| Contig-U16501-1 |
| Contig ID |
Contig-U16501-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
2439 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
8434281 |
| End point |
8431995 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
29 |
| Number of EST |
43 |
| Link to clone list |
U16501 |
| List of clone(s) |
est1=VHO771F,1,623
est2=SSE294E,29,575
est3=AFF786F,321,878
est4=VFC355F,340,875
est5=VHE704F,356,975
est6=VHE880F,356,972
est7=AFE757F,357,1367
est8=VHO673F,357,970
est9=CFH854F,362,971
est10=CFI106F,362,908
est11=CHF658F,363,799
est12=VHD191F,363,899
est13=VHJ869F,363,940
est14=CFH749F,367,759
est15=SFB864F,376,971
est16=SSF655F,1176,1883
est17=SSF278F,1568,1938
est18=VHO771Z,1644,2394
est19=AHI132Z,1659,2309
est20=CFH854Z,1705,2432
est21=AFE757Z,1706,2435
est22=CHF658Z,1707,2405
est23=SFF506Z,1725,2405
est24=SFB864Z,1726,2430
est25=VHE704Z,1726,2404
est26=VHO673Z,1726,2403
est27=CHN884Z,1727,2295
est28=VHJ869Z,1727,2430
est29=CHH311Z,1729,2280
est30=CHQ859Z,1731,2308
est31=CHL282Z,1732,2328
est32=CFJ158Z,1734,2438
est33=SFJ747Z,1802,2283
est34=AFB371Z,1813,2340
est35=VHE880Z,1834,2422
est36=VHD191Z,1835,2423
est37=CHK431Z,1838,2323
est38=SFF249Z,1841,2439
est39=CFI106Z,1842,2428
est40=CFH749Z,1846,2427
est41=AHR303Z,1928,2419
est42=AFF786Z,2009,2396
est43=VFC355Z,2011,2421
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 4.10 |
| Homology vs DNA |
Query= Contig-U16501-1 (Contig-U16501-1Q) /CSM_Contig/Contig-U16501-1Q.Seq.d
(2439 letters)
Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC115612) Dictyostelium discoideum chromosome 2 map 6245135... 3116 0.0 2
(BJ420678) Dictyostelium discoideum cDNA clone:ddv40h01, 5' ... 1219 0.0 1
(BJ420950) Dictyostelium discoideum cDNA clone:ddv40p20, 5' ... 1213 0.0 1
(BJ323415) Dictyostelium discoideum cDNA clone:dda10b15, 5' ... 1211 0.0 1
(BJ361308) Dictyostelium discoideum cDNA clone:ddc16l14, 5' ... 1207 0.0 1
(BJ426934) Dictyostelium discoideum cDNA clone:ddv60a20, 5' ... 1193 0.0 1
(BJ387754) Dictyostelium discoideum cDNA clone:dds4p16, 5' e... 1178 0.0 1
(BJ423857) Dictyostelium discoideum cDNA clone:ddv50j18, 5' ... 1146 0.0 1
(BJ361434) Dictyostelium discoideum cDNA clone:ddc17k01, 5' ... 1082 0.0 1
(BJ445801) Dictyostelium discoideum cDNA clone:ddv60n17, 3' ... 1041 0.0 3
(BJ352646) Dictyostelium discoideum cDNA clone:dda47o07, 3' ... 1011 0.0 2
(BJ379010) Dictyostelium discoideum cDNA clone:ddc33c16, 3' ... 916 0.0 3
(BJ374885) Dictyostelium discoideum cDNA clone:ddc16l14, 3' ... 890 0.0 4
(BJ398353) Dictyostelium discoideum cDNA clone:dds12k01, 3' ... 880 0.0 2
(BJ339811) Dictyostelium discoideum cDNA clone:dda10b15, 3' ... 880 0.0 3
(BJ445814) Dictyostelium discoideum cDNA clone:ddv60a20, 3' ... 878 0.0 2
(BJ439321) Dictyostelium discoideum cDNA clone:ddv40h01, 3' ... 878 0.0 3
(BJ399197) Dictyostelium discoideum cDNA clone:dds4p16, 3' e... 878 0.0 2
(BJ442672) Dictyostelium discoideum cDNA clone:ddv50j18, 3' ... 868 0.0 2
(BJ382443) Dictyostelium discoideum cDNA clone:ddc44c22, 3' ... 868 0.0 2
(BJ375663) Dictyostelium discoideum cDNA clone:ddc19c15, 3' ... 864 0.0 2
(BJ385619) Dictyostelium discoideum cDNA clone:ddc55f16, 3' ... 862 0.0 2
(BJ426921) Dictyostelium discoideum cDNA clone:ddv60n17, 5' ... 583 0.0 3
(BJ347681) Dictyostelium discoideum cDNA clone:dda27h19, 3' ... 458 0.0 3
(BJ419970) Dictyostelium discoideum cDNA clone:ddv37e23, 5' ... 1065 0.0 1
(BJ379811) Dictyostelium discoideum cDNA clone:ddc36f03, 3' ... 874 0.0 2
(BJ384543) Dictyostelium discoideum cDNA clone:ddc49h22, 3' ... 878 0.0 2
(BJ323918) Dictyostelium discoideum cDNA clone:dda12l21, 5' ... 1015 0.0 1
(BJ438397) Dictyostelium discoideum cDNA clone:ddv37e23, 3' ... 662 0.0 2
(BJ398210) Dictyostelium discoideum cDNA clone:dds11a14, 3' ... 650 0.0 2
