Contig-U03326-1 |
Contig ID |
Contig-U03326-1 |
Contig update |
2001. 8.29 |
Contig sequence |
|
Gap |
no gap |
Contig length |
1135 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
5085100 |
End point |
5083965 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
3 |
Number of EST |
2 |
Link to clone list |
U03326 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6. 9 |
Homology vs CSM-cDNA |
|
dna update |
2009. 5.31 |
Homology vs DNA |
Query= Contig-U03326-1 (Contig-U03326-1Q) /CSM_Contig/Contig-U03326-1Q.Seq.d (1135 letters)
Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 2242 0.0 1 (BJ431427) Dictyostelium discoideum cDNA clone:ddv14k03, 3' ... 1542 0.0 1 (AU271396) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 1068 0.0 1 (BJ413087) Dictyostelium discoideum cDNA clone:ddv14k03, 5' ... 880 0.0 1 (AC116982) Dictyostelium discoideum chromosome 2 map 3622643... 44 2e-04 10 (BJ382070) Dictyostelium discoideum cDNA clone:ddc43e24, 3' ... 36 0.001 4 (BJ352554) Dictyostelium discoideum cDNA clone:dda47k04, 3' ... 36 0.002 4 (BJ383803) Dictyostelium discoideum cDNA clone:ddc47d09, 3' ... 44 0.004 2 (Z81581) Caenorhabditis elegans Cosmid T02E1. 50 0.009 5 (AM469019) Vitis vinifera contig VV78X010459.6, whole genome... 46 0.042 2 (AC215317) Nomascus leucogenys BAC clone CH271-95H12 from ch... 36 0.11 7 (CU257642) Equus caballus GSS, BAC clone CH241-406E23, T7 en... 50 0.19 1 (CU018220) Equus caballus GSS, BAC clone CH241-91N7, T7 end ... 50 0.19 1 (EE623565) CHWS1571.b1_E09.ab1 CHW(LMS) silverleaf sunflower... 50 0.19 1 (DW058728) CLLY11357.b1_I08.ab1 CLL(XYZ) lettuce saligna Lac... 50 0.19 1 (BJ442023) Dictyostelium discoideum cDNA clone:ddv48h17, 3' ... 48 0.20 2 (AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 30 0.39 13 (AC153179) Bos taurus clone CH240-30O3, WORKING DRAFT SEQUEN... 40 0.60 4 (AM478853) Vitis vinifera contig VV78X238184.3, whole genome... 48 0.75 1 (AC145508) Dasypus novemcinctus clone VMRC5-464O17, complete... 48 0.75 1 (AC197844) Zea mays chromosome 7 clone CH201-97G1; ZMMBBc009... 48 0.75 1 (AC191735) Zea mays chromosome 7 clone ZMMBBb-475C16; ZMMBBb... 48 0.75 1 (DX432340) BE1066_I06_F IASMA L1 HindIII BAC library Vitis v... 48 0.75 1 (CG134742) PUFWG07TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 48 0.75 1 (CG134740) PUFWG07TB ZM_0.6_1.0_KB Zea mays genomic clone ZM... 48 0.75 1 (CC705470) OGWHO14TV ZM_0.7_1.5_KB Zea mays genomic clone ZM... 48 0.75 1 (CC612391) OGUEK76TV ZM_0.7_1.5_KB Zea mays genomic clone ZM... 48 0.75 1 (BZ997822) PUGIH64TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 48 0.75 1 (BZ997820) PUGIH64TB ZM_0.6_1.0_KB Zea mays genomic clone ZM... 48 0.75 1 (BZ987381) PUGGX40TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 48 0.75 1 (CO454360) MZCCL10202A05.g Maize Endosperm cDNA Library Zea ... 48 0.75 1 (BI416818) hasp002xg07f Heterobasidion annosum - Scots pine ... 48 0.75 1 (AC020604) Homo sapiens BAC clone RP11-536C12 from 2, comple... 36 0.84 7 (AZ678321) ENTHD64TF Entamoeba histolytica Sheared DNA Entam... 36 0.84 2 (AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 32 1.2 9 (AC165994) Bos taurus clone CH240-165I10, WORKING DRAFT SEQU... 42 1.2 5 (AC171224) Bos taurus clone CH240-310I1, WORKING DRAFT SEQUE... 44 1.2 4 (CP000982) Borrelia duttonii Ly plasmid pl26, complete seque... 36 1.7 5 (AC087240) Homo sapiens 12p BAC RP11-752F20 (Roswell Park Ca... 46 1.9 7 (AC193668) Zea mays chromosome 9 clone CH201-461K19; ZMMBBc0... 40 1.9 6 (AC158429) Ornithorhynchus anatinus clone OA_Bb-39B24, WORKI... 36 2.7 6 (AC055841) Homo sapiens chromosome 15 clone RP11-707D22 map ... 36 2.7 7 (AC231593) Monodelphis domestica clone VMRC18-950N21, WORKIN... 40 2.9 4 (X77691) W.suaveolens mitochondrial DNA intergenic region be... 46 3.0 1 (CT963112) Medicago truncatula chromosome 5 clone mth2-117d2... 46 3.0 1 (AM431583) Vitis vinifera contig VV78X182845.8, whole genome... 46 3.0 1 (Z46811) Caenorhabditis elegans Cosmid C09D8. 46 3.0 1 (AC152326) Bos taurus clone CH240-1G6, WORKING DRAFT SEQUENC... 46 3.0 1 (CU928244) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.0 1 (AC199059) Zea mays chromosome 10 clone CH201-460A17; ZMMBBc... 46 3.0 1 (AC198737) Zea mays chromosome 10 clone CH201-60F10; ZMMBBc0... 46 3.0 1 (AQ573870) nbxb0085C03f CUGI Rice BAC Library Oryza sativa J... 46 3.0 1 (EJ414920) 1093012175764 Global-Ocean-Sampling_GS-28-01-01-1... 46 3.0 1 (ED104207) AUAC-aax40d01.g1 Ascaris suum whole genome shotgu... 46 3.0 1 (CC310879) TAM32-20P7_Sp6.1 TAM32 Gallus gallus genomic clon... 46 3.0 1 (EL467223) CHTS5982.b2_K08.ab1 CHT(LMS) Jerusalem artichoke ... 46 3.0 1 (BU028220) QHH11C15.yg.ab1 QH_EFGHJ sunflower RHA280 Heliant... 46 3.0 1 (BQ978857) QHI6H16.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 46 3.0 1 (BQ912803) QHA2h05.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 46 3.0 1 (GE498820) CCFT1411.g1_E18.ab1 CCF(STU) sunflower Helianthus... 46 3.0 1 (AM946015) Streptococcus uberis 0140J complete genome. 46 3.0 1 (AC165742) Bos taurus clone CH240-164A17, WORKING DRAFT SEQU... 40 3.0 5 (AM450718) Vitis vinifera contig VV78X201609.7, whole genome... 34 3.2 4 (AC199971) Cavia porcellus clone CH234-15H18, WORKING DRAFT ... 40 3.2 6 (CU695235) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 36 3.3 4 (AC155669) Bos taurus clone CH240-45N11, WORKING DRAFT SEQUE... 34 3.4 7 (AC002089) Homo sapiens BAC clone CTA-308B22 from 7, complet... 36 3.6 4 (AC146044) Pan troglodytes BAC clone RP43-109N23 from chromo... 36 4.0 4 (CR536604) Zebrafish DNA sequence from clone DKEY-57A22 in l... 38 4.0 5 (CE776226) tigr-gss-dog-17000330631116 Dog Library Canis lup... 38 4.1 3 (AC232207) Monodelphis domestica clone VMRC18-652N14, WORKIN... 34 4.5 6 (AL359267) Human DNA sequence from clone RP11-384P3 on chrom... 40 4.9 7 (DX416774) MUGQ_CH252P030E07T7_GL414_076 CHORI-252 Vervet Mo... 34 4.9 3 (FI115623) MUGQ_CH252P487C18Sp6_CH0182_077 CHORI-252 Vervet ... 34 5.2 3 (AC147713) Medicago truncatula clone mth2-138b11, complete s... 40 5.3 7 (AC224445) Bos taurus clone CH240-484I10, WORKING DRAFT SEQU... 32 5.5 2 (BX088720) Zebrafish DNA sequence from clone CH211-195M2 in ... 34 5.5 2 (CT827865) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 34 5.6 2 (CR626902) Zebrafish DNA sequence from clone CH211-1F22 in l... 34 5.6 2 (CU855803) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 34 5.7 2 (AC084281) Homo sapiens BAC clone RP11-755P23 from 4, comple... 42 5.9 6 (EJ767855) 1092963327399 Global-Ocean-Sampling_GS-30-02-01-1... 38 6.1 3 (AM285304) Spiroplasma citri GII3-3X chromosome, contig Cont... 38 6.1 12 (EJ773828) 1092979401115 Global-Ocean-Sampling_GS-30-02-01-1... 38 6.2 3 (AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 32 6.3 13 (AC181069) Strongylocentrotus purpuratus clone R3-3050D13, W... 36 6.4 6 (DN247972) ACAE-aaa53l14.g1 Hydra EST UCI 5 Hydra magnipapil... 36 6.4 2 (CQ873160) Sequence 773 from Patent WO2004078949. 42 6.4 8 (AL590230) Human DNA sequence from clone RP11-254L20 on chro... 36 6.5 3 (AM426271) Vitis vinifera contig VV78X146771.11, whole genom... 36 6.7 5 (AM444719) Vitis vinifera contig VV78X011791.5, whole genome... 32 6.7 2 (CR936364) M.truncatula DNA sequence from clone MTH2-193I1 o... 42 6.8 4 (AC180105) Strongylocentrotus purpuratus clone R3-4008D12, W... 36 7.0 5 (EK291499) 1095462332127 Global-Ocean-Sampling_GS-31-01-01-1... 34 7.2 3 (EY831537) PT11-C2-300-064-B02-CT.F Poncirus trifoliata bark... 32 7.4 2 (EY881166) LT33-C1-003-052-F11-CT.F Tahiti lime leaf, greenh... 