 4 (EX624769) 255427512 Pea aphid whole body normalized full le... 82 1e-29 3 (CU361059) Aphanomyces euteiches cDNA. 109 1e-29 3 (FE263540) CAZO3319.fwd CAZO Naegleria gruberi Flagellate St... 82 1e-29 3 (EY354296) CAWZ2993.fwd CAWZ Helobdella robusta Primary Late... 64 2e-29 4 (CU352619) Aphanomyces euteiches cDNA. 109 2e-29 3 (EY376625) CAXA16281.rev CAXA Helobdella robusta Subtracted ... 68 2e-29 4 (EE006805) ROE00000698 Rhizopus oryzae Company Rhizopus oryz... 70 3e-29 3 (DC864607) Samia cynthia ricini cDNA, clone: I09A02NGRL0006_... 107 3e-29 3 (FG404384) 000603KAAA001777HT (KAAA) A. deliciosa developing... 90 3e-29 5 (ES852298) UFL_670_58 Cotton fiber 0-10 day post anthesis Go... 86 4e-29 4 (FD508972) Pam01b_116_A08_C013.g1 Persea americana flower bu... 96 4e-29 3 (AY087584) Arabidopsis thaliana clone 36815 mRNA, complete s... 56 5e-29 7 (DN244845) ACAE-aaa18e07.b1 Hydra EST UCI 5 Hydra magnipapil... 68 5e-29 4 (DT979841) CLJ185-B01.x1d-t SHGC-CLJ Gasterosteus aculeatus ... 76 6e-29 5 (ES800695) UFL_538_66 Cotton fiber 0-10 day post anthesis Go... 86 6e-29 4 (DV136552) CV03114B1G09.f1 CV03-normalized library Euphorbia... 60 6e-29 5 (EH691800) CCIM3968.b1_P07.ab1 CCI(LMS) chicory Cichorium in... 117 6e-29 3 (EH697786) CCIM9603.b1_E01.ab1 CCI(LMS) chicory Cichorium in... 117 7e-29 3 (FG474955) 020216KALA005555HT (KALA) Dormant kiwifruit buds ... 103 8e-29 4 (EH673676) CCIL11685.b1_J17.ab1 CCI(LMS) chicory Cichorium i... 117 8e-29 3 (DV186558) CT065_B06_CT065_3700_90.ab1 C. tentans tissue cul... 54 1e-28 7 (FE387727) CBNT971.rev CBNT_Daphnia_pulex_Chosen_One_Library... 96 1e-28 3 (FE243067) CAPG7468.rev CAPG Naegleria gruberi amoeba stage ... 68 2e-28 4 (FE263686) CAZO3408.rev CAZO Naegleria gruberi Flagellate St... 68 2e-28 4 (FE263416) CAZO3243.rev CAZO Naegleria gruberi Flagellate St... 68 2e-28 4 (FE237312) CAPG4316.rev CAPG Naegleria gruberi amoeba stage ... 68 2e-28 4 (EV485359) 079C02 Cotton Lambda Zap Express Library Gossypiu... 52 2e-28 5 (FG069061) UI-FF-IF0-aac-g-09-0-UI.r1 Ceratitis capitata emb... 66 2e-28 3 (ES801134) UFL_573_20 Cotton fiber 0-10 day post anthesis Go... 86 2e-28 4 (CU355976) Aphanomyces euteiches cDNA. 109 3e-28 3 (CU365876) Aphanomyces euteiches cDNA. 109 3e-28 3 (CO114530) GR__Eb015L17.r GR__Eb Gossypium raimondii cDNA cl... 70 4e-28 5 (DY327591) OB_MEa0001K23.f OB_MEa Ocimum basilicum cDNA clon... 98 4e-28 4 (FE387728) CBNT971.fwd CBNT_Daphnia_pulex_Chosen_One_Library... 96 4e-28 3 (CO089122) GR__Ea08H11.f GR__Ea Gossypium raimondii cDNA clo... 52 5e-28 5 (EY825935) PT11-C1-901-085-A04-CT.F Poncirus trifoliata leaf... 68 6e-28 5 (ES909439) BNARO2GH_T3_001_G09_23NOV2006_067 Brassica napus ... 82 6e-28 4 (BJ340136) Dictyostelium discoideum cDNA clone:dda11e19, 3' ... 72 6e-28 5 (EX841711) CBNC10930.rev CBNC Phycomyces blakesleeanus NRRL1... 94 7e-28 2 (DB761665) Apis mellifera head cDNA, RIKEN full-length enric... 64 8e-28 4 (DB775962) Apis mellifera head cDNA, RIKEN full-length enric... 64 8e-28 4 (DB763978) Apis mellifera head cDNA, RIKEN full-length enric... 64 9e-28 4 (FD763200) Afi06_21_B12_C014.b2 Aristolochia fimbriata mixed... 68 9e-28 4 (BJ343833) Dictyostelium discoideum cDNA clone:dda17h11, 3' ... 72 9e-28 5 (DY376904) ZO__Eg0002N16.f ZO__Eg Zingiber officinale cDNA c... 94 1e-27 3 (ES406198) MUT14-P17.y1d-s SHGC-MUT Mytilus californianus cD... 74 1e-27 5 (ES909750) BNARO2GH_T7_002_G09_23NOV2006_067 Brassica napus ... 82 1e-27 4 (EY751606) CS00-C5-003-093-H01-CT.F Sweet orange flower, gre... 68 1e-27 4 (DT013629) VVH003D02_738701 CabSau Flower Nectary Stage 25 (... 86 2e-27 4 (BM169092) EST571615 PyBS Plasmodium yoelii yoelii cDNA clon... 70 2e-27 4 (ES814050) UFL_331_35 Cotton fiber 0-10 day post anthesis Go... 52 2e-27 5 (FC299891) CAIC10499.rev CAIC Nematostella vectensis Nemve w... 68 2e-27 4 (ES807805) UFL_650_93 Cotton fiber 0-10 day post anthesis Go... 52 3e-27 5 (EE080320) S2B24072 Buds (VvS2) Vitis vinifera cDNA clone S2... 86 3e-27 4 (CA815571) CA12EI204IF_H10 Cabernet Sauvignon Leaf - CA12EI ... 86 3e-27 4 (EX262830) 1443254_5_K20_070 PY06 Carica papaya cDNA, mRNA s... 78 4e-27 5 (EV028127) BNSCS2CT_UP_169_B11_27APR2007_093 Brassica napus ... 64 4e-27 4 (BJ435430) Dictyostelium discoideum cDNA clone:ddv27i01, 3' ... 74 5e-27 4 (CU432552) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 70 5e-27 4 (EV047129) BNSCS3CT_UP_132_D08_10MAY2007_058 Brassica napus ... 82 1e-26 3 (EE435533) 5ETGS9H_UP_001_H08_15MAY2003_025 Brassica napus 5... 82 1e-26 4 (CT781684) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 1e-26 6 (L16578) Dictyostelium discoideum HIV1 TAT-binding protein h... 72 1e-26 5 (EC958132) WIN064.C21_L08 Cab Sauv seed normalized (WIN06) V... 86 2e-26 4 (GD183417) Ferret_011_E12 Ferret library from spleen, liver,... 52 2e-26 6 (BM902266) rc34a10.y1 Meloidogyne hapla egg pAMP1 v1 Meloido... 74 2e-26 5 (CX666409) UCRCP01_022_F03_T3 Swingle citrumelo nematode-cha... 72 2e-26 4 (EY376024) CAXA1595.rev CAXA Helobdella robusta Subtracted L... 62 2e-26 5 (EV021225) BNSCS2CT_UP_074_E07_18APR2007_055 Brassica napus ... 68 2e-26 4 (EG978025) GLL050_E05_020 Cyamopsis tetragonoloba (L.) Taub ... 80 3e-26 4 (FE364271) CBNO3183.rev CBNO_Daphnia_pulex_Chosen_One_Librar... 96 5e-26 3 (CV196498) CGF1003501_E11 Seed coat from mid-season walnut e... 96 6e-26 3 (CO093696) GR__Ea15G17.r GR__Ea Gossypium raimondii cDNA clo... 72 7e-26 5 (CO085503) GR__Ea02L09.f GR__Ea Gossypium raimondii cDNA clo... 72 8e-26 5 (FE340989) CAOF2648.fwd CAOF_Daphnia_pulex_Log50_Library_12 ... 96 8e-26 3 (FG611473) stem_S073_C04.SEQ Opium poppy stem cDNA library P... 72 9e-26 5 (FE340988) CAOF2648.rev CAOF_Daphnia_pulex_Log50_Library_12 ... 96 9e-26 3 (AL078470) Arabidopsis thaliana DNA chromosome 4, BAC clone ... 68 9e-26 4 (EV536474) RR2AJ29TF RR2(MS) Raphanus raphanistrum subsp. ra... 74 1e-25 4 (DT040680) Mdrtp1009E17.g1 Apple_EST_Mdrtp Malus x domestica... 64 1e-25 4 (ES799222) UFL_469_60 Cotton fiber 0-10 day post anthesis Go... 80 1e-25 4 (DT041967) Mdrtp1009L23.g1 Apple_EST_Mdrtp Malus x domestica... 64 1e-25 4 (EY391163) CAXA9119.rev CAXA Helobdella robusta Subtracted L... 62 1e-25 3 (EY341582) CAWZ11242.rev CAWZ Helobdella robusta Primary Lat... 62 1e-25 3 (CX292762) C04019C04SK FlavFr1 Citrus clementina cDNA clone ... 72 2e-25 3 (BQ477137) meladema3d09.g Meladema coriacea cDNA Meladema co... 78 2e-25 3 (CX288398) C01020A07SK Veg1 Citrus clementina cDNA clone C01... 72 2e-25 3 (DC892061) Citrus limon mRNA, clone: LLL0906, 5'-end sequenc... 72 2e-25 3 (CX667345) UCRCP01_030_F10_T3 Swingle citrumelo nematode-cha... 72 2e-25 3 (CX670536) UCRCP01_051_D12_T3 Swingle citrumelo nematode-cha... 72 2e-25 3 (EY802843) CR05-C3-702-015-A08-CT.F Mandarin fruit, developm... 72 2e-25 3 (CX070441) UCRCS08_16G08_b Parent Washington Navel Orange Ca... 72 2e-25 3 (AL078469) Arabidopsis thaliana DNA chromosome 4, BAC clone ... 68 2e-25 5 (ES836431) UFL_020_10 Cotton fiber 0-10 day post anthesis Go... 80 3e-25 4 (EY391013) CAXA9039.rev CAXA Helobdella robusta Subtracted L... 70 3e-25 4 (DV182387) CT006_E06_6_3700_90.ab1 C. tentans tissue culture... 54 3e-25 7 (DY231212) EST01961 BmP Bombyx mori cDNA clone BmpB_B147_200... 105 3e-25 2 (CX046791) UCRCS09_10C02_b Ruby Orange Developing Seed cDNA ... 72 3e-25 3 (BP115859) Bombyx mori cDNA, clone:brP-1694, 5' end sequence. 80 3e-25 4 (FG294645) 1108770716176 New World Screwworm Larvae 9387 EST... 92 3e-25 4 (FG290015) 1108793313320 New World Screwworm Egg 9261 ESTs C... 92 3e-25 4 (FG298875) 1108793322674 New World Screwworm Larvae 9387 EST... 92 3e-25 4 (FG291251) 1108793336342 New World Screwworm Egg 9261 ESTs C... 92 3e-25 4 (CJ589331) Triticum aestivum cDNA clone rwhsc20b16 3', Y.Ogi... 86 3e-25 2 (BQ802799) WHE2830_B06_C12ZS Triticum monococcum vernalized ... 86 3e-25 2 (AJ291500) Brassica napus homologue of SPH gene, AT4g29040 g... 64 5e-25 5 (FM978705) Glossina morsitans morsitans EST, clone GMsg104c0... 78 5e-25 3 (CK208139) FGAS019820 Triticum aestivum FGAS: Library 5 GATE... 86 5e-25 2 (FM977504) Glossina morsitans morsitans EST, clone GMsg116b1... 