(BJ340754) Dictyostelium discoideum cDNA clone:dda3n17, 3' e... 702 0.0 2
(BJ374840) Dictyostelium discoideum cDNA clone:ddc16b13, 3' ... 642 0.0 2
(BJ375019) Dictyostelium discoideum cDNA clone:ddc17k01, 3' ... 650 0.0 2
(BJ411755) Dictyostelium discoideum cDNA clone:ddv5n13, 5' e... 957 0.0 2
(BJ439594) Dictyostelium discoideum cDNA clone:ddv40p20, 3' ... 658 0.0 2
(BJ381717) Dictyostelium discoideum cDNA clone:ddc42n08, 3' ... 658 0.0 2
(BJ364927) Dictyostelium discoideum cDNA clone:ddc33c16, 5' ... 866 0.0 1
(BJ402084) Dictyostelium discoideum cDNA clone:dds20n11, 3' ... 716 0.0 2
(BJ361269) Dictyostelium discoideum cDNA clone:ddc16b13, 5' ... 716 0.0 1
(BJ357892) Dictyostelium discoideum cDNA clone:dda65f01, 3' ... 357 0.0 3
(BJ429995) Dictyostelium discoideum cDNA clone:ddv5n13, 3' e... 377 0.0 2
(BJ340394) Dictyostelium discoideum cDNA clone:dda12l21, 3' ... 317 e-177 3
(AU072363) Dictyostelium discoideum slug cDNA, clone SSE294. 476 e-129 1
(AU072868) Dictyostelium discoideum slug cDNA, clone SSF278. 462 e-125 1
(AU072992) Dictyostelium discoideum slug cDNA, clone SSF655. 458 e-124 1
(BJ446713) Dictyostelium discoideum cDNA clone:ddv63i14, 3' ... 412 e-110 1
(DY894459) CeleSEQ14036 Cunninghamella elegans pBluescript (... 68 3e-39 6
(DL173543) Methods for Identifying the Target of a Compound ... 70 5e-37 10
(AX489103) Sequence 6403 from Patent WO02053728. 70 5e-37 10
(AR547792) Sequence 2923 from patent US 6747137. 70 2e-29 8
(DY888840) CeleSEQ6190 Cunninghamella elegans pBluescript (E... 68 1e-28 6
(EK365805) 1095469396550 Global-Ocean-Sampling_GS-31-01-01-1... 52 7e-28 7
(AF535132) Candida albicans acetyl-CoA synthetase (ACS2) gen... 62 4e-25 8
(EJ731372) 1092960156009 Global-Ocean-Sampling_GS-30-02-01-1... 52 3e-23 7
(DQ272742) Uncultured Bacteroidetes bacterium 'SBI2-18 P41A3... 62 4e-21 7
(EJ099531) 1095462415177 Global-Ocean-Sampling_GS-26-01-01-1... 54 4e-20 4
(EE008641) ROE00004370 Rhizopus oryzae Company Rhizopus oryz... 46 3e-19 6
(EJ717275) 1092959427837 Global-Ocean-Sampling_GS-30-02-01-1... 52 1e-18 7
(EJ576003) 1092960107813 Global-Ocean-Sampling_GS-29-01-01-1... 46 1e-18 6
(EJ540240) 1092955363538 Global-Ocean-Sampling_GS-29-01-01-1... 46 2e-18 6
(FL902657) CCGN9779.b1 CCGN Panicum virgatum etiolated seedl... 56 2e-17 5
(ER516910) 1093015524499 Global-Ocean-Sampling_GS-35-01-01-1... 72 3e-17 5
(DQ366724) Uncultured Prochlorococcus marinus clone HF10-11H... 72 4e-17 8
(FL787420) CCGF14843.b1 CCGF Panicum virgatum early floral b... 56 6e-17 5
(EK324295) 1095467000924 Global-Ocean-Sampling_GS-31-01-01-1... 60 7e-17 4
(EK306560) 1095462383168 Global-Ocean-Sampling_GS-31-01-01-1... 44 1e-16 6
(EK343851) 1095467130607 Global-Ocean-Sampling_GS-31-01-01-1... 62 2e-16 3
(EJ696045) 1092956018640 Global-Ocean-Sampling_GS-30-02-01-1... 54 2e-16 5
(EJ837983) 1093017812394 Global-Ocean-Sampling_GS-30-02-01-1... 54 2e-16 4
(EK392661) 1095469508006 Global-Ocean-Sampling_GS-31-01-01-1... 78 5e-16 3
(EJ056322) 1095456031096 Global-Ocean-Sampling_GS-26-01-01-1... 72 5e-16 4
(EJ582963) 1092960191874 Global-Ocean-Sampling_GS-29-01-01-1... 46 8e-16 6
(FL921243) CCGO13506.b1 CCGO Panicum virgatum root (H) Panic... 56 8e-16 4
(EK149325) 1095456040613 Global-Ocean-Sampling_GS-31-01-01-1... 58 2e-15 4
(EK149307) 1095456040589 Global-Ocean-Sampling_GS-31-01-01-1... 58 2e-15 4
(EK169689) 1095458069528 Global-Ocean-Sampling_GS-31-01-01-1... 58 2e-15 4
(ER632616) 1093018510828 Global-Ocean-Sampling_GS-36-01-01-2... 54 5e-15 4
(AK250613) Hordeum vulgare subsp. vulgare cDNA clone: FLbaf8... 50 5e-15 5
(EK244878) 1095460248437 Global-Ocean-Sampling_GS-31-01-01-1... 54 8e-15 5
(EJ267194) 1095351023003 Global-Ocean-Sampling_GS-27-01-01-1... 54 8e-15 4
(ER493745) 1093015338973 Global-Ocean-Sampling_GS-35-01-01-1... 62 8e-15 3