32 7.4 2 (BH677082) BOMHQ88TF BO_2_3_KB Brassica oleracea genomic clo... 34 7.4 2 (BX243039) Danio rerio genomic clone DKEY-236P19, genomic su... 34 7.5 2 (BZ435749) BONLM68TR BO_1.6_2_KB_tot Brassica oleracea genom... 34 7.5 2 (EY811824) PT11-C1-900-022-F08-CT.F Poncirus trifoliata leaf... 32 7.5 2 (ET075482) QM0AAB2BE07RM1 CCER1 Citrus clementina genomic cl... 32 7.6 2 (AG233861) Lotus japonicus DNA, clone:LjB25p03_r. 38 8.1 2 (AC165180) Muntiacus reevesi clone CH245-213D17, WORKING DRA... 44 8.2 8 (AB022862) Hydra magnipapillata mRNA for actin-binding prote... 36 8.6 2 (DN814622) ACAC-aac32d04.g1 Hydra EST UCI 7 Hydra magnipapil... 36 8.6 2 (AM464728) Vitis vinifera contig VV78X040120.10, whole genom... 38 8.7 4 (CU855529) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 8.7 5 (DN815385) ACAC-aab62a24.g1 Hydra EST UCI 7 Hydra magnipapil... 36 8.8 2 (CX832789) ACAC-aaa07c08.g1 Hydra EST UCI 7 Hydra magnipapil... 36 8.9 2 (DT617167) ACAH-aaa47d07.g1 Hydra_EST_UCI-10 Hydra magnipapi... 36 9.0 2 (CU469464) Candidatus Phytoplasma mali strain AT complete ch... 32 9.2 17 (AC073856) Homo sapiens 3 BAC RP11-938G16 (Roswell Park Canc... 36 9.2 3 (CV042168) tai68b03.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 40 9.4 2 (AL161789) Human DNA sequence from clone RP11-490H9 on chrom... 36 9.5 5 (BX927322) Zebrafish DNA sequence from clone CH211-101J8 in ... 38 9.8 8 (CU570854) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 9.9 5 (ET077917) QM0AAB5DE11RM1 CCER1 Citrus clementina genomic cl... 38 10.0 2
>(AC116305) Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, complete sequence. Length = 413138
Score = 2242 bits (1131), Expect = 0.0 Identities = 1134/1135 (99%) Strand = Plus / Plus
Query: 1 gtaatggtgatactataattggttttgaagttattgttgaatttgatggtttacattttg 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 235898 gtaatggtgatactataattggttttgaagttattgttgaatttgatggtttacattttg 235957
Query: 61 gaatataaaaacctaaagttggatgaggaccaatctctaaaaagattgcattcttgtatg 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 235958 gaatataaaaacctaaagttggatgaggaccaatctctaaaaagattgcattcttgtatg 236017
Query: 121 attcattttcttcaatgaaattgaaaatgtttgaaatggctttggtgaattcaacaggca 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236018 attcattttcttcaatgaaattgaaaatgtttgaaatggctttggtgaattcaacaggca 236077
Query: 181 tacgtaaattatcataaatgtattgaacattgtagaaacctttatgagataattgtgaac 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236078 tacgtaaattatcataaatgtattgaacattgtagaaacctttatgagataattgtgaac 236137
Query: 241 cagtaattgttgaaaagaatggtacacatggtacatttgattctggtaaatctgataaat 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236138 cagtaattgttgaaaagaatggtacacatggtacatttgattctggtaaatctgataaat 236197
Query: 301 ctttgaatatcttttctttaatcatttcttgttttgatgagtggaaagaacatggtgtac 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236198 ctttgaatatcttttctttaatcatttcttgttttgatgagtggaaagaacatggtgtac 236257
Query: 361 ctaagaaagcacaaaaaacaccttcagctgatagtgttgatttagcacctaacaaatctt 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236258 ctaagaaagcacaaaaaacaccttcagctgatagtgttgatttagcacctaacaaatctt 236317
Query: 421 gttcagaaccagtaataacaattgaatttggatcattataacaagctatttcaatttctg 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236318 gttcagaaccagtaataacaattgaatttggatcattataacaagctatttcaatttctg 236377
Query: 481 gatataataaagcacatttttcaagataagcatcagcaccgataccaattgataataatc 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236378 gatataataaagcacatttttcaagataagcatcagcaccgataccaattgataataatc 236437
Query: 541 taccagttcccattgttaaattttgagctaagcccctatagtaaacgattttaacagcag 600 |||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||| Sbjct: 236438 taccagttcccattgttaaattttgagctaagcctctatagtaaacgattttaacagcag 236497
Query: 601 tttctaaactgatgacaccagagaataaagcggatgaaacttcaccaaaactatgaccaa 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236498 tttctaaactgatgacaccagagaataaagcggatgaaacttcaccaaaactatgaccaa 236557
Query: 661 ctacaattgatggtgaaataccaaatgatttataaagtgcgactaaaccaacttgaatta 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236558 ctacaattgatggtgaaataccaaatgatttataaagtgcgactaaaccaacttgaatta 236617
Query: 721 agaaaatacttggttgtgctaaaattggatgatgaatttctggtgaatcatcactttcta 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236618 agaaaatacttggttgtgctaaaattggatgatgaatttctggtgaatcatcactttcta 236677
Query: 781 atgaacgtaacttttggagtattgaatatccaaaataattagcaagtaatttatcacaat 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236678 atgaacgtaacttttggagtattgaatatccaaaataattagcaagtaatttatcacaat 236737
Query: 841 gatcaatggcatctttaaatactgattcagtttcatataatgctttacccatatctctcc 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236738 gatcaatggcatctttaaatactgattcagtttcatataatgctttacccatatctctcc 236797
Query: 901 attgtgggccttgaccggtgaaaacataaatgactggagttgatgaagctggtgctgaaa 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236798 attgtgggccttgaccggtgaaaacataaatgactggagttgatgaagctggtgctgaaa 236857
Query: 961 ttgttgaagtcaatgatgaagttgatgtagtttcatttcttttatttaaaaagtcatccc 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236858 ttgttgaagtcaatgatgaagttgatgtagtttcatttcttttatttaaaaagtcatccc 236917
Query: 1021 aatcggaagcggttataacttttctctttattaaatttgattttgaaattgtttgatgtt 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236918 aatcggaagcggttataacttttctctttattaaatttgattttgaaattgtttgatgtt 236977
Query: 1081 ttacaaaatctttaaataatattgtatctttataaatagattggtttgaaattaa 1135 ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236978 ttacaaaatctttaaataatattgtatctttataaatagattggtttgaaattaa 237032
Score = 2155 bits (1087), Expect = 0.0 Identities = 1123/1135 (98%) Strand = Plus / Minus
Query: 1 gtaatggtgatactataattggttttgaagttattgttgaatttgatggtttacattttg 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209445 gtaatggtgatactataattggttttgaagttattgttgaatttgatggtttacattttg 209386
Query: 61 gaatataaaaacctaaagttggatgaggaccaatctctaaaaagattgcattcttgtatg 120 |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209385 gaatgtaaaaacctaaagttggatgaggaccaatctctaaaaagattgcattcttgtatg 209326
Query: 121 attcattttcttcaatgaaattgaaaatgtttgaaatggctttggtgaattcaacaggca 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209325 attcattttcttcaatgaaattgaaaatgtttgaaatggctttggtgaattcaacaggca 209266
Query: 181 tacgtaaattatcataaatgtattgaacattgtagaaacctttatgagataattgtgaac 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209265 tacgtaaattatcataaatgtattgaacattgtagaaacctttatgagataattgtgaac 209206
Query: 241 cagtaattgttgaaaagaatggtacacatggtacatttgattctggtaaatctgataaat 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209205 cagtaattgttgaaaagaatggtacacatggtacatttgattctggtaaatctgataaat 209146
Query: 301 ctttgaatatcttttctttaatcatttcttgttttgatgagtggaaagaacatggtgtac 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209145 ctttgaatatcttttctttaatcatttcttgttttgatgagtggaaagaacatggtgtac 209086
Query: 361 ctaagaaagcacaaaaaacaccttcagctgatagtgttgatttagcacctaacaaatctt 420 ||||||||||||||||||||||||||||||||||||| ||||||||||||| |||||||| Sbjct: 209085 ctaagaaagcacaaaaaacaccttcagctgatagtgtcgatttagcacctagcaaatctt 209026
Query: 421 gttcagaaccagtaataacaattgaatttggatcattataacaagctatttcaatttctg 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 209025 gttcagaaccagtaataacaattgaatttggatcattataacaagctatttcaatttctg 208966
Query: 481 gatataataaagcacatttttcaagataagcatcagcaccgataccaattgataataatc 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208965 gatataataaagcacatttttcaagataagcatcagcaccgataccaattgataataatc 208906
Query: 541 taccagttcccattgttaaattttgagctaagcccctatagtaaacgattttaacagcag 600 |||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||| Sbjct: 208905 taccagttcccattgttaaattttgagctaagcctctatagtaaacgattttaacagcag 208846