78 5e-25 3 (FM966839) Glossina morsitans morsitans EST, clone GMsg78a02... 78 5e-25 3 (EV104085) 0095777 Brassica napus Leaf library Brassica napu... 68 6e-25 4 (DT564768) EST1075408 GH_TMO Gossypium hirsutum cDNA, mRNA s... 44 6e-25 6 (DY373232) ZO__Ef0007G05.f ZO__Ef Zingiber officinale cDNA c... 84 8e-25 3 (FG083955) CMRC-FF-IH0-abv-g-18-0-CMRC.r1 Ceratitis capitata... 66 9e-25 4 (EY814162) PT11-C1-900-045-E02-CT.F Poncirus trifoliata leaf... 72 1e-24 3 (FK915535) EST_lsal_evj_932180 lsalevj mixed_tissue_mixed_st... 60 1e-24 6 (FK906880) EST_lsal_evj_937624 lsalevj mixed_tissue_mixed_st... 60 1e-24 6 (BP187728) Dugesia japonica cDNA, clone: 00164_HN, expressed... 127 1e-24 1 (AM456586) Vitis vinifera contig VV78X057212.45, whole genom... 54 1e-24 6 (FG456264) 011101KAIA001566HT (KAIA) Actinidia chinensis rip... 82 1e-24 5 (AJ559529) Antirrhinum majus EST, clone 018_1_10_j07. 64 1e-24 4 (DR908716) USDA-FP_16844 Citrus sinensis phloem Citrus sinen... 68 2e-24 3 (CU593577) Theobroma cacao, mRNA sequence (KZ0AAH7YB17FM1). 72 2e-24 4 (DY268216) IC0AAA23CD02RM1 CitNFL Citrus clementina cDNA 5',... 68 2e-24 5 (FK910145) EST_lsal_evj_948589 lsalevj mixed_tissue_mixed_st... 60 2e-24 6 (EY342458) CAWZ11923.rev CAWZ Helobdella robusta Primary Lat... 60 2e-24 3 (CX070442) UCRCS08_16G08_g Parent Washington Navel Orange Ca... 72 2e-24 4 (EE103880) SBB05271 Inflorescence (VvS11) Vitis vinifera cDN... 54 2e-24 4 (EE009871) ROE00004945 Rhizopus oryzae Company Rhizopus oryz... 70 3e-24 3 (DY280622) IC0AAA51CG09RM1 CitNFL Citrus clementina cDNA 5',... 50 3e-24 6 (EV774653) AGENCOURT_112388702 NIH_MGC_429 Rattus norvegicus... 52 3e-24 6 (CN184861) UCRCS04_0006D23_r Ruby Orange Developing Flower c... 68 3e-24 3 (EH704542) CCIS3428.b1_H18.ab1 CCI(LMS) chicory Cichorium in... 117 3e-24 2 (CV705803) UCRPT01_0007G14_f Poncirus trifoliata CTV-challen... 68 3e-24 3 (DN312882) PL06014A1E12 cDNA from juvenile hermaphodites Sch... 90 3e-24 3 (CX673808) UCRCS10_2A04_b Madame Vinous Sweet Orange Multipl... 68 3e-24 3 (AL161574) Arabidopsis thaliana DNA chromosome 4, contig fra... 68 3e-24 5 (EY818380) PT11-C1-900-097-E12-CT.F Poncirus trifoliata leaf... 68 4e-24 3 (EY814982) PT11-C1-900-057-G03-CT.F Poncirus trifoliata leaf... 68 4e-24 3 (EX285047) 1572404_5_M02_003 PY06 Carica papaya cDNA, mRNA s... 78 5e-24 4 (ES841963) UFL_082_82 Cotton fiber 0-10 day post anthesis Go... 56 5e-24 6 (GO110899) CAFZ9680.fwd CAFZ Alvinella pompejana Incyte regu... 92 5e-24 2 (CB916509) VVD026E04_370679 An expressed sequence tag databa... 86 5e-24 3 (AY105631) Zea mays PCO101908 mRNA sequence. 54 6e-24 5 (DT031016) VVL053A08_683658 CabSau Berry Postveraison Mixed ... 86 7e-24 3 (DR170476) 23_O06:A Triphysaria versicolor root-tip, early D... 62 8e-24 3 (EY371461) CAXA13459.rev CAXA Helobdella robusta Subtracted ... 60 8e-24 3 (EX347863) GQ03105.B7_H20 GQ031 - Xylem Scrapings (Normalize... 50 1e-23 7 (EY384423) CAXA5141.rev CAXA Helobdella robusta Subtracted L... 68 1e-23 5 (DL263348) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS. 80 1e-23 4 (DJ129797) Method for identification of useful proteins deri... 80 1e-23 4 (EV173269) 0156033 Brassica napus Etiolated seedlings (Uni-Z... 82 1e-23 4 (CB974163) CAB30004_IIa_Ra_E08 Cabernet Sauvignon Berry Stag... 86 1e-23 3 (ES492571) BIG_AF_386 Brine Shrimp embryos, 15 hours after h... 76 1e-23 2 (EC924945) WIN027.TB24.1_D17 Cab Sauv flower, leaf and root ... 86 1e-23 3 (FD494124) Ltu01b_116_E10_C012.g2 Liriodendron Flower Bud Li... 86 1e-23 4 (BM357203) 13II-H3 Triphysaria versicolor root-tip, early DM... 62 1e-23 3 (EX382794) GQ03305.B7_H20 GQ033 - Terminal leader (Normalize... 50 1e-23 7 (EU961657) Zea mays clone 237370 mRNA sequence. 54 1e-23 5 (FE311443) CANU3172.rev CANU_Daphnia_pulex_Log50_Library_7 D... 88 2e-23 3 (FE311444) CANU3172.fwd CANU_Daphnia_pulex_Log50_Library_7 D... 88 2e-23 3 (CN826766) EL1827R Brassica embryo library (EL) Brassica nap... 82 2e-23 4 (EX148870) ZRA620R ZRA Zoophthora radicans cDNA clone ZRA620... 68 2e-23 4 (AV555567) Arabidopsis thaliana cDNA clone:SQ018e02F, 3' end. 98 2e-23 3 (DV694582) CGN-39133 Seed of Late Development Stage Coffea c... 72 2e-23 4 (FG199243) AGN_PNL228br1_g7.trimmed.seq AGN_PNL Nicotiana ta... 74 2e-23 4 (FG197405) AGN_PNL225dr1_e3.trimmed.seq AGN_PNL Nicotiana ta... 74 3e-23 4 (FG159623) AGN_RNC021xe05r1.ab1 AGN_RNC Nicotiana tabacum cD... 74 3e-23 4 (EY368362) CAXA11764.rev CAXA Helobdella robusta Subtracted ... 70 3e-23 3 (EY378551) CAXA17324.rev CAXA Helobdella robusta Subtracted ... 62 3e-23 3 (BQ426672) CgHem 017-A-02 C. gigas Hemocytes Lambda Zap Expr... 98 3e-23 3 (EW716796) RS1BA15TF RS1(AR) Raphanus sativus var. oleiformi... 66 3e-23 4 (CV098356) FAMU_USDA_FP_6379 Vitis shuttleworthii L., grape ... 86 4e-23 3 (FG152878) AGN_RNC107xl01r1.ab1 AGN_RNC Nicotiana tabacum cD... 74 4e-23 4 (EH770754) CNSM3375.b1_N04.ab1 CNS(LMS) yellow starthistle C... 68 5e-23 5 (FG285330) 1108770700782 New World Screwworm Egg 9261 ESTs C... 84 6e-23 4 (BY943521) Bombyx mori cDNA, clone:E_FL_e100_21J20_R_0, 3' e... 98 6e-23 2 (DY241989) 2_H11_K101_2 malus abscission express library Mal... 66 6e-23 3 (FK927127) EST_lsal_evj_946984 lsalevj mixed_tissue_mixed_st... 60 6e-23 6 (DY389214) CL__Eb0002C11.r CL__Eb Curcuma longa cDNA clone C... 86 6e-23 3 (EX135780) BR119610 root cDNA library KHRT Brassica rapa sub... 56 7e-23 6 (CJ632645) Triticum aestivum cDNA clone whdp12d17 5', Y.Ogih... 94 7e-23 2 (CJ834259) Triticum aestivum cDNA clone:whatlal5k24, 5' end. 94 7e-23 2 (EW735429) RS3B948TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 74 7e-23 2 (CJ543588) Triticum aestivum cDNA clone rwhem5k13 3', Y.Ogih... 94 8e-23 2 (CB176636) PopSC00059 Poplar SC cDNA library Populus alba x ... 92 8e-23 4 (CJ524108) Triticum aestivum cDNA clone rwhdp12d17 3', Y.Ogi... 94 8e-23 2 (CU366461) Aphanomyces euteiches cDNA. 109 8e-23 2 (CU504215) Theobroma cacao, mRNA sequence (KZ0ACAB10YD05FM1). 84 9e-23 3 (FD452248) EGGAG38TR Haematobia irritans eggs Haematobia irr... 107 9e-23 3 (DY537298) ZM_BFb0271N08.r ZM_BFb Zea mays cDNA 5', mRNA seq... 54 9e-23 4 (CU352371) Aphanomyces euteiches cDNA. 109 9e-23 2 (FG080665) UI-FF-IH0-aay-f-02-0-UI.r1 Ceratitis capitata adu... 72 9e-23 4 (ES898071) 60ACAB48R_UP_019_B08_22OCT2004_062 Brassica napus... 68 1e-22 3 (CT580028) Pinus pinaster bud EST. 84 1e-22 3 (EE407836) 20ACACDS_UP_028_G01_05NOV2004_003 Brassica napus ... 68 1e-22 3 (CZ288251) cp57b12.r Candida parapsilosis Random Genomic Lib... 68 1e-22 4 (EY391014) CAXA9039.fwd CAXA Helobdella robusta Subtracted L... 64 1e-22 3 (FM969784) Glossina morsitans morsitans EST, clone GMsg82e05... 70 1e-22 3 (BM959240) PLATE_12_C11_05.AB1 GS Lambda-Triplex, 10 day ger... 64 1e-22 3 (FG567985) BN18DYSC_UP_176_F04_4APR2008_022 BN18DYSC Brassic... 68 1e-22 3 (ES802792) UFL_608_42 Cotton fiber 0-10 day post anthesis Go... 80 1e-22 4 (EV537238) RR2AS10TF RR2(MS) Raphanus raphanistrum subsp. ra... 74 1e-22 4 (DY385600) CL__Ea0005H15.r CL__Ea Curcuma longa cDNA clone C... 76 1e-22 3 (DY385481) CL__Ea0005E14.f CL__Ea Curcuma longa cDNA clone C... 76 1e-22 3 (BM900606) rc39e04.y1 Meloidogyne hapla egg pAMP1 v1 Meloido... 74 1e-22 4 (EH776238) CNSM8530.b1_C21.ab1 CNS(LMS) yellow starthistle C... 60 2e-22 5 (DT589215) she01-17ms2-d02 She01 Saruma henryi cDNA clone sh... 62 2e-22 4 (CT033067) Platynereis dumerilii EST IB0AAA27BB06EM1. 90 2e-22 4 (C91977) Dictyostelium discoideum slug cDNA, clone SSC647. 72 2e-22 5 (FK917207) EST_lsal_evj_952242 lsalevj mixed_tissue_mixed_st... 60 2e-22 5 (FK915536) EST_lsal_evj_956372 lsalevj mixed_tissue_mixed_st... 60 2e-22 5 (BQ622353) fch1c.pk002.o11 Conidiobolus cornatus ARSEF 512 C... 76 3e-22 3 (CG278977) OGVDX81TH ZM_0.7_1.5_KB Zea mays genomic clone ZM... 82 3e-22 2 (EV495542) sg058F08 Cotton Lambda Zap Express Library Gossyp... 80 3e-22 3 (CU362185) Aphanomyces euteiches cDNA. 107 4e-22 2 (BM260251) baa17f06.x1 Cassava EYC library1 Manihot esculent... 107 4e-22 3 (FC754825) CBBI8293.