(EJ251537) 1095344035213 Global-Ocean-Sampling_GS-27-01-01-1... 54 1e-14 6
(EE009826) ROE00003037 Rhizopus oryzae Company Rhizopus oryz... 46 1e-14 5
(FM992688) Candida dubliniensis CD36 chromosome 1, complete ... 80 1e-14 2
(EJ813914) 1093017504837 Global-Ocean-Sampling_GS-30-02-01-1... 50 1e-14 5
(FL921244) CCGO13506.g1 CCGO Panicum virgatum root (H) Panic... 56 1e-14 4
(FL861866) CCGI7099.g1 CCGI Panicum virgatum etiolated seedl... 56 3e-14 3
(EK331954) 1095467026853 Global-Ocean-Sampling_GS-31-01-01-1... 66 3e-14 3
(EJ909809) 1093018531897 Global-Ocean-Sampling_GS-30-02-01-1... 54 4e-14 5
(FL965789) CCHY7284.b1 CCHY Panicum virgatum callus (N) Pani... 56 6e-14 4
(EJ660662) 1092955022264 Global-Ocean-Sampling_GS-30-02-01-1... 54 6e-14 5
(GD034920) CCHZ18303.g1 CCHZ Panicum virgatum abiotic and bi... 56 6e-14 4
(EJ875235) 1093018365973 Global-Ocean-Sampling_GS-30-02-01-1... 50 7e-14 4
(FL700446) CCGA681.g1 CCGA Panicum virgatum apex + stem (H) ... 56 7e-14 4
(FL865756) CCGI911.g1 CCGI Panicum virgatum etiolated seedli... 56 7e-14 4
(EJ880133) 1093018392060 Global-Ocean-Sampling_GS-30-02-01-1... 38 7e-14 6
(GD016280) CCHZ6796.b1 CCHZ Panicum virgatum abiotic and bio... 56 7e-14 4
(GD002364) CCHY27656.g1 CCHY Panicum virgatum callus (N) Pan... 56 7e-14 4
(GD002363) CCHY27656.b1 CCHY Panicum virgatum callus (N) Pan... 56 7e-14 4
(FL854052) CCGI3076.g1 CCGI Panicum virgatum etiolated seedl... 56 8e-14 3
(FL787421) CCGF14843.g1 CCGF Panicum virgatum early floral b... 56 8e-14 4
(FL966363) CCHY7581.g1 CCHY Panicum virgatum callus (N) Pani... 56 8e-14 4
(FL858214) CCGI5224.g1 CCGI Panicum virgatum etiolated seedl... 56 8e-14 4
(GD037139) CCHZ19222.g1 CCHZ Panicum virgatum abiotic and bi... 56 8e-14 4
(FL768397) CCGC14685.g1 CCGC Panicum virgatum early floral b... 56 8e-14 4
(GD037615) CCHZ19489.g1 CCHZ Panicum virgatum abiotic and bi... 56 8e-14 4
(FL877222) CCGN1889.g1 CCGN Panicum virgatum etiolated seedl... 56 8e-14 4
(GD016281) CCHZ6796.g1 CCHZ Panicum virgatum abiotic and bio... 56 9e-14 4
(FL902658) CCGN9779.g1 CCGN Panicum virgatum etiolated seedl... 56 9e-14 4
(GD009130) CCHZ2792.b1 CCHZ Panicum virgatum abiotic and bio... 56 1e-13 4
(EJ203957) 1092344320913 Global-Ocean-Sampling_GS-27-01-01-1... 38 1e-13 7
(EK148873) 1095456037239 Global-Ocean-Sampling_GS-31-01-01-1... 58 1e-13 3
(DY885862) CeleSEQ1325 Cunninghamella elegans pBluescript (E... 56 1e-13 3
(EK284789) 1095462309121 Global-Ocean-Sampling_GS-31-01-01-1... 44 1e-13 5
(AZ930496) 474.dhz54h09.s1 Saccharomyces unisporus NRRL Y-15... 72 2e-13 2
(EJ109063) 1092343147360 Global-Ocean-Sampling_GS-27-01-01-1... 54 2e-13 5
(FL979151) CCHY14826.g4 CCHY Panicum virgatum callus (N) Pan... 56 3e-13 4
(EK380620) 1095469460442 Global-Ocean-Sampling_GS-31-01-01-1... 50 3e-13 6
(EK000494) 1093025049573 Global-Ocean-Sampling_GS-30-02-01-1... 54 3e-13 3
(EJ302605) 1095390046567 Global-Ocean-Sampling_GS-27-01-01-1... 50 4e-13 6
(EJ452250) 1093015437145 Global-Ocean-Sampling_GS-28-01-01-1... 52 4e-13 4
(EJ290731) 1095375003985 Global-Ocean-Sampling_GS-27-01-01-1... 48 4e-13 5
(EK326653) 1095467008960 Global-Ocean-Sampling_GS-31-01-01-1... 46 5e-13 5
(EJ761594) 1092963137978 Global-Ocean-Sampling_GS-30-02-01-1... 50 7e-13 6
(FL911017) CCGO6698.b1 CCGO Panicum virgatum root (H) Panicu... 48 9e-13 4
(EK213348) 1095460106693 Global-Ocean-Sampling_GS-31-01-01-1... 48 9e-13 5
(EJ773034) 1092975700890 Global-Ocean-Sampling_GS-30-02-01-1... 50 1e-12 6
(GD031994) CCHZ16308.g1 CCHZ Panicum virgatum abiotic and bi... 56 1e-12 3
(ER361723) 1092404082927 Global-Ocean-Sampling_GS-34-01-01-1... 50 1e-12 4
(AL389602) Medicago truncatula EST MtBC56A04F1 : T3 end of c... 64 1e-12 3
(EJ881712) 1093018399164 Global-Ocean-Sampling_GS-30-02-01-1... 38 1e-12 6
(GD031993) CCHZ16308.b1 CCHZ Panicum virgatum abiotic and bi... 56 2e-12 3