Query: 601 tttctaaactgatgacaccagagaataaagcggatgaaacttcaccaaaactatgaccaa 660 ||||||||||||||||| |||||||||||||||||| || |||||||||||||||||||| Sbjct: 208845 tttctaaactgatgacatcagagaataaagcggatggaatttcaccaaaactatgaccaa 208786
Query: 661 ctacaattgatggtgaaataccaaatgatttataaagtgcgactaaaccaacttgaatta 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208785 ctacaattgatggtgaaataccaaatgatttataaagtgcgactaaaccaacttgaatta 208726
Query: 721 agaaaatacttggttgtgctaaaattggatgatgaatttctggtgaatcatcactttcta 780 ||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| Sbjct: 208725 agaaaatacttggttgtgctaaaattggatgatgaatttctggtgaatcttcactttcta 208666
Query: 781 atgaacgtaacttttggagtattgaatatccaaaataattagcaagtaatttatcacaat 840 ||||| |||||||||||||||| ||||||||||||||||||||||||||||||||||||| Sbjct: 208665 atgaaagtaacttttggagtatagaatatccaaaataattagcaagtaatttatcacaat 208606
Query: 841 gatcaatggcatctttaaatactgattcagtttcatataatgctttacccatatctctcc 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208605 gatcaatggcatctttaaatactgattcagtttcatataatgctttacccatatctctcc 208546
Query: 901 attgtgggccttgaccggtgaaaacataaatgactggagttgatgaagctggtgctgaaa 960 |||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208545 attgtgggccttgaccagtgaaaacataaatgactggagttgatgaagctggtgctgaaa 208486
Query: 961 ttgttgaagtcaatgatgaagttgatgtagtttcatttcttttatttaaaaagtcatccc 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208485 ttgttgaagtcaatgatgaagttgatgtagtttcatttcttttatttaaaaagtcatccc 208426
Query: 1021 aatcggaagcggttataacttttctctttattaaatttgattttgaaattgtttgatgtt 1080 |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208425 aatcggaagctgttataacttttctctttattaaatttgattttgaaattgtttgatgtt 208366
Query: 1081 ttacaaaatctttaaataatattgtatctttataaatagattggtttgaaattaa 1135 ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 208365 ttacaaaatctttaaataatattgtatctttataaatagattggtttgaaattaa 208311
Score = 38.2 bits (19), Expect(15) = 4.8 Identities = 19/19 (100%) Strand = Plus / Plus
Query: 1054 aatttgattttgaaattgt 1072 ||||||||||||||||||| Sbjct: 349074 aatttgattttgaaattgt 349092
Score = 30.2 bits (15), Expect(15) = 4.8 Identities = 18/19 (94%) Strand = Plus / Plus
Query: 269 tggtacatttgattctggt 287 |||||||||||||| |||| Sbjct: 135019 tggtacatttgattgtggt 135037
Score = 28.2 bits (14), Expect(15) = 4.8 Identities = 14/14 (100%) Strand = Plus / Plus
Query: 15 ataattggttttga 28 |||||||||||||| Sbjct: 56370 ataattggttttga 56383
Score = 28.2 bits (14), Expect(15) = 4.8 Identities = 14/14 (100%) Strand = Plus / Plus
Query: 287 taaatctgataaat 300 |||||||||||||| Sbjct: 170828 taaatctgataaat 170841
Score = 28.2 bits (14), Expect(15) = 4.8 Identities = 14/14 (100%) Strand = Plus / Plus
Query: 303 ttgaatatcttttc 316 |||||||||||||| Sbjct: 212232 ttgaatatcttttc 212245
Score = 28.2 bits (14), Expect(15) = 4.8 Identities = 14/14 (100%) Strand = Plus / Plus
Query: 526 caattgataataat 539 |||||||||||||| Sbjct: 267194 caattgataataat 267207
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 131 ttcaatgaaattg 143 ||||||||||||| Sbjct: 108948 ttcaatgaaattg 108960
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 140 attgaaaatgttt 152 ||||||||||||| Sbjct: 118184 attgaaaatgttt 118196
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 474 atttctggatata 486 ||||||||||||| Sbjct: 265453 atttctggatata 265465
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 658 caactacaattga 670 ||||||||||||| Sbjct: 294927 caactacaattga 294939
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 16/17 (94%) Strand = Plus / Plus
Query: 677 aataccaaatgatttat 693 |||| |||||||||||| Sbjct: 313549 aataacaaatgatttat 313565
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 950 tggtgctgaaatt 962 ||||||||||||| Sbjct: 340727 tggtgctgaaatt 340739
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 16/17 (94%) Strand = Plus / Plus
Query: 995 atttcttttatttaaaa 1011 |||| |||||||||||| Sbjct: 346107 attttttttatttaaaa 346123
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 1091 tttaaataatatt 1103 ||||||||||||| Sbjct: 353395 tttaaataatatt 353407
Score = 26.3 bits (13), Expect(15) = 4.8 Identities = 13/13 (100%) Strand = Plus / Plus
Query: 1110 ttataaatagatt 1122 ||||||||||||| Sbjct: 385100 ttataaatagatt 385112
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 102105510 Number of Hits to DB: 1,611,005,313 Number of extensions: 99775498 Number of successful extensions: 8577675 Number of sequences better than 10.0: 117 Length of query: 1135 Length of database: 101,790,757,118 Length adjustment: 24 Effective length of query: 1111 Effective length of database: 99,340,224,878 Effective search space: 110366989839458 Effective search space used: 110366989839458 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.27 |
Homology vs Protein |
Query= Contig-U03326-1 (Contig-U03326-1Q) /CSM_Contig/Contig-U03326-1Q.Seq.d (1135 letters)
Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q869W9) RecName: Full=Probable polyketide synthase 16; ... 712 0.0 (Q869X2) RecName: Full=Probable polyketide synthase 17; ... 703 0.0 (Q55E72) RecName: Full=Probable polyketide synthase 1; ... 301 3e-80 (Q54QD1) RecName: Full=Probable polyketide synthase 23; ... 295 2e-78 (Q55DM7) RecName: Full=Probable polyketide synthase 2; ... 293 1e-77 (Q54ED6) RecName: Full=Probable polyketide synthase 41; ... 290 9e-77 (Q54KU5) RecName: Full=Probable polyketide synthase 24; ... 282 2e-74 (B0G170) RecName: Full=Probable polyketide synthase 28; ... 280 9e-74 (Q54KU3) RecName: Full=Probable polyketide synthase 25; ... 277 4e-73 (Q54G30) RecName: Full=Probable polyketide synthase 27; ... 277 6e-73 (Q54TW0) RecName: Full=Probable polyketide synthase 18; ... 276 8e-73 (Q54FQ3) RecName: Full=Probable polyketide synthase 29; ... 275 2e-72 (Q54B49) RecName: Full=Probable polyketide synthase 45; ... 275 2e-72 (B0G100) RecName: Full=Probable polyketide synthase 7; ... 275 3e-72 AC116982_23(AC116982|pid:none) Dictyostelium discoideum chromoso... 275 3e-72 (Q54FC8) RecName: Full=Probable polyketide synthase 39; ... 274 5e-72 (B0G101) RecName: Full=Probable polyketide synthase 8/35; ... 273 8e-72 AC116982_20(AC116982|pid:none) Dictyostelium discoideum chromoso... 269 1e-70 (B0G0Z9) RecName: Full=Probable polyketide synthase 6; ... 269 1e-70 (Q54FN7) RecName: Full=Probable polyketide synthase 33; ... 267 6e-70 (Q54FD2) RecName: Full=Probable polyketide synthase 38; ... 265 3e-69 AC117176_58(AC117176|pid:none) Dictyostelium discoideum chromoso... 263 9e-69 (Q559A9) RecName: Full=Probable polyketide synthase 13; ... 263 9e-69 (Q558Y6) RecName: Full=Probable polyketide synthase 14; ... 260 6e-68 AC116963_16(AC116963|pid:none) Dictyostelium discoideum chromoso... 254 4e-66 (B0G103) RecName: Full=Probable polyketide synthase 10; ... 244 3e-63 AC116982_72(AC116982|pid:none) Dictyostelium discoideum chromoso... 244 3e-63 (Q558W4) RecName: Full=Probable polyketide synthase 15; ... 234 4e-60 AC117075_22(AC117075|pid:none) Dictyostelium discoideum chromoso... 234 4e-60 AP009552_2780(AP009552|pid:none) Microcystis aeruginosa NIES-843... 174 7e-42 CP000282_3715(CP000282|pid:none) Saccharophagus degradans 2-40, ... 173 1e-41 EF028635_5(EF028635|pid:none) Lysobacter enzymogenes strain C3 H... 172 2e-41 EU569687_1(EU569687|pid:none) Pseudoalteromonas sp. NJ632 polyke... 172 2e-41 CP000934_3129(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 172 3e-41 AP009493_814(AP009493|pid:none) Streptomyces griseus subsp. gris... 171 4e-41 BA000045_1954(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 171 4e-41 AE001437_3300(AE001437|pid:none) Clostridium acetobutylicum ATCC... 170 1e-40 CP000850_2328(CP000850|pid:none) Salinispora arenicola CNS-205, ... 