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 98 4e-22 4 (EE532748) 46RDOAG_UP_036_C09_27DEC2004_075 O. Alba 46RDOAG ... 82 4e-22 3 (GE510342) CCFT7479.g1_N21.ab1 CCF(STU) sunflower Helianthus... 107 5e-22 3 (DY263995) IC0AAA13BC04RM1 CitNFL Citrus clementina cDNA 5',... 58 5e-22 4 (FD948218) RS2GW23TF RS2(RS) Raphanus sativus cDNA 5', mRNA ... 74 5e-22 3 (EE089413) S6B04495 Fruits 7-9 mm (VvS6) Vitis vinifera cDNA... 86 6e-22 5 (DT593580) she01-24ms2-d03 She01 Saruma henryi cDNA clone sh... 54 6e-22 5 (DY279972) IC0AAA4DF08RM1 CitNFL Citrus clementina cDNA 5', ... 56 6e-22 5 (EX765812) RR3CV78TF RR3(NY) Raphanus raphanistrum subsp. ra... 74 7e-22 3 (DY924876) CHAY7989.b1_J06.ab1 CHA(XYZ) common wild sunflowe... 107 7e-22 3 (BJ344360) Dictyostelium discoideum cDNA clone:dda19b04, 3' ... 46 7e-22 7 (DT578129) she01-27ms2-d05 She01 Saruma henryi cDNA clone sh... 54 7e-22 5 (EY086428) CAZI17377.rev CAZI Artemisia annua normalized lea... 109 7e-22 2 (EY110176) CAZI6665.rev CAZI Artemisia annua normalized leaf... 109 7e-22 2 (EY072637) CAZI10311.rev CAZI Artemisia annua normalized lea... 109 7e-22 2 (DT579796) she01-10ms2-h04 She01 Saruma henryi cDNA clone sh... 54 7e-22 5 (FK906881) EST_lsal_evj_961816 lsalevj mixed_tissue_mixed_st... 60 8e-22 5 (DT592229) she01-31ms2-d04 She01 Saruma henryi cDNA clone sh... 54 8e-22 5 (DT592008) she01-31ms2-c01 She01 Saruma henryi cDNA clone sh... 54 8e-22 5 (ES839302) UFL_052_75 Cotton fiber 0-10 day post anthesis Go... 80 1e-21 3 (AV785235) Arabidopsis thaliana cDNA clone:RAFL06-13-G21, 3'... 98 1e-21 2 (EV042647) BNSCS3CT_UP_078_A10_04MAY2007_080 Brassica napus ... 68 1e-21 4 (CK298842) EST761556 Nicotiana benthamiana mixed tissue cDNA... 64 2e-21 4 (EH737476) CNMS10957.b1_I04.ab1 CNM(LMS) spotted knapweed Ce... 68 2e-21 4 (AY888761) Synthetic construct Homo sapiens clone FLH110001.... 46 2e-21 6 (AY888760) Synthetic construct Homo sapiens clone FLH110000.... 46 2e-21 6 (AY888759) Synthetic construct Homo sapiens clone FLH109996.... 46 2e-21 6 (BT009826) Homo sapiens proteasome (prosome, macropain) 26S ... 46 2e-21 6 (BI944726) sad67a04.y1 Gm-c1051 Glycine max cDNA clone GENOM... 76 2e-21 5 (AJ702920) Zantedeschia aethiopica EST, clone M-11-6. 64 2e-21 3 (EV540914) RR2AJ29JQ RR2(MS) Raphanus raphanistrum subsp. ra... 74 2e-21 4 (DY385563) CL__Ea0005G16.r CL__Ea Curcuma longa cDNA clone C... 72 2e-21 3 (AJ702898) Zantedeschia aethiopica EST, clone M-10-6. 64 2e-21 3 (BM901975) rc30g09.y1 Meloidogyne hapla egg pAMP1 v1 Meloido... 74 2e-21 4 (AK313325) Homo sapiens cDNA, FLJ93843, Homo sapiens proteas... 46 2e-21 6 (DQ894881) Synthetic construct Homo sapiens clone IMAGE:1000... 46 2e-21 6 (DQ891703) Synthetic construct clone IMAGE:100004333; FLH184... 46 2e-21 6 (ED522511) KBrB110G03F KBrB, Brassica rapa BamHI BAC library... 48 2e-21 5 (EH774814) CNSM7137.b1_A10.ab1 CNS(LMS) yellow starthistle C... 68 2e-21 5 (AC006081) Arabidopsis thaliana chromosome 2 clone T2G17 map... 56 3e-21 8 (FG518017) 030606KAZB006647HT (KAZB) Actinidia chinensis you... 103 3e-21 2 (EE002624) ROE00014244 Rhizopus oryzae Company Rhizopus oryz... 70 3e-21 2
>(BJ339806) Dictyostelium discoideum cDNA clone:dda10p07, 3' end, single read. Length = 718
Score = 1291 bits (651), Expect(3) = 0.0 Identities = 651/651 (100%) Strand = Plus / Minus
Query: 635 tgaaaaggcaccaaccgaatcctacagcgatatcggtggtttggaagcacaagttcaaga 694 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 718 tgaaaaggcaccaaccgaatcctacagcgatatcggtggtttggaagcacaagttcaaga 659
Query: 695 gatgaaagaagccatcgaattgccattgactcatccagagctctatgaggagattggtat 754 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 658 gatgaaagaagccatcgaattgccattgactcatccagagctctatgaggagattggtat 599
Query: 755 caaaccaccaaagggtgtcatcctctatggtgagccaggtactggtaagactttattagc 814 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 598 caaaccaccaaagggtgtcatcctctatggtgagccaggtactggtaagactttattagc 539
Query: 815 caaagccgtagcaaatcaaacatccgctacatttttacgtgttgtaggctcagaattaat 874 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 538 caaagccgtagcaaatcaaacatccgctacatttttacgtgttgtaggctcagaattaat 479
Query: 875 tcaaaagtatttaggtgatggtccaaaattagttcgtgaattattcagagttgcagatga 934 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 478 tcaaaagtatttaggtgatggtccaaaattagttcgtgaattattcagagttgcagatga 419
Query: 935 atgtgcaccatcaattgttttcattgatgaaatcgatgctgttggtaccaaacgttatga 994 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 418 atgtgcaccatcaattgttttcattgatgaaatcgatgctgttggtaccaaacgttatga 359
Query: 995 ttctcaatctggtggtgaacgtgaaattcaaagaactatgttggaactcttgaatcaatt 1054 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 358 ttctcaatctggtggtgaacgtgaaattcaaagaactatgttggaactcttgaatcaatt 299
Query: 1055 ggatggtttcgatgctagaaccgatgtaaaagttatcatggctacaaatcgtattgaaac 1114 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 298 ggatggtttcgatgctagaaccgatgtaaaagttatcatggctacaaatcgtattgaaac 239
Query: 1115 tttagatcctgctctcattcgtccaggtcgtatcgatcgtaaaattgaattccctcttcc 1174 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 238 tttagatcctgctctcattcgtccaggtcgtatcgatcgtaaaattgaattccctcttcc 179
Query: 1175 agatattaagaccaagagaaagatctttgaaattcatactgctaaaatgaatctctctga 1234 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 178 agatattaagaccaagagaaagatctttgaaattcatactgctaaaatgaatctctctga 119
Query: 1235 agatgttaaccttgaagagtttgttatgtctaaagatgatttatccggtgc 1285 ||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 118 agatgttaaccttgaagagtttgttatgtctaaagatgatttatccggtgc 68
Score = 56.0 bits (28), Expect(3) = 0.0 Identities = 28/28 (100%) Strand = Plus / Minus
Query: 1314 ggtcttttagcactcagagaacgtagaa 1341 |||||||||||||||||||||||||||| Sbjct: 42 ggtcttttagcactcagagaacgtagaa 15
Score = 40.1 bits (20), Expect(3) = 0.0 Identities = 20/20 (100%) Strand = Plus / Minus
Query: 1287 gatatcaaagccatctgtac 1306 |||||||||||||||||||| Sbjct: 67 gatatcaaagccatctgtac 48
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 102105510 Number of Hits to DB: 1,502,985,057 Number of extensions: 92527315 Number of successful extensions: 8791197 Number of sequences better than 10.0: 10982 Length of query: 1477 Length of database: 101,790,757,118 Length adjustment: 24 Effective length of query: 1453 Effective length of database: 99,340,224,878 Effective search space: 144341346747734 Effective search space used: 144341346747734 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.28 |
Homology vs Protein |
Query= Contig-U16520-1 (Contig-U16520-1Q) /CSM_Contig/Contig-U16520-1Q.Seq.d (1477 letters)
Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AC006081_7(AC006081|pid:none) Arabidopsis thaliana chromosome 2 ... 631 e-179 AF123391_1(AF123391|pid:none) Arabidopsis thaliana 26S proteasom... 631 e-179 AB161192_1(AB161192|pid:none) Arabidopsis thaliana HLR mRNA for ... 631 e-179 AY087584_1(AY087584|pid:none) Arabidopsis thaliana clone 36815 m... 627 e-178 AC150776_3(AC150776|pid:none) Medicago truncatula chromosome 7 c... 625 e-177 FB781850_1(FB781850|pid:none) Sequence 1123 from Patent WO200803... 620 e-176 BT054998_1(BT054998|pid:none) Zea mays full-length cDNA clone ZM... 620 e-176 AB037154_1(AB037154|pid:none) Oryza sativa Japonica Group OsRPT2... 619 e-175 EU959285_1(EU959285|pid:none) Zea mays clone 214269 26S protease... 618 e-175 D17789_1(D17789|pid:none) Oryza sativa Japonica Group mRNA for h... 618 e-175 (P46466) RecName: Full=26S protease regulatory subunit 4 homolog... 618 e-175 DQ440313_1(DQ440313|pid:none) Aedes aegypti clone AET-397 26S pr... 617 e-175 (P48601) RecName: Full=26S protease regulatory subunit 4; AltNam... 614 e-174 FN318152_1(FN318152|pid:none) Schistosoma japonicum isolate Anhu... 613 e-174 CP001325_99(CP001325|pid:none) Micromonas sp. RCC299 chromosome ... 612 e-173 AF432345_1(AF432345|pid:none) Tortula ruralis 26S proteasome reg... 610 e-173 A44468(A44468;B44468)26S proteasome regulatory chain 4 [validate... 605 e-171 (O16368) RecName: Full=Probable 26S protease regulatory subunit ... 603 e-171 (P62191) RecName: Full=26S protease regulatory subunit 4; AltNam... 