(EK380857) 1095469461193 Global-Ocean-Sampling_GS-31-01-01-1... 60 2e-12 2
(EJ102459) 1093012064408 Global-Ocean-Sampling_GS-26-02-01-1... 42 3e-12 5
(EJ456864) 1093017549587 Global-Ocean-Sampling_GS-28-01-01-1... 54 4e-12 5
(EJ729021) 1092960016076 Global-Ocean-Sampling_GS-30-02-01-1... 50 4e-12 4
(EJ207751) 1092344373319 Global-Ocean-Sampling_GS-27-01-01-1... 56 4e-12 3
(EK245176) 1095460249831 Global-Ocean-Sampling_GS-31-01-01-1... 62 5e-12 3
(EJ718675) 1092959438263 Global-Ocean-Sampling_GS-30-02-01-1... 50 6e-12 4
(ER489507) 1093015319904 Global-Ocean-Sampling_GS-35-01-01-1... 46 7e-12 4
(EK358556) 1095468820206 Global-Ocean-Sampling_GS-31-01-01-1... 56 7e-12 3
(EK106707) 1092963056484 Global-Ocean-Sampling_GS-31-01-01-1... 48 8e-12 4
(ER576066) 1093015811796 Global-Ocean-Sampling_GS-36-01-01-2... 44 1e-11 5
(EJ392660) 1092963966879 Global-Ocean-Sampling_GS-28-01-01-1... 52 1e-11 5
(GD037138) CCHZ19222.b1 CCHZ Panicum virgatum abiotic and bi... 56 1e-11 4
(EJ630636) 1092963367911 Global-Ocean-Sampling_GS-29-01-01-1... 46 1e-11 5
(EJ529777) 1092955212696 Global-Ocean-Sampling_GS-29-01-01-1... 52 1e-11 3
(EK268146) 1095462242029 Global-Ocean-Sampling_GS-31-01-01-1... 44 2e-11 6
(CA258874) SCBGRT3013E01.g RT3 Saccharum officinarum cDNA cl... 42 2e-11 5
(EK353136) 1095468183798 Global-Ocean-Sampling_GS-31-01-01-1... 52 2e-11 3
(EJ987959) 1093023025369 Global-Ocean-Sampling_GS-30-02-01-1... 48 2e-11 4
(ER633406) 1093018537668 Global-Ocean-Sampling_GS-36-01-01-2... 52 2e-11 3
(EJ480562) 1095403466224 Global-Ocean-Sampling_GS-28-01-01-1... 54 3e-11 3
(EK201600) 1095460058217 Global-Ocean-Sampling_GS-31-01-01-1... 46 3e-11 6
(EJ833860) 1093017605849 Global-Ocean-Sampling_GS-30-02-01-1... 42 3e-11 5
(EJ483687) 1095403485523 Global-Ocean-Sampling_GS-28-01-01-1... 42 3e-11 6
(EJ088006) 1095460133160 Global-Ocean-Sampling_GS-26-01-01-1... 72 3e-11 3
(CJ833698) Triticum aestivum cDNA clone:whatlal40p08, 5' end. 50 4e-11 4
(AR337814) Sequence 1 from patent US 6566584. 42 4e-11 6
(EJ267683) 1095351026228 Global-Ocean-Sampling_GS-27-01-01-1... 40 4e-11 6
(EJ798899) 1093017415652 Global-Ocean-Sampling_GS-30-02-01-1... 40 4e-11 5
(CD978883) QAF6c12.yg QAF Zea mays cDNA clone QAF6c12, mRNA ... 42 4e-11 4
(CJ851978) Triticum aestivum cDNA clone:whsctal1p08, 5' end. 50 4e-11 4
(CJ833052) Triticum aestivum cDNA clone:whatlal39p08, 5' end. 50 5e-11 4
(EK545652) 1095516081654 Global-Ocean-Sampling_GS-32-01-01-1... 44 5e-11 4
(EJ238461) 1095326011103 Global-Ocean-Sampling_GS-27-01-01-1... 46 6e-11 4
(EJ276048) 1095366020865 Global-Ocean-Sampling_GS-27-01-01-1... 50 6e-11 4
(ER549903) 1093016215285 Global-Ocean-Sampling_GS-35-01-01-1... 50 7e-11 4
(EE006189) ROE00009216 Rhizopus oryzae Company Rhizopus oryz... 36 7e-11 6
(EE006178) ROE00009120 Rhizopus oryzae Company Rhizopus oryz... 36 7e-11 6
(ER361356) 1092404026257 Global-Ocean-Sampling_GS-34-01-01-1... 38 8e-11 4
(EJ442676) 1093015310855 Global-Ocean-Sampling_GS-28-01-01-1... 52 8e-11 4
(EJ057054) 1095456035923 Global-Ocean-Sampling_GS-26-01-01-1... 52 8e-11 3
(EJ152709) 1092343778071 Global-Ocean-Sampling_GS-27-01-01-1... 44 8e-11 4
(EJ626274) 1092963184949 Global-Ocean-Sampling_GS-29-01-01-1... 46 9e-11 4
(ER619439) 1093017381434 Global-Ocean-Sampling_GS-36-01-01-2... 48 9e-11 4
(BT053784) Zea mays full-length cDNA clone ZM_BFb0167E18 mRN... 42 1e-10 6
(ER523700) 1093015609169 Global-Ocean-Sampling_GS-35-01-01-1... 44 1e-10 5
(EK438310) 1095521143641 Global-Ocean-Sampling_GS-31-01-01-1... 46 1e-10 6
(AY104427) Zea mays PCO084078 mRNA sequence. 42 1e-10 5
(AW037040) 614025A12.y1 614 - root cDNA library from Walbot ... 42 2e-10 4
(EJ367065) 1092963709655 Global-Ocean-Sampling_GS-28-01-01-1... 42 2e-10 4
(ER319874) 1092344169983 Global-Ocean-Sampling_GS-34-01-01-1... 48 2e-10 4