170 1e-40 AJ698723_1(AJ698723|pid:none) Stigmatella aurantiaca myxochromid... 167 8e-40 BA000045_2829(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 166 2e-39 AP006618_4340(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 165 3e-39 CP000875_1864(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 165 3e-39 AJ871581_7(AJ871581|pid:none) Streptomyces achromogenes subsp. r... 164 7e-39 AC2012(AC2012) hypothetical protein all1649 [imported] - Nostoc ... 160 6e-38 CP000117_4713(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 160 1e-37 CP000875_2400(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 159 1e-37 AM946600_12(AM946600|pid:none) Chondromyces crocatus ajudazol bi... 159 2e-37 DQ897667_18(DQ897667|pid:none) Polyangium cellulosum strain So c... 155 2e-36 CU458896_2190(CU458896|pid:none) Mycobacterium abscessus chromos... 155 3e-36 AJ639921_1(AJ639921|pid:none) Uncultured bacterium partial pks4 ... 155 3e-36 AF319998_6(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 154 4e-36 DQ190053_2(DQ190053|pid:none) Cystobacter fuscus MmxC (mmxC) and... 154 7e-36 AF521085_11(AF521085|pid:none) Streptomyces nanchangensis NS3226... 154 7e-36 CP001037_2811(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 153 1e-35 AF081920_5(AF081920|pid:none) Pseudomonas fluorescens strain Pf-... 152 2e-35 AF204805_2(AF204805|pid:none) Nostoc sp. GSV224 nostopeptolide b... 152 3e-35 DQ897668_8(DQ897668|pid:none) Polyangium cellulosum strain So ce... 152 3e-35 AM270193_47(AM270193|pid:none) Aspergillus niger contig An09c004... 152 3e-35 AF210843_9(AF210843|pid:none) Sorangium cellulosum strain So ce9... 152 3e-35 AF521085_10(AF521085|pid:none) Streptomyces nanchangensis NS3226... 151 4e-35 DQ897667_10(DQ897667|pid:none) Polyangium cellulosum strain So c... 151 5e-35 AF188287_5(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 150 6e-35 AF217189_6(AF217189|pid:none) Sorangium cellulosum putative tran... 150 6e-35 AF516145_6(AF516145|pid:none) Lyngbya majuscula barbamide biosyn... 150 1e-34 CP001287_2899(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 149 1e-34 CP000113_4409(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 149 1e-34 CP000393_3333(CP000393|pid:none) Trichodesmium erythraeum IMS101... 149 2e-34 AY652953_7(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 149 2e-34 AF188287_2(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 149 2e-34 U24241_8(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 149 2e-34 AY522504_17(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 149 2e-34 CP001016_1096(CP001016|pid:none) Beijerinckia indica subsp. indi... 149 2e-34 AL935186_8(AL935186|pid:none) Zebrafish DNA sequence from clone ... 149 2e-34 BX005238_11(BX005238|pid:none) Zebrafish DNA sequence from clone... 148 3e-34 CP000712_3868(CP000712|pid:none) Pseudomonas putida F1, complete... 148 3e-34 AF319998_9(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 148 3e-34 AY495652_1(AY495652|pid:none) Cochliobolus heterostrophus polyke... 148 3e-34 CP001037_1980(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 148 4e-34 (Q03133) RecName: Full=Erythronolide synthase, modules 5 and 6; ... 147 5e-34 AF040570_21(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 147 5e-34 CP000113_4410(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 147 7e-34 M63677_2(M63677|pid:none) S.erythraea second and third ORF's of ... 147 7e-34 AJ421825_15(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 147 7e-34 AY652953_13(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 147 7e-34 AF040570_23(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 147 7e-34 AF016585_4(AF016585|pid:none) Streptomyces caelestis cytochrome ... 147 9e-34 AF263912_14(AF263912|pid:none) Streptomyces noursei ATCC 11455 n... 146 1e-33 CP000850_1215(CP000850|pid:none) Salinispora arenicola CNS-205, ... 146 1e-33 CP000113_4412(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 146 1e-33 AJ223012_2(AJ223012|pid:none) Amycolatopsis mediterranei genes e... 146 2e-33 AF040570_22(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 146 2e-33 CP000117_1609(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 146 2e-33 AF395828_1(AF395828|pid:none) Aphanizomenon ovalisporum aoa gene... 146 2e-33 AM778535_5(AM778535|pid:none) Streptomyces orinoci neoaureothin ... 145 2e-33 CP000117_4716(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 145 2e-33 AM179409_3(AM179409|pid:none) Chondromyces crocatus chondramide ... 145 2e-33 CP000117_4082(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 145 2e-33 AF263245_14(AF263245|pid:none) Micromonospora megalomicea subsp.... 145 3e-33 AM902716_2323(AM902716|pid:none) Bordetella petrii strain DSM 12... 145 3e-33 U78289_3(U78289|pid:none) Streptomyces fradiae tylactone synthas... 145 3e-33 AB241068_6(AB241068|pid:none) Streptomyces halstedii halstoctaco... 145 3e-33 DQ149987_5(DQ149987|pid:none) Streptomyces neyagawaensis concana... 144 4e-33 CU640366_785(CU640366|pid:none) Podospora anserina genomic DNA c... 144 4e-33 AM238664_270(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 144 4e-33 BX294144_103(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 144 4e-33 DQ897668_12(DQ897668|pid:none) Polyangium cellulosum strain So c... 144 4e-33 AM920427_1153(AM920427|pid:none) Penicillium chrysogenum Wiscons... 144 4e-33 CP000854_3736(CP000854|pid:none) Mycobacterium marinum M, comple... 144 6e-33 EU220288_3(EU220288|pid:none) Streptomyces eurythermus strain AT... 144 6e-33 AF040570_25(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 144 6e-33 AM420293_2531(AM420293|pid:none) Saccharopolyspora erythraea NRR... 144 6e-33 T28658(T28658)polyketide synthase - Sorangium cellulosum (fragme... 144 8e-33 AB2012(AB2012) hypothetical protein all1648 [imported] - Nostoc ... 144 8e-33 CP000511_267(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1,... 143 1e-32 AM407731_6(AM407731|pid:none) Polyangium cellulosum spirangien b... 143 1e-32 AY652953_8(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 143 1e-32 CP000850_1218(CP000850|pid:none) Salinispora arenicola CNS-205, ... 143 1e-32 AJ505006_2(AJ505006|pid:none) Sorangium cellulosum spiG gene (pa... 143 1e-32 CP000850_1217(CP000850|pid:none) Salinispora arenicola CNS-205, ... 143 1e-32 AP009552_2781(AP009552|pid:none) Microcystis aeruginosa NIES-843... 143 1e-32 CP001037_3038(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 143 1e-32 CP000511_990(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1,... 142 2e-32 DQ249342_2(DQ249342|pid:none) Streptomyces hygroscopicus subsp. ... 142 2e-32 CP001291_2672(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 142 2e-32 AM946600_13(AM946600|pid:none) Chondromyces crocatus ajudazol bi... 142 2e-32 DQ897667_12(DQ897667|pid:none) Polyangium cellulosum strain So c... 142 2e-32 AM238664_468(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 142 2e-32 AF217189_5(AF217189|pid:none) Sorangium cellulosum putative tran... 142 2e-32 DQ289493_1(DQ289493|pid:none) Synthetic construct EpoC (epoC) ge... 142 2e-32 AM850130_11(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 142 3e-32 U24241_7(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 142 3e-32 AF210843_8(AF210843|pid:none) Sorangium cellulosum strain So ce9... 142 3e-32 CP001037_2819(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 141 4e-32 EU603720_5(EU603720|pid:none) Planktothrix rubescens genomic seq... 141 4e-32 AE000516_1749(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 141 4e-32 AP009493_6373(AP009493|pid:none) Streptomyces griseus subsp. gri... 141 5e-32 DQ149987_8(DQ149987|pid:none) Streptomyces neyagawaensis concana... 