603 e-171 AK222668_1(AK222668|pid:none) Homo sapiens mRNA for proteasome 2... 603 e-171 BT020983_1(BT020983|pid:none) Bos taurus proteasome (prosome, ma... 603 e-171 BC154336_1(BC154336|pid:none) Danio rerio proteasome (prosome, m... 602 e-170 AL935145_2(AL935145|pid:none) Zebrafish DNA sequence from clone ... 600 e-170 BT043952_1(BT043952|pid:none) Salmo salar clone HM4_3128 proteas... 600 e-170 BC067741_1(BC067741|pid:none) Homo sapiens proteasome (prosome, ... 600 e-170 BC049471_1(BC049471|pid:none) Danio rerio proteasome (prosome, m... 600 e-170 BT076124_1(BT076124|pid:none) Caligus rogercresseyi clone crog-e... 599 e-170 (Q90732) RecName: Full=26S protease regulatory subunit 4; AltNam... 599 e-170 BC054287_1(BC054287|pid:none) Xenopus laevis protease (prosome, ... 598 e-169 AB169562_1(AB169562|pid:none) Macaca fascicularis brain cDNA, cl... 598 e-169 BT058391_1(BT058391|pid:none) Salmo salar clone Contig273 26S pr... 590 e-167 BT073386_1(BT073386|pid:none) Oncorhynchus mykiss clone omyk-evn... 589 e-166 AE014185_79(AE014185|pid:none) Plasmodium falciparum 3D7 chromos... 585 e-165 AX497296_1(AX497296|pid:none) Sequence 63 from Patent WO0229058. 573 e-162 CP000496_248(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 570 e-161 CR382132_107(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 569 e-160 AE016818_336(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 568 e-160 L17040_1(L17040|pid:none) Saccharomyces cerevisiae ATPase gene, ... 566 e-160 CU928171_706(CU928171|pid:none) Kluyveromyces thermotolerans str... 565 e-159 CR380955_202(CR380955|pid:none) Candida glabrata strain CBS138 c... 565 e-159 FN392322_761(FN392322|pid:none) Pichia pastoris GS115 chromosome... 564 e-159 CR382126_636(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 562 e-158 CU928173_172(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 560 e-158 T48743(T48743)probable 26S ATP/ubiquitin-dependent proteinase ch... 560 e-158 CR382135_216(CR382135|pid:none) Debaryomyces hansenii strain CBS... 559 e-158 BT062241_1(BT062241|pid:none) Zea mays full-length cDNA clone ZM... 557 e-157 (P36612) RecName: Full=26S protease regulatory subunit 4 homolog... 552 e-155 AM270384_3(AM270384|pid:none) Aspergillus niger contig An17c0020... 550 e-155 AM920437_1474(AM920437|pid:none) Penicillium chrysogenum Wiscons... 546 e-154 AF227500_1(AF227500|pid:none) Trypanosoma brucei proteasome regu... 532 e-149 AM494950_89(AM494950|pid:none) Leishmania braziliensis chromosom... 530 e-149 AF517885_1(AF517885|pid:none) Griffithsia japonica isolate Gj112... 471 e-131 AY540192_1(AY540192|pid:none) Oreochromis mossambicus proteasome... 418 e-115 A99111(A99111) 26S proteasome AAA-ATPase subunit [imported] - Gu... 403 e-110 (P46507) RecName: Full=26S protease regulatory subunit 6B; AltNa... 393 e-107 DQ443126_1(DQ443126|pid:none) Bombyx mori 26S protease regulator... 392 e-107 AE014298_1620(AE014298|pid:none) Drosophila melanogaster chromos... 392 e-107 AY891401_1(AY891401|pid:none) Synthetic construct Homo sapiens c... 389 e-106 (P43686) RecName: Full=26S protease regulatory subunit 6B; AltNa... 389 e-106 (Q63570) RecName: Full=26S protease regulatory subunit 6B; AltNa... 389 e-106 AK050677_1(AK050677|pid:none) Mus musculus 9 days embryo whole b... 389 e-106 AL954724_8(AL954724|pid:none) Zebrafish DNA sequence from clone ... 389 e-106 BC060362_1(BC060362|pid:none) Xenopus laevis proteasome 26S ATPa... 389 e-106 BC080888_1(BC080888|pid:none) Xenopus tropicalis proteasome (pro... 389 e-106 AB170960_1(AB170960|pid:none) Macaca fascicularis brain cDNA clo... 388 e-106 AF020736_1(AF020736|pid:none) Homo sapiens ATPase homolog mRNA, ... 387 e-106 (O28303) RecName: Full=Proteasome-activating nucleotidase; AltNa... 387 e-106 AK160644_1(AK160644|pid:none) Mus musculus 10, 11 days embryo wh... 386 e-105 BT075424_1(BT075424|pid:none) Osmerus mordax clone omor-eva-511-... 386 e-105 BC055215_1(BC055215|pid:none) Danio rerio proteasome (prosome, m... 385 e-105 (P46502) RecName: Full=Probable 26S protease regulatory subunit ... 385 e-105 AM910987_174(AM910987|pid:none) Plasmodium knowlesi strain H chr... 383 e-105 FN357538_19(FN357538|pid:none) Schistosoma mansoni genome sequen... 383 e-104 BT078140_1(BT078140|pid:none) Lepeophtheirus salmonis Pacific fo... 382 e-104 FB781798_1(FB781798|pid:none) Sequence 1071 from Patent WO200803... 380 e-104 (P54775) RecName: Full=26S protease regulatory subunit 6B; AltNa... 379 e-103 CR940353_23(CR940353|pid:none) Theileria annulata strain Ankara ... 379 e-103 EU188624_3(EU188624|pid:none) Giardia intestinalis isolate JH hy... 378 e-103 EF148658_1(EF148658|pid:none) Populus trichocarpa x Populus delt... 378 e-103 EU188625_3(EU188625|pid:none) Giardia intestinalis isolate 55 hy... 378 e-103 AK071476_1(AK071476|pid:none) Oryza sativa Japonica Group cDNA c... 377 e-103 BT016035_1(BT016035|pid:none) Drosophila melanogaster RE01104 fu... 377 e-103 EF147477_1(EF147477|pid:none) Populus trichocarpa clone WS01231_... 377 e-103 AB070253_1(AB070253|pid:none) Oryza sativa Japonica Group OsRPT3... 375 e-102 (P54778) RecName: Full=26S protease regulatory subunit 6B homolo... 374 e-102 AE014297_1050(AE014297|pid:none) Drosophila melanogaster chromos... 373 e-101 (Q58576) RecName: Full=Proteasome-activating nucleotidase; AltNa... 370 e-101 AC104496_3(AC104496|pid:none) Trypanosoma cruzi strain CL Brener... 368 e-100 CP001326_453(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 367 e-100 AE014297_1051(AE014297|pid:none) Drosophila melanogaster chromos... 366 1e-99 CT005251_22(CT005251|pid:none) Leishmania major strain Friedlin,... 364 5e-99 AM502230_19(AM502230|pid:none) Leishmania infantum chromosome 12. 364 5e-99 (Q8TX03) RecName: Full=Proteasome-activating nucleotidase; AltNa... 363 9e-99 (Q8SQI9) RecName: Full=26S protease regulatory subunit 6B homolo... 362 2e-98 AM494949_23(AM494949|pid:none) Leishmania braziliensis chromosom... 362 2e-98 (Q5JHS5) RecName: Full=Proteasome-activating nucleotidase; AltNa... 361 3e-98 (Q8U4H3) RecName: Full=Proteasome-activating nucleotidase; AltNa... 358 4e-97 AM118080_27(AM118080|pid:none) Ustilago hordei mating type regio... 357 5e-97 (Q9V287) RecName: Full=Proteasome-activating nucleotidase; AltNa... 356 1e-96 AE017342_397(AE017342|pid:none) Cryptococcus neoformans var. neo... 355 2e-96 (O57940) RecName: Full=Proteasome-activating nucleotidase; AltNa... 354 4e-96 FM992689_281(FM992689|pid:none) Candida dubliniensis CD36 chromo... 353 9e-96 CP000678_354(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 353 9e-96 CP000589_215(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 353 1e-95 BX908789_22(BX908789|pid:none) Neurospora crassa DNA linkage gro... 352 2e-95 (Q6LWR0) RecName: Full=Proteasome-activating nucleotidase; AltNa... 350 1e-94 CP001463_852(CP001463|pid:none) Thermococcus sibiricus MM 739, c... 349 1e-94 (A6VHR1) RecName: Full=Proteasome-activating nucleotidase; AltNa... 349 2e-94 (Q0W257) RecName: Full=Proteasome-activating nucleotidase; AltNa... 348 2e-94 (A6UQT3) RecName: Full=Proteasome-activating nucleotidase; AltNa... 348 2e-94 (A9A916) RecName: Full=Proteasome-activating nucleotidase; AltNa... 348 3e-94 (A4G0S4) RecName: Full=Proteasome-activating nucleotidase; AltNa... 347 8e-94 CP000477_446(CP000477|pid:none) Methanosaeta thermophila PT, com... 345 2e-93 (Q2FQ56) RecName: Full=Proteasome-activating nucleotidase; AltNa... 345 2e-93 AK226206_1(AK226206|pid:none) Arabidopsis thaliana mRNA for 26S ... 345 2e-93 CR382130_485(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 344 4e-93 FB781822_1(FB781822|pid:none) Sequence 1095 from Patent WO200803... 342 2e-92 AF123395_1(AF123395|pid:none) Arabidopsis thaliana 26S proteasom... 342 2e-92 AB035272_1(AB035272|pid:none) Matricaria chamomilla McTBP1 mRNA ... 342 2e-92 AB033537_1(AB033537|pid:none) Oryza sativa Japonica Group OsRPT6... 