(CP000111) Prochlorococcus marinus str. MIT 9312, complete g... 72 2e-10 2
(EK164753) 1095458046771 Global-Ocean-Sampling_GS-31-01-01-1... 48 2e-10 3
(EJ602004) 1092961199918 Global-Ocean-Sampling_GS-29-01-01-1... 48 2e-10 3
(EJ060227) 1095456059157 Global-Ocean-Sampling_GS-26-01-01-1... 46 3e-10 4
(EK150273) 1095456048134 Global-Ocean-Sampling_GS-31-01-01-1... 46 3e-10 4
(AY387595) Flavobacterium columnare strain G4 acetyl-coenzym... 46 3e-10 6
(EK499898) 1095505205894 Global-Ocean-Sampling_GS-32-01-01-1... 48 3e-10 4
(BI674812) 949067E10.y2 949 - Juvenile leaf and shoot cDNA f... 42 3e-10 4
(EH411275) RTHAIR1_66_D06.g1_A002 Sorghum bicolor BTx623 Roo... 42 3e-10 4
(EK422262) 1095515521391 Global-Ocean-Sampling_GS-31-01-01-1... 46 3e-10 3
(EK363581) 1095469366866 Global-Ocean-Sampling_GS-31-01-01-1... 52 4e-10 4
(DN228563) MEST1000_H07.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mR... 42 4e-10 4
(EJ665280) 1092955038853 Global-Ocean-Sampling_GS-30-02-01-1... 52 4e-10 4
(CA269673) SCMCRT3083F09.g RT3 Saccharum officinarum cDNA cl... 42 5e-10 4
(EK339900) 1095467057518 Global-Ocean-Sampling_GS-31-01-01-1... 40 6e-10 6
(DV493829) 1000209-H05.T7-1 UGI-Reseq Zea mays cDNA, mRNA se... 42 6e-10 4
(EK197540) 1095460044603 Global-Ocean-Sampling_GS-31-01-01-1... 58 6e-10 2
(DN227313) MEST1204_G01.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mR... 42 6e-10 4
(EC877143) ZM_BFc0010K04.f ZM_BFc Zea mays cDNA clone ZM_BFc... 42 6e-10 4
(DU749413) HF10_11_03TR HF10_10-07-02 uncultured marine micr... 50 7e-10 4
(DV495697) 1000209-H04.T7-1 UGI-Reseq Zea mays cDNA, mRNA se... 42 7e-10 4
(DN231345) MEST1011_A06.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mR... 42 7e-10 4
(EC888926) ZM_BFc0028O17.f ZM_BFc Zea mays cDNA clone ZM_BFc... 42 7e-10 4
(FE805660) CCAG26391.b1 CCAG Petrolisthes cinctipes heart, g... 48 7e-10 5
(EJ021309) 1095448004774 Global-Ocean-Sampling_GS-26-01-01-1... 50 8e-10 3
(CF635493) zmrww00_0A20-011-b10.s2 zmrww00 Zea mays cDNA 3',... 42 9e-10 4
(ER287330) 1092343579313 Global-Ocean-Sampling_GS-34-01-01-1... 38 9e-10 6
(FL858213) CCGI5224.b1 CCGI Panicum virgatum etiolated seedl... 52 1e-09 3
(EK428368) 1095516060104 Global-Ocean-Sampling_GS-31-01-01-1... 62 1e-09 3
(DU789732) APKH3274.g2 HF770_12-21-03 uncultured marine micr... 64 1e-09 3
(AR547782) Sequence 2913 from patent US 6747137. 48 1e-09 4
(EK026525) 1092955371983 Global-Ocean-Sampling_GS-31-01-01-1... 58 2e-09 2
(EJ474816) 1095403434010 Global-Ocean-Sampling_GS-28-01-01-1... 42 2e-09 5
(EK468889) 1095469439531 Global-Ocean-Sampling_GS-32-01-01-1... 48 2e-09 6
(CZ284795) cp37f04.r Candida parapsilosis Random Genomic Lib... 60 2e-09 2
(ER516635) 1093015519695 Global-Ocean-Sampling_GS-35-01-01-1... 56 2e-09 4
(EU686595) Uncultured bacterium AD235-B9 genomic sequence. 56 3e-09 7
(EK163100) 1095458040043 Global-Ocean-Sampling_GS-31-01-01-1... 50 3e-09 4
(CP000576) Prochlorococcus marinus str. MIT 9301, complete g... 64 3e-09 2
(EJ990521) 1093023045333 Global-Ocean-Sampling_GS-30-02-01-1... 54 3e-09 3
(EJ574377) 1092960083502 Global-Ocean-Sampling_GS-29-01-01-1... 50 4e-09 4
(AJ700858) Zantedeschia aethiopica EST, clone K-23-13. 54 4e-09 3
(EJ094261) 1095460256141 Global-Ocean-Sampling_GS-26-01-01-1... 54 5e-09 3
(EJ604220) 1092961218400 Global-Ocean-Sampling_GS-29-01-01-1... 56 5e-09 3
(EJ192454) 1092344210045 Global-Ocean-Sampling_GS-27-01-01-1... 58 5e-09 3
(FL853820) CCGI2938.g1 CCGI Panicum virgatum etiolated seedl... 56 6e-09 2
(EJ049873) 1095454141424 Global-Ocean-Sampling_GS-26-01-01-1... 42 6e-09 5
(BI478599) 949067E10.x1 949 - Juvenile leaf and shoot cDNA f... 42 6e-09 4
(CA148970) SCJLRZ1021D03.g RZ1 Saccharum officinarum cDNA cl... 40 6e-09 5
(EJ618324) 1092963039308 Global-Ocean-Sampling_GS-29-01-01-1... 62 8e-09 2