141 5e-32 AB241068_3(AB241068|pid:none) Streptomyces halstedii halstoctaco... 140 6e-32 CP001287_2900(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 140 6e-32 CP000480_6552(CP000480|pid:none) Mycobacterium smegmatis str. MC... 140 6e-32 AM746336_27(AM746336|pid:none) Streptomyces collinus kirromycin ... 140 8e-32 EU595749_6(EU595749|pid:none) Pseudomonas aeruginosa strain PACS... 140 8e-32 AM408590_1703(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 140 8e-32 DQ272521_9(DQ272521|pid:none) Streptomyces sp. Eco86 B gene locu... 140 8e-32 AF319998_5(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 140 8e-32 CP000908_1917(CP000908|pid:none) Methylobacterium extorquens PA1... 140 8e-32 DQ249341_3(DQ249341|pid:none) Streptomyces hygroscopicus subsp. ... 140 8e-32 AJ557546_13(AJ557546|pid:none) Melittangium lichenicola melithia... 140 1e-31 AB070949_7(AB070949|pid:none) Streptomyces avermitilis polyene m... 140 1e-31 AF440781_17(AF440781|pid:none) Streptomyces cinnamonensis polyet... 140 1e-31 AY373435_3(AY373435|pid:none) Streptomyces nanchangensis strain ... 140 1e-31 CT573213_3981(CT573213|pid:none) Frankia alni str. ACN14A chromo... 140 1e-31 AB435553_3(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 139 1e-31 AB179766_1(AB179766|pid:none) Alternaria alternata AF-toxin bios... 139 1e-31 CP001001_935(CP001001|pid:none) Methylobacterium radiotolerans J... 139 1e-31 AM988861_6(AM988861|pid:none) Chondromyces crocatus chondrochlor... 139 2e-31 CP001037_2824(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 139 2e-31 AM231613_6(AM231613|pid:none) Mycobacterium chelonae GPL gene cl... 139 2e-31 CP000806_3070(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 139 2e-31 AB088224_34(AB088224|pid:none) Streptomyces rochei plasmid pSLA2... 139 2e-31 AF357202_16(AF357202|pid:none) Streptomyces nodosus amphotericin... 139 2e-31 AY217789_1(AY217789|pid:none) Phoma sp. C2932 type I polyketide ... 139 2e-31 AY179507_10(AY179507|pid:none) Streptomyces hygroscopicus strain... 139 2e-31 CP000656_403(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, co... 138 3e-31 AY423269_2(AY423269|pid:none) Streptomyces diastaticus 108 cytoc... 138 3e-31 CT573213_2491(CT573213|pid:none) Frankia alni str. ACN14A chromo... 138 3e-31 DQ289495_1(DQ289495|pid:none) Synthetic construct EpoE (epoE) ge... 138 3e-31 FJ545274_16(FJ545274|pid:none) Streptomyces antibioticus strain ... 138 3e-31 AF521085_9(AF521085|pid:none) Streptomyces nanchangensis NS3226 ... 138 3e-31 CP001037_1896(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 138 4e-31 CP001029_1805(CP001029|pid:none) Methylobacterium populi BJ001, ... 138 4e-31 CP000086_1328(CP000086|pid:none) Burkholderia thailandensis E264... 138 4e-31 AB193609_14(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetro... 137 5e-31 EU449979_2(EU449979|pid:none) Fusarium oxysporum strain FRC O-18... 137 5e-31 AF521085_12(AF521085|pid:none) Streptomyces nanchangensis NS3226... 137 5e-31 CP000806_3757(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 137 5e-31 AB376467_1(AB376467|pid:none) Sorangium cellulosum gene for poly... 137 5e-31 AE016853_4575(AE016853|pid:none) Pseudomonas syringae pv. tomato... 137 7e-31 CP000820_4733(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 137 7e-31 AM420293_2550(AM420293|pid:none) Saccharopolyspora erythraea NRR... 137 7e-31 AB241068_7(AB241068|pid:none) Streptomyces halstedii halstoctaco... 137 7e-31 AB435553_2(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 137 7e-31 AD2135(AD2135) polyketide synthase type I [imported] - Nostoc sp... 137 7e-31 AM420293_707(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 137 7e-31 AM420293_4055(AM420293|pid:none) Saccharopolyspora erythraea NRR... 137 7e-31 CP000526_532(CP000526|pid:none) Burkholderia mallei SAVP1 chromo... 137 9e-31 DQ249341_1(DQ249341|pid:none) Streptomyces hygroscopicus subsp. ... 137 9e-31 CT573213_2488(CT573213|pid:none) Frankia alni str. ACN14A chromo... 137 9e-31 EU301739_27(EU301739|pid:none) Actinomadura kijaniata fructokina... 137 9e-31 AL939129_116(AL939129|pid:none) Streptomyces coelicolor A3(2) co... 137 9e-31 AF079138_3(AF079138|pid:none) Streptomyces venezuelae methymycin... 137 9e-31 CP001408_3359(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 137 9e-31 AF440781_26(AF440781|pid:none) Streptomyces cinnamonensis polyet... 137 9e-31 CP000572_3224(CP000572|pid:none) Burkholderia pseudomallei 1106a... 137 9e-31 AM850130_10(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 137 9e-31 AF440781_15(AF440781|pid:none) Streptomyces cinnamonensis polyet... 136 1e-30 AB363939_11(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 136 1e-30 CP000117_3964(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 136 1e-30 CU633870_146(CU633870|pid:none) Podospora anserina genomic DNA c... 136 1e-30 CP001037_2818(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 136 1e-30 CP000384_243(CP000384|pid:none) Mycobacterium sp. MCS, complete ... 136 1e-30 FJ872523_5(FJ872523|pid:none) Streptomyces sp. DSM 21069 putativ... 136 2e-30 AY834753_9(AY834753|pid:none) Cystobacter fuscus cystothiazole A... 136 2e-30 CP000378_295(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 136 2e-30 CP001349_1882(CP001349|pid:none) Methylobacterium nodulans ORS 2... 136 2e-30 AM778535_10(AM778535|pid:none) Streptomyces orinoci neoaureothin... 136 2e-30 BA000030_420(BA000030|pid:none) Streptomyces avermitilis MA-4680... 136 2e-30 AB158460_2(AB158460|pid:none) Streptomyces halstedii hlsA, hlsB,... 136 2e-30 AP007169_168(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 136 2e-30 AH2140(AH2140) polyketide synthase [imported] - Nostoc sp. (stra... 136 2e-30 CP000458_781(CP000458|pid:none) Burkholderia cenocepacia HI2424 ... 136 2e-30 BX294154_97(BX294154|pid:none) Rhodopirellula baltica SH 1 compl... 136 2e-30 CP001040_62(CP001040|pid:none) Nostoc punctiforme PCC 73102 plas... 135 2e-30 CP000958_748(CP000958|pid:none) Burkholderia cenocepacia MC0-3 c... 135 2e-30 BX248341_70(BX248341|pid:none) Mycobacterium bovis subsp. bovis ... 135 2e-30 BX842578_219(BX842578|pid:none) Mycobacterium tuberculosis H37Rv... 135 2e-30 AY310323_20(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 135 2e-30 AY354515_6(AY354515|pid:none) Streptomyces sp. HK803 PlmR5 (plmR... 135 2e-30 CP000151_689(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 135 2e-30 AF440781_16(AF440781|pid:none) Streptomyces cinnamonensis polyet... 135 2e-30 EU443633_22(EU443633|pid:none) Micromonospora chalcea tetrocarci... 135 2e-30 DQ897667_14(DQ897667|pid:none) Polyangium cellulosum strain So c... 135 2e-30 AM408590_2071(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 135 2e-30 AE000516_2167(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 135 2e-30 CP001037_2726(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 135 2e-30 DQ897668_10(DQ897668|pid:none) Polyangium cellulosum strain So c... 135 3e-30 CP000943_161(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 135 3e-30 AF521897_2(AF521897|pid:none) Streptomyces hygroscopicus ansamyc... 135 3e-30 AM747720_3228(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 135 3e-30 CU633895_40(CU633895|pid:none) Podospora anserina genomic DNA ch... 135 3e-30 AF440781_25(AF440781|pid:none) Streptomyces cinnamonensis polyet... 135 3e-30 AM850130_13(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 135 4e-30 AB449340_13(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 135 4e-30 AB376509_1(AB376509|pid:none) Sorangium cellulosum gene for poly... 135 4e-30 EU301739_10(EU301739|pid:none) Actinomadura kijaniata fructokina... 