342 3e-92 BT054955_1(BT054955|pid:none) Zea mays full-length cDNA clone ZM... 342 3e-92 AP007155_599(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 341 4e-92 EU162611_6(EU162611|pid:none) Capsella rubella clone contig46 BA... 341 4e-92 T27048(T27048) hypothetical protein Y49E10.1 - Caenorhabditis el... 341 4e-92 CP000743_1018(CP000743|pid:none) Methanococcus aeolicus Nankai-3... 340 6e-92 AF099922_3(AF099922|pid:none) Caenorhabditis elegans cosmid F56F... 340 8e-92 AY011124_1(AY011124|pid:none) Dactylis glomerata 26S proteasome ... 340 8e-92 CR382123_278(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 340 8e-92 AF099922_2(AF099922|pid:none) Caenorhabditis elegans cosmid F56F... 340 8e-92 CP001365_184(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 340 8e-92 CR380957_405(CR380957|pid:none) Candida glabrata strain CBS138 c... 340 1e-91 FM992689_795(FM992689|pid:none) Candida dubliniensis CD36 chromo... 340 1e-91 (Q8PY58) RecName: Full=Proteasome-activating nucleotidase; AltNa... 339 1e-91 AM502254_679(AM502254|pid:none) Leishmania infantum chromosome 36. 339 1e-91 AM494972_460(AM494972|pid:none) Leishmania braziliensis chromoso... 339 1e-91 AE008384_1006(AE008384|pid:none) Methanosarcina mazei strain Goe... 339 1e-91 AE016819_627(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 338 2e-91 CP000881_144(CP000881|pid:none) Hemiselmis andersenii chromosome... 338 3e-91 BT040193_1(BT040193|pid:none) Zea mays full-length cDNA clone ZM... 338 3e-91 CR382135_420(CR382135|pid:none) Debaryomyces hansenii strain CBS... 338 3e-91 CU633898_26(CU633898|pid:none) Podospora anserina genomic DNA ch... 338 4e-91 AL691439_2(AL691439|pid:none) Mouse DNA sequence from clone RP23... 338 4e-91 AK151370_1(AK151370|pid:none) Mus musculus bone marrow macrophag... 338 4e-91 AK167002_1(AK167002|pid:none) Mus musculus blastocyst blastocyst... 338 4e-91 AL691439_3(AL691439|pid:none) Mouse DNA sequence from clone RP23... 338 4e-91 (P17980) RecName: Full=26S protease regulatory subunit 6A; AltNa... 338 4e-91 BC103063_1(BC103063|pid:none) Bos taurus proteasome (prosome, ma... 338 4e-91 (Q63569) RecName: Full=26S protease regulatory subunit 6A; AltNa... 338 4e-91 AK168263_1(AK168263|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 338 4e-91 AJ720697_1(AJ720697|pid:none) Gallus gallus mRNA for hypothetica... 338 4e-91 BC107804_1(BC107804|pid:none) Homo sapiens proteasome (prosome, ... 338 4e-91 BT025458_1(BT025458|pid:none) Bos taurus proteasome (prosome, ma... 338 4e-91 BC075596_1(BC075596|pid:none) Xenopus tropicalis proteasome (pro... 338 4e-91 AB171905_1(AB171905|pid:none) Macaca fascicularis brain cDNA clo... 337 5e-91 CP001140_1265(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 337 5e-91 BT075406_1(BT075406|pid:none) Osmerus mordax clone omor-eva-504-... 337 5e-91 BC078375_1(BC078375|pid:none) Danio rerio proteasome (prosome, m... 337 5e-91 (O18413) RecName: Full=26S protease regulatory subunit 8; &AE01... 337 5e-91 D44467_1(D44467|pid:none) Homo sapiens mRNA for 26S proteasome s... 337 5e-91 AB171711_1(AB171711|pid:none) Macaca fascicularis brain cDNA clo... 337 5e-91 U97538_1(U97538|pid:none) Drosophila melanogaster DUG mRNA, comp... 337 5e-91 U77918_1(U77918|pid:none) Rattus norvegicus spermatogenic cell/s... 337 7e-91 CP000102_1167(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 337 7e-91 AP007172_18(AP007172|pid:none) Aspergillus oryzae RIB40 genomic ... 337 7e-91 AK167061_1(AK167061|pid:none) Mus musculus blastocyst blastocyst... 337 7e-91 (P62194) RecName: Full=26S protease regulatory subunit 8; AltNam... 337 7e-91 FN375083_1(FN375083|pid:none) Schistosoma mansoni genome sequenc... 337 7e-91 BT019726_1(BT019726|pid:none) Synthetic construct Homo sapiens p... 337 7e-91 AK222485_1(AK222485|pid:none) Homo sapiens mRNA for proteasome 2... 337 9e-91 (Q25544) RecName: Full=26S protease regulatory subunit 8 homolog... 337 9e-91 CU928171_100(CU928171|pid:none) Kluyveromyces thermotolerans str... 337 9e-91 (Q8TI88) RecName: Full=Proteasome-activating nucleotidase; AltNa... 336 1e-90 BT077485_1(BT077485|pid:none) Lepeophtheirus salmonis Pacific fo... 336 1e-90 AE010299_4158(AE010299|pid:none) Methanosarcina acetivorans str.... 336 1e-90 CP000099_606(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 336 1e-90 AL590451_186(AL590451|pid:none) chromosome IX of strain GB-M1 of... 335 2e-90 BC054164_1(BC054164|pid:none) Xenopus laevis proteasome (prosome... 335 2e-90 BT043367_1(BT043367|pid:none) Zea mays full-length cDNA clone ZM... 335 2e-90 BT034485_1(BT034485|pid:none) Zea mays full-length cDNA clone ZM... 335 2e-90 (O42586) RecName: Full=26S protease regulatory subunit 6A-B; Alt... 335 2e-90 AP002854_15(AP002854|pid:none) Oryza sativa Japonica Group genom... 335 3e-90 AK010505_1(AK010505|pid:none) Mus musculus ES cells cDNA, RIKEN ... 334 4e-90 L38810_1(L38810|pid:none) Homo sapiens thyroid receptor interact... 334 6e-90 AL590449_141(AL590449|pid:none) chromosome X of strain GB-M1 of ... 334 6e-90 (P54776) RecName: Full=26S protease regulatory subunit 6A homolo... 334 6e-90 D17788_1(D17788|pid:none) Oryza sativa Japonica Group mRNA for h... 334 6e-90 (Q9YAC7) RecName: Full=Proteasome-activating nucleotidase; AltNa... 333 7e-90 BT046299_1(BT046299|pid:none) Salmo salar clone ssal-eve-543-152... 333 7e-90 FB781802_1(FB781802|pid:none) Sequence 1075 from Patent WO200803... 333 1e-89 FN320332_1(FN320332|pid:none) Schistosoma japonicum isolate Anhu... 333 1e-89 AC136288_5(AC136288|pid:none) Medicago truncatula clone mth2-13o... 333 1e-89 (Q01939) RecName: Full=26S protease regulatory subunit 8 homolog... 332 2e-89 X66400_1(X66400|pid:none) S.cerevisiae SUG1 gene. 332 2e-89 AC009606_1(AC009606|pid:none) Arabidopsis thaliana chromosome II... 332 2e-89 CR382130_688(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 331 4e-89 (O04019) RecName: Full=26S protease regulatory subunit 6A homolo... 331 4e-89 AF412095_1(AF412095|pid:none) Arabidopsis thaliana At1g09100/F7G... 331 4e-89 BT080690_1(BT080690|pid:none) Caligus clemensi clone ccle-evs-50... 331 5e-89 AK065619_1(AK065619|pid:none) Oryza sativa Japonica Group cDNA c... 331 5e-89 DQ206972_1(DQ206972|pid:none) Schistosoma mansoni 26S proteasome... 330 6e-89 BT052739_1(BT052739|pid:none) Medicago truncatula clone MTYFH_FI... 330 6e-89 AB000493_1(AB000493|pid:none) Rattus norvegicus gene for proteas... 330 6e-89 CU928179_930(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 330 8e-89 CR859252_1(CR859252|pid:none) Pongo abelii mRNA; cDNA DKFZp469N2... 330 8e-89 AM180088_563(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 329 1e-88 (P34124) RecName: Full=26S protease regulatory subunit 8; AltNam... 328 2e-88 AF134402_1(AF134402|pid:none) Drosophila melanogaster Tat-bindin... 327 5e-88 (Q9HRW6) RecName: Full=Proteasome-activating nucleotidase 2; Alt... 327 7e-88 BX538350_38(BX538350|pid:none) Cryptosporidium parvum chromosome... 327 7e-88 AB171188_1(AB171188|pid:none) Macaca fascicularis brain cDNA clo... 327 9e-88 CP000816_585(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 327 9e-88 EF085905_1(EF085905|pid:none) Picea sitchensis clone WS0295_I06 ... 327 9e-88 FN357393_54(FN357393|pid:none) Schistosoma mansoni genome sequen... 326 1e-87 EF678275_1(EF678275|pid:none) Picea sitchensis clone WS02911_P12... 326 1e-87 AY627303_1(AY627303|pid:none) Haloferax volcanii DS2 proteasome-... 326 2e-87 AM910991_280(AM910991|pid:none) Plasmodium knowlesi strain H chr... 325 2e-87 AY596297_3126(AY596297|pid:none) Haloarcula marismortui ATCC 430... 325 2e-87 FB781816_1(FB781816|pid:none) Sequence 1089 from Patent WO200803... 325 3e-87 AM114193_1720(AM114193|pid:none) Uncultured methanogenic archaeo... 325 3e-87 CP001325_312(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 325 3e-87 AY750868_1(AY750868|pid:none) Toxoptera citricida putative 26S p... 325 3e-87 CP000559_1165(CP000559|pid:none) Methanocorpusculum labreanum Z,... 325 3e-87 AF067618_3(AF067618|pid:none) Caenorhabditis elegans cosmid F56H... 325 3e-87 CP000300_1963(CP000300|pid:none) Methanococcoides burtonii DSM 6... 