(FL904563) CCGO2297.b1 CCGO Panicum virgatum root (H) Panicu... 56 8e-09 3
(EK438954) 1095521429443 Global-Ocean-Sampling_GS-31-01-01-1... 56 8e-09 2
(AL033502) C.albicans cosmid Ca38F10. 48 8e-09 8
(CJ947779) Triticum aestivum cDNA clone:whchul21g21, 5' end. 50 8e-09 4
(EK087984) 1092961175946 Global-Ocean-Sampling_GS-31-01-01-1... 40 9e-09 4
(FL965790) CCHY7284.g1 CCHY Panicum virgatum callus (N) Pani... 56 9e-09 3
(CJ588909) Triticum aestivum cDNA clone rwhsc19j03 3', Y.Ogi... 50 1e-08 3
(EJ422695) 1093012241496 Global-Ocean-Sampling_GS-28-01-01-1... 52 1e-08 4
(EK384560) 1095469476048 Global-Ocean-Sampling_GS-31-01-01-1... 62 1e-08 4
(CP000685) Flavobacterium johnsoniae UW101, complete genome. 58 1e-08 2
(EJ995926) 1093023088782 Global-Ocean-Sampling_GS-30-02-01-1... 50 1e-08 3
(ER555012) 1093016302904 Global-Ocean-Sampling_GS-35-01-01-1... 50 1e-08 3
(EJ163304) 1092344056593 Global-Ocean-Sampling_GS-27-01-01-1... 44 1e-08 4
(EJ294006) 1095388015179 Global-Ocean-Sampling_GS-27-01-01-1... 38 1e-08 6
(EJ251645) 1095344037260 Global-Ocean-Sampling_GS-27-01-01-1... 40 2e-08 4
(EK310499) 1095462395432 Global-Ocean-Sampling_GS-31-01-01-1... 44 2e-08 3
(AJ476472) Hordeum vulgare EST clone S0000800061C11F1. 50 2e-08 3
(EJ862851) 1093018221470 Global-Ocean-Sampling_GS-30-02-01-1... 40 2e-08 4
(ER364076) 1093018942789 Global-Ocean-Sampling_GS-34-01-01-1... 52 2e-08 3
(EK445124) 1095467025893 Global-Ocean-Sampling_GS-32-01-01-1... 46 2e-08 4
(EJ128938) 1092343406783 Global-Ocean-Sampling_GS-27-01-01-1... 44 2e-08 3
(EK396739) 1095469524144 Global-Ocean-Sampling_GS-31-01-01-1... 40 2e-08 5
(EJ072724) 1095458098097 Global-Ocean-Sampling_GS-26-01-01-1... 54 2e-08 5
(BI788396) sag70c05.y1 Gm-c1082 Glycine max cDNA clone GENOM... 50 2e-08 3
(AW704225) sk17d07.y1 Gm-c1028 Glycine max cDNA clone GENOME... 50 3e-08 3
(CA069335) SCSFAD1068B02.g AD1 Saccharum officinarum cDNA cl... 42 3e-08 3
(EK021420) 1092955327831 Global-Ocean-Sampling_GS-31-01-01-1... 74 3e-08 2
(ER316120) 1092344143925 Global-Ocean-Sampling_GS-34-01-01-1... 40 3e-08 5
(EK215643) 1095460117544 Global-Ocean-Sampling_GS-31-01-01-1... 74 3e-08 1
(EK122633) 1092964603608 Global-Ocean-Sampling_GS-31-01-01-1... 54 3e-08 3
(EK167567) 1095458059887 Global-Ocean-Sampling_GS-31-01-01-1... 36 3e-08 5
(EJ252979) 1095347000490 Global-Ocean-Sampling_GS-27-01-01-1... 46 3e-08 4
(BJ246451) Triticum aestivum cDNA clone:whf24b09, 5' end, si... 50 4e-08 3
(DN179695) HO29I04S HO Hordeum vulgare cDNA clone HO29I04 5-... 50 4e-08 3
(EJ288936) 1095370005879 Global-Ocean-Sampling_GS-27-01-01-1... 46 4e-08 3
(ER329819) 1092344247777 Global-Ocean-Sampling_GS-34-01-01-1... 40 4e-08 4
(CJ845990) Triticum aestivum cDNA clone:whatlal39p08, 3' end. 50 4e-08 3
(EJ019555) 1095439028486 Global-Ocean-Sampling_GS-26-01-01-1... 38 4e-08 4
(EA169880) Sequence 34195 from patent US 7214786. 50 4e-08 4
(ER308626) 1092343774578 Global-Ocean-Sampling_GS-34-01-01-1... 52 4e-08 3
(CJ863577) Triticum aestivum cDNA clone:whsctal1p08, 3' end. 50 4e-08 3
(EJ929749) 1093018800769 Global-Ocean-Sampling_GS-30-02-01-1... 48 4e-08 3
(EJ685081) 1092955169927 Global-Ocean-Sampling_GS-30-02-01-1... 50 4e-08 3
(EJ046316) 1095454119266 Global-Ocean-Sampling_GS-26-01-01-1... 50 5e-08 4
(CJ846652) Triticum aestivum cDNA clone:whatlal40p08, 3' end. 50 5e-08 3
(CJ533683) Triticum aestivum cDNA clone rwhec7f08 3', Y.Ogih... 50 5e-08 3
(CJ788335) Triticum aestivum cDNA clone:whatl1j15, 3' end. 50 5e-08 3
(EJ819545) 1093017531659 Global-Ocean-Sampling_GS-30-02-01-1... 40 5e-08 3
(EJ726834) 1092959518677 Global-Ocean-Sampling_GS-30-02-01-1... 40 5e-08 3
(EJ720803) 1092959450054 Global-Ocean-Sampling_GS-30-02-01-1... 40 5e-08 3
(CP000825) Prochlorococcus marinus str. MIT 9215, complete g... 64 5e-08 2
(EJ999984) 1093025031018 Global-Ocean-Sampling_GS-30-02-01-1... 46 5e-08 3