135 4e-30 AB070940_12(AB070940|pid:none) Streptomyces avermitilis oligomyc... 135 4e-30 AE016958_2230(AE016958|pid:none) Mycobacterium avium subsp. para... 135 4e-30 CP001291_1832(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 134 5e-30 CP000806_3074(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 134 5e-30 FM173265_16(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 134 5e-30 AB097904_5(AB097904|pid:none) Streptomyces carzinostaticus DNA, ... 134 5e-30 AM920436_484(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 134 5e-30 AM269971_62(AM269971|pid:none) Aspergillus niger contig An01c024... 134 5e-30 CP001344_2632(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 134 5e-30 DQ019316_6(DQ019316|pid:none) Gibberella zeae aldehyde dehydroge... 134 6e-30 CP001037_3034(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 134 6e-30 AY899214_8(AY899214|pid:none) Streptomyces aizunensis strain NRR... 134 6e-30 AE016958_1796(AE016958|pid:none) Mycobacterium avium subsp. para... 134 6e-30 AB070940_14(AB070940|pid:none) Streptomyces avermitilis oligomyc... 134 6e-30 DQ897668_9(DQ897668|pid:none) Polyangium cellulosum strain So ce... 134 6e-30 CP000850_3025(CP000850|pid:none) Salinispora arenicola CNS-205, ... 134 6e-30 AY466441_30(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 134 8e-30 AJ421825_16(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 134 8e-30 AY466441_29(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 134 8e-30 AY652953_1(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 134 8e-30 AM920436_393(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 133 1e-29 CP000667_2725(CP000667|pid:none) Salinispora tropica CNB-440, co... 133 1e-29 BX640432_33(BX640432|pid:none) Bordetella parapertussis strain 1... 133 1e-29 AB070940_8(AB070940|pid:none) Streptomyces avermitilis oligomyci... 133 1e-29 AB449340_18(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 133 1e-29 AM269971_60(AM269971|pid:none) Aspergillus niger contig An01c024... 133 1e-29 AY373435_7(AY373435|pid:none) Streptomyces nanchangensis strain ... 133 1e-29 AY466441_31(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 133 1e-29 S23070(S23070;S22011;S23205)erythronolide synthase (EC 2.3.1.94)... 133 1e-29 AM988861_7(AM988861|pid:none) Chondromyces crocatus chondrochlor... 133 1e-29 AP009493_6083(AP009493|pid:none) Streptomyces griseus subsp. gri... 133 1e-29 AB279593_12(AB279593|pid:none) Microcystis aeruginosa new nonrib... 133 1e-29 CP000806_3076(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 133 1e-29 AP009493_6778(AP009493|pid:none) Streptomyces griseus subsp. gri... 133 1e-29 CP000875_3940(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 132 2e-29 AF521085_8(AF521085|pid:none) Streptomyces nanchangensis NS3226 ... 132 2e-29 AP009385_628(AP009385|pid:none) Burkholderia multivorans ATCC 17... 132 2e-29 AY505295_1(AY505295|pid:none) Mycobacterium ulcerans clone 112 m... 132 2e-29 AJ871581_38(AJ871581|pid:none) Streptomyces achromogenes subsp. ... 132 2e-29 AY495647_1(AY495647|pid:none) Cochliobolus heterostrophus polyke... 132 2e-29 AM946600_8(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 132 2e-29 AF440781_19(AF440781|pid:none) Streptomyces cinnamonensis polyet... 132 3e-29 AY974560_4(AY974560|pid:none) Lyngbya majuscula hectochlorin bio... 132 3e-29 AB032367_6(AB032367|pid:none) Streptomyces avermitilis polyketid... 132 3e-29 CP001037_2984(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 132 3e-29 AB376477_1(AB376477|pid:none) Sorangium cellulosum gene for poly... 132 3e-29 AP007154_450(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 131 4e-29 CP000479_2340(CP000479|pid:none) Mycobacterium avium 104, comple... 131 4e-29 CP001037_3040(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 131 4e-29 FJ477836_6(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 131 4e-29 AF082100_3(AF082100|pid:none) Streptomyces sp. MA6548 FK506 pept... 131 5e-29 AP007171_14(AP007171|pid:none) Aspergillus oryzae RIB40 genomic ... 131 5e-29 AB032367_5(AB032367|pid:none) Streptomyces avermitilis polyketid... 131 5e-29 AB376432_1(AB376432|pid:none) Melittangium lichenicola gene for ... 131 5e-29 FJ872525_9(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 131 5e-29 AB070940_9(AB070940|pid:none) Streptomyces avermitilis oligomyci... 131 5e-29 AY522504_20(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 131 5e-29 AB435553_1(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 131 5e-29 CP001503_647(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 130 7e-29 AY373435_6(AY373435|pid:none) Streptomyces nanchangensis strain ... 130 9e-29 AB032367_2(AB032367|pid:none) Streptomyces avermitilis polyketid... 130 9e-29 AB376505_1(AB376505|pid:none) Sorangium cellulosum gene for poly... 130 9e-29 AY495654_1(AY495654|pid:none) Cochliobolus heterostrophus polyke... 130 9e-29 AB070940_15(AB070940|pid:none) Streptomyces avermitilis oligomyc... 130 9e-29 AF395534_1(AF395534|pid:none) Xylaria sp. BCC 1067 melanin synth... 130 1e-28 DQ351275_18(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 130 1e-28 FJ393327_1(FJ393327|pid:none) Microcystis sp. CYN06 microcystin ... 130 1e-28 CP000431_4186(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 130 1e-28 BX649209_40(BX649209|pid:none) Mycobacterium ulcerans plasmid pM... 130 1e-28 EU271968_43(EU271968|pid:none) Mycobacterium liflandii 128FXT pl... 130 1e-28 AF188287_6(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 130 1e-28 DQ176871_14(DQ176871|pid:none) Streptomyces aureofaciens strain ... 130 1e-28 AF188287_4(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 130 1e-28 DQ885223_3(DQ885223|pid:none) Streptomyces violaceusniger merida... 130 1e-28 DQ116941_31(DQ116941|pid:none) Streptomyces antibioticus acetylt... 129 1e-28 AM238664_478(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 129 1e-28 AY495613_1(AY495613|pid:none) Botryotinia fuckeliana polyketide ... 129 1e-28 DQ983361_9(DQ983361|pid:none) Streptomyces sp. CK4412 tautomycet... 129 1e-28 AF155773_7(AF155773|pid:none) Gibberella moniliformis fumonisin ... 129 1e-28 CP000112_1605(CP000112|pid:none) Desulfovibrio desulfuricans G20... 129 1e-28 AJ421825_17(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 129 2e-28 AB376465_1(AB376465|pid:none) Sorangium cellulosum gene for poly... 129 2e-28 AF220951_2(AF220951|pid:none) Streptomyces antibioticus 8,8a-deo... 129 2e-28 CP000854_1167(CP000854|pid:none) Mycobacterium marinum M, comple... 129 2e-28 EU140798_1(EU140798|pid:none) Cylindrospermopsis raciborskii AWT... 129 2e-28 AB120221_5(AB120221|pid:none) Alternaria solani alt1, alt2, alt3... 129 2e-28 AY623658_22(AY623658|pid:none) Aeromicrobium erythreum putative ... 129 2e-28 DQ885223_4(DQ885223|pid:none) Streptomyces violaceusniger merida... 129 3e-28 DQ249342_4(DQ249342|pid:none) Streptomyces hygroscopicus subsp. ... 128 3e-28 AP009493_6181(AP009493|pid:none) Streptomyces griseus subsp. gri... 128 3e-28 AJ421825_14(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 128 3e-28 BX571865_129(BX571865|pid:none) Photorhabdus luminescens subsp. ... 128 3e-28 AP011115_4155(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 128 3e-28 AJ505006_1(AJ505006|pid:none) Sorangium cellulosum spiG gene (pa... 128 3e-28 AM778952_15(AM778952|pid:none) Microcystis aeruginosa PCC 7806 g... 128 3e-28 AM270233_15(AM270233|pid:none) Aspergillus niger contig An11c016... 128 3e-28 AF183408_7(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 128 3e-28 FJ406097_1(FJ406097|pid:none) Streptomyces erumpens strain 1626 ... 