324 4e-87 FN314258_1(FN314258|pid:none) Schistosoma japonicum isolate Anhu... 324 6e-87 CP000682_2236(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 324 6e-87 CP000575_899(CP000575|pid:none) Staphylothermus marinus F1, comp... 324 6e-87 AE014186_295(AE014186|pid:none) Plasmodium falciparum 3D7 chromo... 324 6e-87 DQ864866_1(DQ864866|pid:none) Pfiesteria piscicida clone ppi-5p-... 323 8e-87 CP000493_1096(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 323 1e-86 AE014297_4820(AE014297|pid:none) Drosophila melanogaster chromos... 322 2e-86 AC147002_2(AC147002|pid:none) Medicago truncatula clone mth2-151... 322 2e-86 CP001575_145(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 322 3e-86 AF035309_1(AF035309|pid:none) Homo sapiens clone 23598 mRNA, com... 322 3e-86 CR954203_112(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 321 5e-86 CP001399_1810(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 321 5e-86 AL691439_1(AL691439|pid:none) Mouse DNA sequence from clone RP23... 320 8e-86 EF676518_1(EF676518|pid:none) Picea sitchensis clone WS02740_E13... 318 2e-85 CR382130_373(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 318 3e-85 AY243360_1(AY243360|pid:none) Lactuca sativa clone 2 26S proteas... 318 3e-85 AM502240_60(AM502240|pid:none) Leishmania infantum chromosome 22. 318 4e-85 CT005261_60(CT005261|pid:none) Leishmania major strain Friedlin,... 318 4e-85 (O64982) RecName: Full=26S protease regulatory subunit 7; AltNam... 317 5e-85 AM494959_57(AM494959|pid:none) Leishmania braziliensis chromosom... 317 7e-85 CP000586_397(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 317 7e-85 BT042644_1(BT042644|pid:none) Zea mays full-length cDNA clone ZM... 317 9e-85 CR380947_109(CR380947|pid:none) Candida glabrata strain CBS138 c... 316 2e-84 CR936257_759(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 315 2e-84 AF227504_1(AF227504|pid:none) Trypanosoma brucei proteasome regu... 315 4e-84 AP005056_24(AP005056|pid:none) Oryza sativa Japonica Group genom... 314 5e-84 AE017350_312(AE017350|pid:none) Cryptococcus neoformans var. neo... 314 5e-84 (P33297) RecName: Full=26S protease regulatory subunit 6A; AltNa... 314 5e-84 EU016618_25(EU016618|pid:none) Uncultured marine microorganism H... 313 8e-84 CP000254_1009(CP000254|pid:none) Methanospirillum hungatei JF-1,... 313 1e-83 AY627304_1(AY627304|pid:none) Haloferax volcanii DS2 proteasome-... 312 2e-83 FB781856_1(FB781856|pid:none) Sequence 1129 from Patent WO200803... 311 3e-83 AP007154_387(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 311 5e-83 CR382125_922(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 311 5e-83 AP007155_52(AP007155|pid:none) Aspergillus oryzae RIB40 genomic ... 310 1e-82 CU638744_559(CU638744|pid:none) Podospora anserina genomic DNA c... 309 2e-82 AY229998_1(AY229998|pid:none) Sulfolobus acidocaldarius strain D... 309 2e-82 CU928178_417(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 309 2e-82 FN357312_3(FN357312|pid:none) Schistosoma mansoni genome sequenc... 308 3e-82 (Q975U2) RecName: Full=Proteasome-activating nucleotidase; AltNa... 308 3e-82 AC007915_8(AC007915|pid:none) Genomic sequence for Arabidopsis t... 308 3e-82 EF676776_1(EF676776|pid:none) Picea sitchensis clone WS02751_M22... 308 3e-82 BT081387_1(BT081387|pid:none) Drosophila melanogaster LP16188 fu... 308 4e-82 EF146866_1(EF146866|pid:none) Populus trichocarpa clone WS0121_F... 308 4e-82 FB781814_1(FB781814|pid:none) Sequence 1087 from Patent WO200803... 308 4e-82 AY814884_1(AY814884|pid:none) Schistosoma japonicum SJCHGC09284 ... 308 4e-82 DQ202365_1(DQ202365|pid:none) Schistosoma mansoni 26S proteasome... 307 6e-82 FN357393_55(FN357393|pid:none) Schistosoma mansoni genome sequen... 307 6e-82 AL590447_19(AL590447|pid:none) chromosome VII of strain GB-M1 of... 307 6e-82 FB781812_1(FB781812|pid:none) Sequence 1085 from Patent WO200803... 307 6e-82 FN314955_1(FN314955|pid:none) Schistosoma japonicum isolate Anhu... 307 6e-82 AM424422_1(AM424422|pid:none) Vitis vinifera contig VV78X256011.... 307 6e-82 AK063158_1(AK063158|pid:none) Oryza sativa Japonica Group cDNA c... 307 7e-82 BT040547_1(BT040547|pid:none) Zea mays full-length cDNA clone ZM... 307 7e-82 AB070254_1(AB070254|pid:none) Oryza sativa Japonica Group OsRPT4... 307 7e-82 BT067445_1(BT067445|pid:none) Zea mays full-length cDNA clone ZM... 307 7e-82 BT083190_1(BT083190|pid:none) Anoplopoma fimbria clone afim-evh-... 306 1e-81 AB033536_1(AB033536|pid:none) Oryza sativa Japonica Group OsRPT4... 306 1e-81 DQ440423_1(DQ440423|pid:none) Aedes aegypti clone AET-5666 26S p... 306 1e-81 AE017353_152(AE017353|pid:none) Cryptococcus neoformans var. neo... 306 1e-81 FN314957_1(FN314957|pid:none) Schistosoma japonicum isolate Anhu... 306 1e-81 AY241962_1(AY241962|pid:none) Dermacentor variabilis 26S proteas... 306 2e-81 AE014298_899(AE014298|pid:none) Drosophila melanogaster chromoso... 306 2e-81 BT077925_1(BT077925|pid:none) Lepeophtheirus salmonis Pacific fo... 306 2e-81 (O74445) RecName: Full=Probable 26S protease subunit rpt4; &CU3... 305 2e-81 AE017350_96(AE017350|pid:none) Cryptococcus neoformans var. neof... 305 3e-81 BC041186_1(BC041186|pid:none) Xenopus laevis proteasome 26S ATPa... 305 4e-81 BT075118_1(BT075118|pid:none) Osmerus mordax clone omor-rgc-504-... 305 4e-81 AY750867_1(AY750867|pid:none) Toxoptera citricida 26S protease r... 305 4e-81 BC053187_1(BC053187|pid:none) Danio rerio proteasome (prosome, m... 305 4e-81 AJ719466_1(AJ719466|pid:none) Gallus gallus mRNA for hypothetica... 305 4e-81 (P35998) RecName: Full=26S protease regulatory subunit 7; AltNam... 305 4e-81 EU446703_1(EU446703|pid:none) Synthetic construct Homo sapiens c... 305 4e-81 AC093701_1(AC093701|pid:none) Homo sapiens BAC clone RP11-1252L1... 305 4e-81 AB075520_1(AB075520|pid:none) Homo sapiens neuroblastoma cDNA, c... 305 4e-81 AY814317_1(AY814317|pid:none) Schistosoma japonicum SJCHGC06030 ... 304 5e-81 BC061542_1(BC061542|pid:none) Rattus norvegicus proteasome (pros... 304 5e-81 AE013599_464(AE013599|pid:none) Drosophila melanogaster chromoso... 304 6e-81 BX908808_47(BX908808|pid:none) Neurospora crassa DNA linkage gro... 304 6e-81 AY071182_1(AY071182|pid:none) Drosophila melanogaster RE23388 fu... 304 6e-81 AF024493_9(AF024493|pid:none) Caenorhabditis elegans cosmid F23F... 304 6e-81 AK298821_1(AK298821|pid:none) Homo sapiens cDNA FLJ52353 complet... 304 6e-81 (O17071) RecName: Full=Probable 26S protease regulatory subunit ... 304 6e-81 BT080753_1(BT080753|pid:none) Caligus clemensi clone ccle-evs-52... 303 8e-81 BT078547_1(BT078547|pid:none) Lepeophtheirus salmonis Pacific fo... 303 8e-81 AF227503_1(AF227503|pid:none) Trypanosoma brucei proteasome regu... 303 1e-80 CU633899_420(CU633899|pid:none) Podospora anserina genomic DNA c... 303 1e-80 AC125735_52(AC125735|pid:none) Leishmania major strain Friedlin ... 303 1e-80 DQ443392_1(DQ443392|pid:none) Bombyx mori 26S proteasome regulat... 302 2e-80 (Q63347) RecName: Full=26S protease regulatory subunit 7; AltNam... 302 2e-80 AE017347_370(AE017347|pid:none) Cryptococcus neoformans var. neo... 301 3e-80 AJ297368_1(AJ297368|pid:none) Giardia lamblia partial s4 gene fo... 301 3e-80 BT043940_1(BT043940|pid:none) Salmo salar clone HM4_1948 proteas... 301 3e-80 BC097594_1(BC097594|pid:none) Xenopus laevis hypothetical protei... 301 3e-80 BC080137_1(BC080137|pid:none) Xenopus tropicalis 26S protease re... 301 3e-80 CR954203_337(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 301 3e-80 BC064227_1(BC064227|pid:none) Xenopus tropicalis proteasome (pro... 301 4e-80 CP000583_331(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 301 5e-80 CR936257_2506(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 301 5e-80 BC073644_1(BC073644|pid:none) Xenopus laevis similar to proteaso... 301 5e-80 AY892558_1(AY892558|pid:none) Synthetic construct Homo sapiens c... 300 7e-80 AM502240_55(AM502240|pid:none) Leishmania infantum chromosome 22. 300 7e-80 BC107950_1(BC107950|pid:none) Rattus norvegicus proteasome (pros... 300 7e-80 BC057997_1(BC057997|pid:none) Mus musculus proteasome (prosome, ... 