(ER538785) 1093015892088 Global-Ocean-Sampling_GS-35-01-01-1... 48 5e-08 3
(CJ629218) Triticum aestivum cDNA clone whcs18j19 5', Y.Ogih... 50 5e-08 3
(EJ684272) 1092955162567 Global-Ocean-Sampling_GS-30-02-01-1... 48 5e-08 4
(CJ958428) Triticum aestivum cDNA clone:whchul17h13, 3' end. 50 6e-08 3
(EJ102137) 1092963179210 Global-Ocean-Sampling_GS-26-02-01-1... 42 6e-08 3
(ER509676) 1093015436349 Global-Ocean-Sampling_GS-35-01-01-1... 48 6e-08 3
(CJ520497) Triticum aestivum cDNA clone rwhcs18j19 3', Y.Ogi... 50 6e-08 3
(EK165121) 1095458048070 Global-Ocean-Sampling_GS-31-01-01-1... 46 6e-08 5
(EK111868) 1092963120539 Global-Ocean-Sampling_GS-31-01-01-1... 48 6e-08 3
(EJ951248) 1093018946961 Global-Ocean-Sampling_GS-30-02-01-1... 50 6e-08 3
(EK025218) 1092955360278 Global-Ocean-Sampling_GS-31-01-01-1... 40 6e-08 4
(EJ567346) 1092959731863 Global-Ocean-Sampling_GS-29-01-01-1... 40 6e-08 5
(EG341858) SAAH-aad04g11.g1 Agen 0058 Schmidtea mediterranea... 54 7e-08 2
(AR319414) Sequence 1964 from patent US 6562958. 52 8e-08 3
(EJ346699) 1092963552810 Global-Ocean-Sampling_GS-28-01-01-1... 58 8e-08 3
(AU033735) Dictyostelium discoideum slug cDNA, clone SLB375. 50 9e-08 2
(BJ342396) Dictyostelium discoideum cDNA clone:dda13e23, 3' ... 50 9e-08 2
(EE672516) SAAH-aab75b07.g1 Agen 0058 Schmidtea mediterranea... 54 9e-08 2
(BJ356067) Dictyostelium discoideum cDNA clone:dda59j05, 3' ... 50 9e-08 2
(EE671984) SAAH-aab69e12.g1 Agen 0058 Schmidtea mediterranea... 54 9e-08 2
(EG354655) SAAH-aac92f07.g1 Agen 0058 Schmidtea mediterranea... 54 9e-08 2
(EC385570) SAAH-aaa04d02.g1 Agen 0058 Schmidtea mediterranea... 54 9e-08 2
(BJ443160) Dictyostelium discoideum cDNA clone:ddv52g06, 3' ... 50 1e-07 2
(BJ340074) Dictyostelium discoideum cDNA clone:dda11d15, 3' ... 50 1e-07 2
(EK221400) 1095460142206 Global-Ocean-Sampling_GS-31-01-01-1... 36 1e-07 6
(EJ460203) 1093018501999 Global-Ocean-Sampling_GS-28-01-01-1... 72 1e-07 2
(EK552112) 1095516120812 Global-Ocean-Sampling_GS-32-01-01-1... 54 1e-07 2
(EJ046390) 1095454119829 Global-Ocean-Sampling_GS-26-01-01-1... 72 1e-07 1
(CP000551) Prochlorococcus marinus str. AS9601, complete gen... 72 1e-07 1
(ER410696) 1095368032546 Global-Ocean-Sampling_GS-34-01-01-1... 56 1e-07 2
(ER433831) 1092963788613 Global-Ocean-Sampling_GS-35-01-01-1... 44 1e-07 5
(FE968015) PLATE_T3_044_D11_03DEC2004_089 Opium poppy elicit... 50 1e-07 3
(EJ333440) 1092963457559 Global-Ocean-Sampling_GS-28-01-01-1... 50 1e-07 3
(EK304109) 1095462374747 Global-Ocean-Sampling_GS-31-01-01-1... 40 1e-07 4
(EJ414675) 1093012172717 Global-Ocean-Sampling_GS-28-01-01-1... 50 1e-07 4
(EK289885) 1095462326948 Global-Ocean-Sampling_GS-31-01-01-1... 58 1e-07 2
(EJ038563) 1095454082812 Global-Ocean-Sampling_GS-26-01-01-1... 46 1e-07 2
(CA608194) wr1.pk0089.b6 wr1 Triticum aestivum cDNA clone wr... 50 1e-07 2
(EJ587377) 1092961026885 Global-Ocean-Sampling_GS-29-01-01-1... 44 2e-07 3
(EJ950448) 1093018940864 Global-Ocean-Sampling_GS-30-02-01-1... 42 2e-07 4
(EJ322784) 1095403419416 Global-Ocean-Sampling_GS-27-01-01-1... 44 2e-07 4
(EK378690) 1095469450709 Global-Ocean-Sampling_GS-31-01-01-1... 36 2e-07 6
(EJ793244) 1093017387236 Global-Ocean-Sampling_GS-30-02-01-1... 38 2e-07 5
(EJ969406) 1093022069527 Global-Ocean-Sampling_GS-30-02-01-1... 44 2e-07 3
(EJ663641) 1092955033667 Global-Ocean-Sampling_GS-30-02-01-1... 62 2e-07 3
(EK367175) 1095469402447 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-07 4
(EK094189) 1092962024687 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-07 3
(CP000937) Francisella philomiragia subsp. philomiragia ATCC... 62 2e-07 2
(EJ550247) 1092959436962 Global-Ocean-Sampling_GS-29-01-01-1... 44 2e-07 4
(EK431777) 1095516157482 Global-Ocean-Sampling_GS-31-01-01-1... 42 2e-07 4
(EK317236) 1095462417839 Global-Ocean-Sampling_GS-31-01-01-1... 44 2e-07 4