128 3e-28 CP000384_3104(CP000384|pid:none) Mycobacterium sp. MCS, complete... 128 4e-28 AF521085_20(AF521085|pid:none) Streptomyces nanchangensis NS3226... 128 4e-28 FJ406106_1(FJ406106|pid:none) Streptomyces mediolani strain 1896... 128 4e-28 AF357202_4(AF357202|pid:none) Streptomyces nodosus amphotericin ... 128 4e-28 FJ393328_1(FJ393328|pid:none) Microcystis sp. CYN10 microcystin ... 128 4e-28 FJ406095_1(FJ406095|pid:none) Streptomyces erumpens strain 1626 ... 128 4e-28 AM412319_8(AM412319|pid:none) [Polyangium] brachysporum glidobac... 128 4e-28 CU633457_309(CU633457|pid:none) Podospora anserina genomic DNA c... 128 4e-28 AM270278_16(AM270278|pid:none) Aspergillus niger contig An12c022... 127 6e-28 AM850130_7(AM850130|pid:none) Stigmatella aurantiaca aurafuron b... 127 6e-28 FJ405982_1(FJ405982|pid:none) Streptomyces sp. B8 strain OB8 clo... 127 6e-28 CT573213_338(CT573213|pid:none) Frankia alni str. ACN14A chromos... 127 6e-28 FJ872525_4(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 127 6e-28 AF079138_6(AF079138|pid:none) Streptomyces venezuelae methymycin... 127 6e-28 AB363939_10(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 127 6e-28 FJ405967_1(FJ405967|pid:none) Streptomyces globosus strain O320 ... 127 6e-28 AY652953_12(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 127 6e-28 FJ405985_1(FJ405985|pid:none) Streptomyces sp. D22 strain OD22 c... 127 6e-28 AY179507_9(AY179507|pid:none) Streptomyces hygroscopicus strain ... 127 6e-28 FJ405950_1(FJ405950|pid:none) Streptomyces griseus strain O175 c... 127 6e-28 CP000113_3522(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 127 6e-28 CP000580_3096(CP000580|pid:none) Mycobacterium sp. JLS, complete... 127 7e-28 AB070944_4(AB070944|pid:none) Streptomyces avermitilis polyketid... 127 7e-28 AJ557546_10(AJ557546|pid:none) Melittangium lichenicola melithia... 127 7e-28 AJ557546_12(AJ557546|pid:none) Melittangium lichenicola melithia... 127 7e-28 AM420293_4053(AM420293|pid:none) Saccharopolyspora erythraea NRR... 127 7e-28 DQ351275_17(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 127 7e-28 AM270061_16(AM270061|pid:none) Aspergillus niger contig An03c020... 127 7e-28 AM420293_2559(AM420293|pid:none) Saccharopolyspora erythraea NRR... 127 7e-28 AM270024_5(AM270024|pid:none) Aspergillus niger contig An02c0290... 127 1e-27 CP001472_1105(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 127 1e-27 AY522504_15(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 126 1e-27 FJ477836_8(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 126 1e-27 AF007101_2(AF007101|pid:none) Streptomyces hygroscopicus putativ... 126 1e-27 FJ406028_1(FJ406028|pid:none) Streptomyces griseus strain 175 cl... 126 1e-27 AM778535_8(AM778535|pid:none) Streptomyces orinoci neoaureothin ... 126 1e-27 FM173265_19(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 126 1e-27 AY495620_1(AY495620|pid:none) Botryotinia fuckeliana polyketide ... 126 1e-27 AY495603_1(AY495603|pid:none) Gibberella moniliformis polyketide... 126 2e-27 CP000479_2989(CP000479|pid:none) Mycobacterium avium 104, comple... 126 2e-27 FJ405966_1(FJ405966|pid:none) Streptomyces globosus strain O320 ... 126 2e-27 AY947889_17(AY947889|pid:none) Streptomyces hygroscopicus strain... 126 2e-27 AM238664_467(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 126 2e-27 CU640366_51(CU640366|pid:none) Podospora anserina genomic DNA ch... 126 2e-27 AF440781_18(AF440781|pid:none) Streptomyces cinnamonensis polyet... 126 2e-27 AP007164_716(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 125 2e-27 AM889285_2396(AM889285|pid:none) Gluconacetobacter diazotrophicu... 125 2e-27 CP000854_2991(CP000854|pid:none) Mycobacterium marinum M, comple... 125 2e-27 AM238664_466(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 125 2e-27 DQ249342_5(DQ249342|pid:none) Streptomyces hygroscopicus subsp. ... 125 2e-27 AF506522_7(AF506522|pid:none) Streptomyces hygroscopicus AHBA bi... 125 2e-27 AM930232_1(AM930232|pid:none) Botrytis cinerea pks6 gene for pol... 125 2e-27 FJ406012_1(FJ406012|pid:none) Streptomyces griseus strain 162 cl... 125 2e-27 FJ405965_1(FJ405965|pid:none) Streptomyces globosus strain O320 ... 125 3e-27 AY495595_1(AY495595|pid:none) Gibberella moniliformis polyketide... 125 3e-27 AF007101_4(AF007101|pid:none) Streptomyces hygroscopicus putativ... 125 3e-27 DQ249341_2(DQ249341|pid:none) Streptomyces hygroscopicus subsp. ... 125 3e-27 CP000384_2820(CP000384|pid:none) Mycobacterium sp. MCS, complete... 125 3e-27 AY495592_1(AY495592|pid:none) Gibberella moniliformis polyketide... 125 3e-27 AM946600_3(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 125 3e-27 CP000820_4734(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 125 3e-27 AM270341_48(AM270341|pid:none) Aspergillus niger contig An15c014... 125 3e-27 EU443633_23(EU443633|pid:none) Micromonospora chalcea tetrocarci... 125 4e-27 CU633865_16(CU633865|pid:none) Podospora anserina genomic DNA ch... 125 4e-27 CP000384_2818(CP000384|pid:none) Mycobacterium sp. MCS, complete... 125 4e-27 AM946600_9(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 125 4e-27 CP000580_2832(CP000580|pid:none) Mycobacterium sp. JLS, complete... 125 4e-27 AB449340_16(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 125 4e-27 CP001280_2660(CP001280|pid:none) Methylocella silvestris BL2, co... 124 5e-27 AY971512_1(AY971512|pid:none) Xylaria sp. BCC 1067 polyketide sy... 124 5e-27 FJ405980_1(FJ405980|pid:none) Streptomyces sp. B8 strain OB8 clo... 124 5e-27 AB376544_1(AB376544|pid:none) Haliangium tepidum gene for polyke... 124 5e-27 AY623658_24(AY623658|pid:none) Aeromicrobium erythreum putative ... 124 5e-27 U68040_1(U68040|pid:none) Cochliobolus heterostrophus polyketide... 124 6e-27 CU638744_786(CU638744|pid:none) Podospora anserina genomic DNA c... 124 6e-27 AX089460_1(AX089460|pid:none) Sequence 45 from Patent WO0116303.... 124 6e-27 DQ885223_2(DQ885223|pid:none) Streptomyces violaceusniger merida... 124 6e-27 AJ557546_14(AJ557546|pid:none) Melittangium lichenicola melithia... 124 6e-27 AM420293_4220(AM420293|pid:none) Saccharopolyspora erythraea NRR... 124 8e-27 DQ065771_3(DQ065771|pid:none) Polyangium cellulosum hypothetical... 124 8e-27 AJ441056_3(AJ441056|pid:none) Planktothrix agardhii microcystin ... 124 8e-27 AY495615_1(AY495615|pid:none) Botryotinia fuckeliana polyketide ... 124 8e-27 AY505299_1(AY505299|pid:none) Mycobacterium ulcerans clone 122 m... 123 1e-26 AF521085_27(AF521085|pid:none) Streptomyces nanchangensis NS3226... 123 1e-26 DQ272520_6(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 123 1e-26 T30283(T30283) polyketide synthase - Streptomyces sp. (strain MA... 123 1e-26 FB714659_1(FB714659|pid:none) Sequence 73 from Patent WO20071288... 123 1e-26 AB376466_1(AB376466|pid:none) Sorangium cellulosum gene for poly... 123 1e-26 CP000820_3810(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 123 1e-26 AB193609_17(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetro... 123 1e-26 CP001037_3033(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 123 1e-26 CP000820_3405(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 123 1e-26 FB714663_1(FB714663|pid:none) Sequence 77 from Patent WO20071288... 123 1e-26 AM408590_1706(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 123 1e-26 AE000516_1752(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 123 1e-26 AY495606_1(AY495606|pid:none) Botryotinia fuckeliana polyketide ... 