300 7e-80 CT005261_55(CT005261|pid:none) Leishmania major strain Friedlin,... 300 7e-80 AJ223384_1(AJ223384|pid:none) Manduca sexta mRNA for 26S proteas... 300 9e-80 EZ000460_1(EZ000460|pid:none) TSA: Culex tarsalis Ctar-313 26S p... 299 2e-79 CP000883_64(CP000883|pid:none) Hemiselmis andersenii chromosome ... 299 2e-79 CR382137_302(CR382137|pid:none) Debaryomyces hansenii strain CBS... 299 2e-79 AM494959_52(AM494959|pid:none) Leishmania braziliensis chromosom... 299 2e-79 CQ840920_1(CQ840920|pid:none) Sequence 15 from Patent EP1439230.... 298 3e-79 (Q86JA1) RecName: Full=26S protease regulatory subunit 7; AltNam... 298 3e-79 BT079937_1(BT079937|pid:none) Esox lucius clone eluc-evq-527-020... 298 3e-79 CR380951_271(CR380951|pid:none) Candida glabrata strain CBS138 c... 298 4e-79 FM992688_493(FM992688|pid:none) Candida dubliniensis CD36 chromo... 297 6e-79 AF227502_1(AF227502|pid:none) Trypanosoma brucei proteasome regu... 297 8e-79 AL844509_114(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 297 8e-79 AY208828_1(AY208828|pid:none) Rhipicephalus appendiculatus prote... 296 1e-78 DQ206974_1(DQ206974|pid:none) Schistosoma mansoni 26S proteasome... 296 1e-78 CR382130_469(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 296 1e-78 AL844509_63(AL844509|pid:none) Plasmodium falciparum 3D7 chromos... 296 2e-78 BT079180_1(BT079180|pid:none) Esox lucius clone eluc-evq-511-062... 296 2e-78 AK014354_1(AK014354|pid:none) Mus musculus 17 days embryo head c... 295 2e-78 CR940353_129(CR940353|pid:none) Theileria annulata strain Ankara... 295 2e-78 AM910996_49(AM910996|pid:none) Plasmodium knowlesi strain H chro... 295 3e-78 CP000099_389(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 294 5e-78 (Q9HNP9) RecName: Full=Proteasome-activating nucleotidase 1; Alt... 294 6e-78 BX538352_118(BX538352|pid:none) Cryptosporidium parvum chromosom... 294 6e-78 AJ010592_133(AJ010592|pid:none) Guillardia theta DNA for complet... 293 1e-77 FM992695_364(FM992695|pid:none) Candida dubliniensis CD36 chromo... 292 2e-77 AP007167_353(AP007167|pid:none) Aspergillus oryzae RIB40 genomic... 291 3e-77 AF083031_110(AF083031|pid:none) Guillardia theta nucleomorph chr... 291 3e-77 AM270035_12(AM270035|pid:none) Aspergillus niger contig An02c041... 291 3e-77 T49507(T49507)probable 26S proteasome regulatory particle chain ... 291 4e-77 (P53549) RecName: Full=26S protease subunit RPT4; AltName: Full=... 291 4e-77 CR380957_379(CR380957|pid:none) Candida glabrata strain CBS138 c... 290 7e-77 BT077020_1(BT077020|pid:none) Caligus rogercresseyi clone crog-e... 290 9e-77 AC159413_35(AC159413|pid:none) Trypanosoma brucei chromosome 7 c... 290 1e-76 FN392322_403(FN392322|pid:none) Pichia pastoris GS115 chromosome... 290 1e-76 AE010299_4017(AE010299|pid:none) Methanosarcina acetivorans str.... 289 2e-76 T39558(T39558)26S proteinase regulatory subunit 7 - fission yeas... 289 2e-76 AE008384_798(AE008384|pid:none) Methanosarcina mazei strain Goe1... 289 2e-76 CR382138_643(CR382138|pid:none) Debaryomyces hansenii strain CBS... 289 2e-76 CU928168_500(CU928168|pid:none) Kluyveromyces thermotolerans str... 287 6e-76 AE016814_74(AE016814|pid:none) Ashbya gossypii (= Eremothecium g... 287 6e-76 CP001338_484(CP001338|pid:none) Candidatus Methanosphaerula palu... 285 2e-75 CU928178_509(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 284 5e-75 BC025134_1(BC025134|pid:none) Mus musculus proteasome (prosome, ... 279 2e-73 FN357393_56(FN357393|pid:none) Schistosoma mansoni genome sequen... 279 2e-73 AK150989_1(AK150989|pid:none) Mus musculus bone marrow macrophag... 278 4e-73 BC030840_1(BC030840|pid:none) Mus musculus protease (prosome, ma... 277 8e-73 AB209036_1(AB209036|pid:none) Homo sapiens mRNA for proteasome 2... 277 8e-73 AB429248_1(AB429248|pid:none) Dicyema japonicum psmc3 gene for 2... 277 8e-73 AY809862_1(AY809862|pid:none) Schistosoma japonicum SJCHGC04980 ... 276 1e-72 AJ010592_143(AJ010592|pid:none) Guillardia theta DNA for complet... 274 5e-72 BC094063_1(BC094063|pid:none) Mus musculus proteasome (prosome, ... 273 9e-72 CP000882_30(CP000882|pid:none) Hemiselmis andersenii chromosome ... 270 1e-70 AB070252_1(AB070252|pid:none) Oryza sativa Japonica Group OsRPT1... 265 2e-69 AB170497_1(AB170497|pid:none) Macaca fascicularis brain cDNA clo... 262 2e-68 AK071386_1(AK071386|pid:none) Oryza sativa Japonica Group cDNA c... 262 2e-68 CR855073_5(CR855073|pid:none) Oryza sativa (indica cultivar-grou... 260 8e-68 BT073351_1(BT073351|pid:none) Oncorhynchus mykiss clone omyk-evn... 259 2e-67 AK150189_1(AK150189|pid:none) Mus musculus bone marrow macrophag... 259 2e-67 AJ010592_72(AJ010592|pid:none) Guillardia theta DNA for complete... 258 5e-67 AF115331_1(AF115331|pid:none) Amblyomma americanum 26S protease ... 246 2e-63 (Q58556) RecName: Full=Cell division cycle protein 48 homolog MJ... 240 1e-61 EF103413_1(EF103413|pid:none) Haliotis discus discus 26S proteas... 238 5e-61 AJ871357_1(AJ871357|pid:none) Nyctotherus ovalis partial gene fo... 237 9e-61 (O28972) RecName: Full=Cell division cycle protein 48 homolog AF... 236 2e-60 AM180088_1780(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 233 2e-59 CP000102_1047(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 232 2e-59 CP000609_1479(CP000609|pid:none) Methanococcus maripaludis C5, c... 231 4e-59 CP001398_1690(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 231 4e-59 CP000575_1105(CP000575|pid:none) Staphylothermus marinus F1, com... 230 9e-59 CP000505_671(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 229 2e-58 CP000493_291(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 229 3e-58 BX950229_176(BX950229|pid:none) Methanococcus maripaludis strain... 229 3e-58 CP001398_1723(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 228 3e-58 BA000001_713(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, c... 228 4e-58 CP000742_1163(CP000742|pid:none) Methanococcus vannielii SB, com... 228 6e-58 A69086(A69086) cell division control protein Cdc48 - Methanobact... 227 7e-58 AE000782_2073(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 227 7e-58 AB018433_1(AB018433|pid:none) Pyrococcus kodakaraensis Pk-cdcA g... 226 1e-57 CP000477_76(CP000477|pid:none) Methanosaeta thermophila PT, comp... 226 1e-57 AM180088_1817(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 226 1e-57 CP000855_1119(CP000855|pid:none) Thermococcus onnurineus NA1, co... 226 2e-57 B71196(B71196) probable transitional endoplasmic reticulum ATPas... 225 3e-57 AY596297_1361(AY596297|pid:none) Haloarcula marismortui ATCC 430... 225 3e-57 AE009950_963(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 225 3e-57 CP000477_519(CP000477|pid:none) Methanosaeta thermophila PT, com... 225 3e-57 AY596297_693(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 225 4e-57 EF575938_1(EF575938|pid:none) Oryza sativa (indica cultivar-grou... 224 5e-57 CP000493_1304(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 224 5e-57 AJ248284_97(AJ248284|pid:none) Pyrococcus abyssi complete genome... 224 8e-57 (Q9HPF0) RecName: Full=Protein cdcH; &AE004437_1275(AE004437|pi... 223 1e-56 CP001463_1373(CP001463|pid:none) Thermococcus sibiricus MM 739, ... 223 2e-56 CP000099_888(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 222 2e-56 AP006878_1158(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 222 3e-56 CR936257_1989(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 222 3e-56 GM015171_186(GM015171|pid:none) Sequence 1 from Patent EP1923464. 222 3e-56 AM180088_2248(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 222 3e-56 CP000968_194(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 221 7e-56 AE010299_1765(AE010299|pid:none) Methanosarcina acetivorans str.... 221 7e-56 AE017261_456(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 221 7e-56 CP000562_1555(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 220 9e-56 AK144998_1(AK144998|pid:none) Mus musculus mammary gland RCB-052... 