123 1e-26 AJ580915_19(AJ580915|pid:none) Streptomyces parvulus Tu4055 clus... 123 1e-26 EF990140_11(EF990140|pid:none) Streptomyces spiroverticillatus c... 123 1e-26 AY210783_11(AY210783|pid:none) Nodularia spumigena strain NSOR10... 122 2e-26 CP000113_4181(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 122 2e-26 AJ620477_23(AJ620477|pid:none) Angiococcus disciformis partial O... 122 2e-26 AM269952_38(AM269952|pid:none) Aspergillus niger contig An01c005... 122 2e-26 AM420293_4052(AM420293|pid:none) Saccharopolyspora erythraea NRR... 122 2e-26 AY834753_10(AY834753|pid:none) Cystobacter fuscus cystothiazole ... 122 2e-26 CP000384_2817(CP000384|pid:none) Mycobacterium sp. MCS, complete... 122 2e-26 CP000580_2828(CP000580|pid:none) Mycobacterium sp. JLS, complete... 122 2e-26 AY495601_1(AY495601|pid:none) Gibberella moniliformis polyketide... 122 2e-26 CU640366_721(CU640366|pid:none) Podospora anserina genomic DNA c... 122 2e-26 AL583921_77(AL583921|pid:none) Mycobacterium leprae strain TN co... 122 2e-26 AB376462_1(AB376462|pid:none) Sorangium cellulosum gene for poly... 122 2e-26 AY495646_1(AY495646|pid:none) Cochliobolus heterostrophus polyke... 122 2e-26 CP000480_4563(CP000480|pid:none) Mycobacterium smegmatis str. MC... 122 2e-26 CP000656_3370(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 122 3e-26 AM270337_27(AM270337|pid:none) Aspergillus niger contig An15c010... 122 3e-26 CU633901_318(CU633901|pid:none) Podospora anserina genomic DNA c... 122 3e-26 CP000838_224(CP000838|pid:none) Acaryochloris marina MBIC11017 p... 122 3e-26 CP000820_3292(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 121 4e-26 AY907537_3(AY907537|pid:none) Uncultured bacterial symbiont of D... 121 4e-26 CP001037_1897(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 121 4e-26 AM920436_1245(AM920436|pid:none) Penicillium chrysogenum Wiscons... 121 4e-26 DQ272520_4(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 121 4e-26 EU520419_1(EU520419|pid:none) Pochonia chlamydosporia strain ATC... 121 4e-26 AJ421825_10(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 121 4e-26 DQ351275_19(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 121 4e-26 AM270206_1(AM270206|pid:none) Aspergillus niger contig An09c0170... 121 4e-26 AJ580915_18(AJ580915|pid:none) Streptomyces parvulus Tu4055 clus... 121 5e-26 FJ406094_1(FJ406094|pid:none) Streptomyces erumpens strain 1626 ... 121 5e-26 AP009493_6077(AP009493|pid:none) Streptomyces griseus subsp. gri... 121 5e-26 DQ354110_6(DQ354110|pid:none) Streptomyces violaceusniger strain... 121 5e-26 AY495617_1(AY495617|pid:none) Botryotinia fuckeliana polyketide ... 121 5e-26 FJ406042_1(FJ406042|pid:none) Streptomyces griseus strain E3 clo... 120 7e-26 AB376507_1(AB376507|pid:none) Sorangium cellulosum gene for poly... 120 7e-26 FJ406073_1(FJ406073|pid:none) Streptomyces griseus subsp. griseu... 120 7e-26 U78289_1(U78289|pid:none) Streptomyces fradiae tylactone synthas... 120 7e-26 EF568935_1(EF568935|pid:none) Streptomyces lavendulae strain A1 ... 120 7e-26 AY495602_1(AY495602|pid:none) Gibberella moniliformis polyketide... 120 7e-26 AM055942_139(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 120 7e-26 AM944567_1(AM944567|pid:none) Aspergillus carbonarius partial pk... 120 7e-26 CP001614_2049(CP001614|pid:none) Teredinibacter turnerae T7901, ... 120 7e-26 EF080951_1(EF080951|pid:none) Streptomyces lavendulae strain A1 ... 120 7e-26 AY947889_18(AY947889|pid:none) Streptomyces hygroscopicus strain... 120 7e-26 AY289595_1(AY289595|pid:none) Mycobacterium ulcerans clone C typ... 120 7e-26 AP007166_610(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 120 7e-26 CP001635_3139(CP001635|pid:none) Variovorax paradoxus S110 chrom... 120 7e-26 T30226(T30226) polyketide synthase - Streptomyces hygroscopicus ... 120 9e-26 AM988861_8(AM988861|pid:none) Chondromyces crocatus chondrochlor... 120 9e-26 AC116982_28(AC116982|pid:none) Dictyostelium discoideum chromoso... 120 9e-26 AB449340_15(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 120 9e-26 AB032549_4(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 120 9e-26 DQ645533_1(DQ645533|pid:none) Aphanizomenon issatschenkoi CAWBG0... 120 9e-26 FM173265_18(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 120 9e-26 FJ545274_20(FJ545274|pid:none) Streptomyces antibioticus strain ... 120 9e-26 (Q12397) RecName: Full=Putative sterigmatocystin biosynthesis po... 120 1e-25 L39121_1(L39121|pid:none) Emericella nidulans polyketide synthas... 120 1e-25 CP000854_102(CP000854|pid:none) Mycobacterium marinum M, complet... 120 1e-25 AP009493_6073(AP009493|pid:none) Streptomyces griseus subsp. gri... 120 1e-25 T30225(T30225) polyketide synthase - Streptomyces hygroscopicus ... 120 1e-25 CP000113_4186(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 119 2e-25 FJ406004_1(FJ406004|pid:none) Streptomyces griseus strain 124 cl... 119 2e-25 T30228(T30228) polyketide synthase - Streptomyces hygroscopicus ... 119 2e-25 AB376492_1(AB376492|pid:none) Sorangium cellulosum gene for poly... 119 2e-25 FJ405954_1(FJ405954|pid:none) Streptomyces griseus strain O175 c... 119 2e-25 FJ406015_1(FJ406015|pid:none) Streptomyces griseus strain 162 cl... 119 2e-25 CP000813_630(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 119 2e-25 FJ405949_1(FJ405949|pid:none) Streptomyces griseus strain O162 c... 119 2e-25 CT573213_2913(CT573213|pid:none) Frankia alni str. ACN14A chromo... 119 2e-25 CP000667_3008(CP000667|pid:none) Salinispora tropica CNB-440, co... 119 2e-25
>(Q869W9) RecName: Full=Probable polyketide synthase 16; Short=dipks16; EC=2.3.1.-; &AC116305_81(AC116305|pid:none) Length = 2603
Score = 712 bits (1839), Expect = 0.0 Identities = 360/378 (95%), Positives = 360/378 (95%) Frame = -1
Query: 1135 LISNQSIYKDTILFKDFVKHQTISKSNLIKRKVITASDWDDFLNKRNEXXXXXXXXXXXX 956 LISNQSIYKDTILFKDFVKHQTISKSNLIKRKVITASDWDDFLNKRNE Sbjct: 480 LISNQSIYKDTILFKDFVKHQTISKSNLIKRKVITASDWDDFLNKRNETTSTSSLTSTIS 539
Query: 955 XXXXXXPVIYVFTGQGPQWRDMGKALYETESVFKDAIDHCDKLLANYFGYSILQKLRSLE 776 PVIYVFTGQGPQWRDMGKALYETESVFKDAIDHCDKLLANYFGYSILQKLRSLE Sbjct: 540 APASSTPVIYVFTGQGPQWRDMGKALYETESVFKDAIDHCDKLLANYFGYSILQKLRSLE 599
Query: 775 SDDSPEIHHPILAQPSIFLIQVGLVALYKSFGISPSIVVGHSFGEVSSALFSGVISLETA 596 SDDSPEIHHPILAQPSIFLIQVGLVALYKSFGISPSIVVGHSFGEVSSALFSGVISLETA Sbjct: 600 SDDSPEIHHPILAQPSIFLIQVGLVALYKSFGISPSIVVGHSFGEVSSALFSGVISLETA 659
Query: 595 VKIVYYRGLAQNLTMGTGRLLSIGIGADAYLEKCALLYPEIEIACYNDPNSIVITGSEQD 416 VKIVYYRGLAQNLTMGTGRLLSIGIGADAYLEKCALLYPEIEIACYNDPNSIVITGSEQD Sbjct: 660 VKIVYYRGLAQNLTMGTGRLLSIGIGADAYLEKCALLYPEIEIACYNDPNSIVITGSEQD 719
Query: 415 LLGAKSTLSAEGVFCAFLGTPCSFHSSKQEMIKEKIFKDLSDLPESNVPCVPFFSTITGS 236 LLGAKSTLSAEGVFCAFLGTPCSFHSSKQEMIKEKIFKDLSDLPESNVPCVPFFSTITGS Sbjct: 720 LLGAKSTLSAEGVFCAFLGTPCSFHSSKQEMIKEKIFKDLSDLPESNVPCVPFFSTITGS 779
Query: 235 QLSHKGFYNVQYIYDNLRMPVEFTKAISNIFNFIEENESYKNAIFLEIGPHPTLGFYIPK 56 QLSHKGFYNVQYIYDNLRMPVEFTKAISNIFNFIEENESYKNAIFLEIGPHPTLGFYIPK Sbjct: 780 QLSHKGFYNVQYIYDNLRMPVEFTKAISNIFNFIEENESYKNAIFLEIGPHPTLGFYIPK 839
Query: 55 CKPSNSTITSKPIIVSPL 2 CKPSNSTITSKPIIVSPL Sbjct: 840 CKPSNSTITSKPIIVSPL 857
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 1,702,291,209 Number of extensions: 32829197 Number of successful extensions: 94469 Number of sequences better than 10.0: 1979 Number of HSP's gapped: 90827 Number of HSP's successfully gapped: 2423 Length of query: 378 Length of database: 1,061,185,681 Length adjustment: 130 Effective length of query: 248 Effective length of database: 636,287,441 Effective search space: 157799285368 Effective search space used: 157799285368 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
1 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
1 |
FC-IC (SUB) |
1 |