220 9e-56 AM392939_1(AM392939|pid:none) Synthetic construct Homo sapiens c... 220 9e-56 AF361489_1(AF361489|pid:none) Homo sapiens spermatogenesis assoc... 220 9e-56 BC145302_1(BC145302|pid:none) Mus musculus spermatogenesis assoc... 220 9e-56 AK091384_1(AK091384|pid:none) Homo sapiens cDNA FLJ34065 fis, cl... 220 9e-56 (Q8NB90) RecName: Full=Spermatogenesis-associated protein 5; Alt... 220 9e-56 CP000866_101(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 220 9e-56 AM393832_1(AM393832|pid:none) Synthetic construct Homo sapiens c... 220 9e-56 AL627074_2(AL627074|pid:none) Mouse DNA sequence from clone RP23... 220 9e-56 CP000682_210(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 220 1e-55 CP001399_1960(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 220 1e-55 AB071016_1(AB071016|pid:none) Oryza sativa Japonica Group OsRPT5... 219 2e-55 BA000011_975(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 219 3e-55 AE004438_162(AE004438|pid:none) Halobacterium sp. NRC-1 plasmid ... 218 3e-55 AE009439_486(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 218 3e-55 AY255679_4(AY255679|pid:none) Sulfolobus acidocaldarius DSM 639 ... 218 3e-55 (O05209) RecName: Full=VCP-like ATPase; &AL445065_184(AL445065|... 218 5e-55 CP001365_2346(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 218 6e-55 AE010299_4460(AE010299|pid:none) Methanosarcina acetivorans str.... 218 6e-55 AE009441_467(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 218 6e-55 CP001147_615(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 217 8e-55 AE008384_1256(AE008384|pid:none) Methanosarcina mazei strain Goe... 217 1e-54 CP001338_250(CP001338|pid:none) Candidatus Methanosphaerula palu... 217 1e-54 CP000816_691(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 216 2e-54 CP001338_767(CP001338|pid:none) Candidatus Methanosphaerula palu... 214 5e-54 CP000660_1594(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 214 5e-54 CP000780_1589(CP000780|pid:none) Candidatus Methanoregula boonei... 214 7e-54 CP000866_11(CP000866|pid:none) Nitrosopumilus maritimus SCM1, co... 214 7e-54 CP000682_2198(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 214 8e-54 CP000561_2090(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 214 8e-54 AE000512_571(AE000512|pid:none) Thermotoga maritima MSB8, comple... 214 8e-54 CP001399_1656(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 214 8e-54 CP000504_677(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 214 8e-54 CP001404_1031(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 214 8e-54 CP000969_350(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 214 8e-54 CP000780_2417(CP000780|pid:none) Candidatus Methanoregula boonei... 213 1e-53 CP001365_2041(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 213 1e-53 AM114193_1763(AM114193|pid:none) Uncultured methanogenic archaeo... 213 1e-53 AE006470_296(AE006470|pid:none) Chlorobium tepidum TLS, complete... 213 2e-53 CP000099_2251(CP000099|pid:none) Methanosarcina barkeri str. Fus... 212 2e-53 CP001140_1067(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 212 3e-53 CP001624_454(CP001624|pid:none) Rhizobium leguminosarum bv. trif... 212 3e-53 CP000702_338(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 211 4e-53 CP001097_343(CP001097|pid:none) Chlorobium limicola DSM 245, com... 211 6e-53 CP000496_956(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 211 6e-53 CT573071_924(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 211 6e-53 CP000559_1115(CP000559|pid:none) Methanocorpusculum labreanum Z,... 211 7e-53 CP000300_1888(CP000300|pid:none) Methanococcoides burtonii DSM 6... 211 7e-53 L17042_1(L17042|pid:none) Sulfolobus acidocaldarius ATPase gene,... 211 7e-53 CP000878_907(CP000878|pid:none) Prochlorococcus marinus str. MIT... 211 7e-53 CP000300_1547(CP000300|pid:none) Methanococcoides burtonii DSM 6... 210 9e-53 CP001101_1912(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 210 9e-53 AE009441_2232(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 210 9e-53 CP000916_84(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 210 1e-52 AK098874_1(AK098874|pid:none) Oryza sativa Japonica Group cDNA c... 209 2e-52 EU606206_1(EU606206|pid:none) Dimocarpus longan cell division cy... 209 2e-52 FB781858_1(FB781858|pid:none) Sequence 1131 from Patent WO200803... 209 2e-52 FB906005_1(FB906005|pid:none) Sequence 125278 from Patent WO2008... 209 2e-52 CP000561_1786(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 209 2e-52 FB781494_1(FB781494|pid:none) Sequence 767 from Patent WO2008034... 209 2e-52 FB905989_1(FB905989|pid:none) Sequence 125262 from Patent WO2008... 209 2e-52 FB781568_1(FB781568|pid:none) Sequence 841 from Patent WO2008034... 209 2e-52 FB781564_1(FB781564|pid:none) Sequence 837 from Patent WO2008034... 209 2e-52 EU961444_1(EU961444|pid:none) Zea mays clone 235510 unknown mRNA. 209 2e-52 CP000142_1333(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 209 3e-52 AE009951_448(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 209 3e-52 CP000096_683(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 209 3e-52 AP006840_3195(AP006840|pid:none) Symbiobacterium thermophilum IA... 209 3e-52 GM965351_1(GM965351|pid:none) Sequence 683 from Patent WO2008142... 209 3e-52 CT005272_140(CT005272|pid:none) Leishmania major strain Friedlin... 209 3e-52 CP000698_2797(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 208 4e-52
>AC006081_7(AC006081|pid:none) Arabidopsis thaliana chromosome 2 clone T2G17 map mi148, complete sequence. &AY035072_1(AY035072|pid:none) &AY056335_1(AY056335|pid:none) &E84585(E84585) Length = 443
Score = 631 bits (1627), Expect = e-179 Identities = 314/437 (71%), Positives = 370/437 (84%) Frame = +3
Query: 117 NNQSQGQGDKGEXXXXXXXXXXXXXXXXXXXXXRRGAETSTKLPVITPHSKCKLKQLKLE 296 N Q + D GE ++G E + +LP +TP +KCKL+ LKLE Sbjct: 10 NRQGDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTKCKLRLLKLE 69
Query: 297 RIKDYLLMEQEFLQNYDLNQPKVDENSKEQADEKIIEELRGDPLTVGNLEEIIDDNHAIV 476 RIKDYLLME+EF+ N + +P + K + D +++LRG P++VGNLEE+ID+NHAIV Sbjct: 70 RIKDYLLMEEEFVANQERLKP---QEEKAEEDRSKVDDLRGTPMSVGNLEELIDENHAIV 126
Query: 477 SSTVGPEHYVRIMSFVDKSKLYLGATVLLNNKTLSVVGVIDGEVDPMVNVMKVEKAPTES 656 SS+VGPE+YV I+SFVDK +L G ++L++NK LSVVG++ EVDPMV+VMKVEKAP ES Sbjct: 127 SSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVEKAPLES 186
Query: 657 YSDIGGLEAQVQEMKEAIELPLTHPELYEEIGIKPPKGVILYGEPGTGKTLLAKAVANQT 836 Y+DIGGLEAQ+QE+KEA+ELPLTHPELYE+IGIKPPKGVILYGEPGTGKTLLAKAVAN T Sbjct: 187 YADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAKAVANST 246
Query: 837 SATFLRVVGSELIQKYLGDGPKLVRELFRVADECAPSIVFIDEIDAVGTKRYDSQSGGER 1016 SATFLRVVGSELIQKYLGDGPKLVRELFRVAD+ +PSIVFIDEIDAVGTKRYD+ SGGER Sbjct: 247 SATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDANSGGER 306
Query: 1017 EIQRTMLELLNQLDGFDARTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRK 1196 EIQRTMLELLNQLDGFD+R DVKVI+ATNRIE+LDPAL+RPGRIDRKIEFPLPDIKT+R+ Sbjct: 307 EIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRR 366
Query: 1197 IFEIHTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAK 1376 IF+IHT+KM L+EDVNLEEFVM+KD+ SGADIKAICTE+GLLALRERRM+VTH DFKKAK Sbjct: 367 IFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHVDFKKAK 426
Query: 1377 EKVLYRKTAGAPEGLYM 1427 EKV+++K G PEGLYM Sbjct: 427 EKVMFKKKEGVPEGLYM 443
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 2,141,154,537 Number of extensions: 43448479 Number of successful extensions: 152244 Number of sequences better than 10.0: 4524 Number of HSP's gapped: 148984 Number of HSP's successfully gapped: 4900 Length of query: 492 Length of database: 1,061,185,681 Length adjustment: 133 Effective length of query: 359 Effective length of database: 626,482,097 Effective search space: 224907072823 Effective search space used: 224907072823 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
2 |
AH (FL, L) |
0 |
AF (FL, S) |
5 |
SL (DIR, L) |
2 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
2 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
1 |
FC-IC (SUB) |
0 |