(EJ165848) 1092344065615 Global-Ocean-Sampling_GS-27-01-01-1... 50 2e-07 3
(ER454760) 1092963863912 Global-Ocean-Sampling_GS-35-01-01-1... 52 2e-07 4
(EJ772194) 1092970404167 Global-Ocean-Sampling_GS-30-02-01-1... 48 2e-07 3
(EK272204) 1095462262436 Global-Ocean-Sampling_GS-31-01-01-1... 38 3e-07 5
(EJ430101) 1093015250706 Global-Ocean-Sampling_GS-28-01-01-1... 54 3e-07 3
(EK399596) 1095469535812 Global-Ocean-Sampling_GS-31-01-01-1... 44 3e-07 3
(EK070036) 1092960178427 Global-Ocean-Sampling_GS-31-01-01-1... 52 3e-07 3
(EK280058) 1095462291854 Global-Ocean-Sampling_GS-31-01-01-1... 56 3e-07 3
(EJ004143) 1091121291390 Global-Ocean-Sampling_GS-26-01-01-1... 48 3e-07 3
(ER314833) 1092344131945 Global-Ocean-Sampling_GS-34-01-01-1... 46 3e-07 4
(EJ022188) 1095448008173 Global-Ocean-Sampling_GS-26-01-01-1... 42 4e-07 4
(ER452055) 1092963853550 Global-Ocean-Sampling_GS-35-01-01-1... 62 4e-07 2
(EJ098839) 1095462343867 Global-Ocean-Sampling_GS-26-01-01-1... 50 4e-07 2
(EJ394840) 1093011992554 Global-Ocean-Sampling_GS-28-01-01-1... 60 4e-07 2
(ER333278) 1092344283324 Global-Ocean-Sampling_GS-34-01-01-1... 70 4e-07 1
(EK211257) 1095460099853 Global-Ocean-Sampling_GS-31-01-01-1... 70 4e-07 1
(EJ187821) 1092344165337 Global-Ocean-Sampling_GS-27-01-01-1... 70 4e-07 1
(EJ142524) 1092343664655 Global-Ocean-Sampling_GS-27-01-01-1... 70 4e-07 1
(ER286372) 1092343572307 Global-Ocean-Sampling_GS-34-01-01-1... 46 4e-07 4
(EJ967126) 1093022051670 Global-Ocean-Sampling_GS-30-02-01-1... 44 5e-07 4
(ER612547) 1093016321662 Global-Ocean-Sampling_GS-36-01-01-2... 50 5e-07 2
(EK310818) 1095462396388 Global-Ocean-Sampling_GS-31-01-01-1... 48 6e-07 4
(EJ582634) 1092960185718 Global-Ocean-Sampling_GS-29-01-01-1... 40 6e-07 4
(EK280692) 1095462293861 Global-Ocean-Sampling_GS-31-01-01-1... 48 6e-07 3
(EK324714) 1095467002988 Global-Ocean-Sampling_GS-31-01-01-1... 42 6e-07 4
(EC818957) SME00004506 esmbsro2 Sawyeria marylandensis cDNA,... 52 6e-07 2
(EJ492541) 1095403548790 Global-Ocean-Sampling_GS-28-01-01-1... 48 6e-07 4
(EJ416574) 1093012186503 Global-Ocean-Sampling_GS-28-01-01-1... 50 7e-07 3
(ER512822) 1093015465490 Global-Ocean-Sampling_GS-35-01-01-1... 42 7e-07 5
(ER380785) 1094338731376 Global-Ocean-Sampling_GS-34-01-01-1... 42 7e-07 4
(EJ961419) 1093022005685 Global-Ocean-Sampling_GS-30-02-01-1... 44 8e-07 4
(ER336280) 1092344309819 Global-Ocean-Sampling_GS-34-01-01-1... 62 1e-06 2
(EK338401) 1095467050862 Global-Ocean-Sampling_GS-31-01-01-1... 50 1e-06 3
(EK379858) 1095469456403 Global-Ocean-Sampling_GS-31-01-01-1... 48 1e-06 3
(ER585276) 1093015866332 Global-Ocean-Sampling_GS-36-01-01-2... 36 1e-06 5
(EK315326) 1095462411116 Global-Ocean-Sampling_GS-31-01-01-1... 50 1e-06 3
(EJ304740) 1095390069853 Global-Ocean-Sampling_GS-27-01-01-1... 36 1e-06 4
(ER520745) 1093015570021 Global-Ocean-Sampling_GS-35-01-01-1... 48 1e-06 3
(EK559159) 1095518011079 Global-Ocean-Sampling_GS-32-01-01-1... 48 1e-06 5
(EJ035573) 1095454068024 Global-Ocean-Sampling_GS-26-01-01-1... 44 1e-06 4
(EE008486) ROE00004390 Rhizopus oryzae Company Rhizopus oryz... 46 1e-06 4
(EG346390) SAAH-aad27f05.g1 Agen 0058 Schmidtea mediterranea... 54 1e-06 2
(EJ604632) 1092961221154 Global-Ocean-Sampling_GS-29-01-01-1... 40 1e-06 5
(EH090965) HvNH2A2 HvNH Hordeum vulgare cDNA clone HvNH2A2, ... 42 2e-06 3
(ER303083) 1092343721693 Global-Ocean-Sampling_GS-34-01-01-1... 54 2e-06 4
(EK478302) 1095469498452 Global-Ocean-Sampling_GS-32-01-01-1... 46 2e-06 4
(EJ619186) 1092963046220 Global-Ocean-Sampling_GS-29-01-01-1... 62 2e-06 2
(EK174246) 1095458089486 Global-Ocean-Sampling_GS-31-01-01-1... 50 2e-06 5
(ER443152) 1092963820542 Global-Ocean-Sampling_GS-35-01-01-1... 58 2e-06 2
(EK259392) 1095462097718 Global-Ocean-Sampling_GS-31-01-01-1... 36 2e-06 5
(EJ506786) 1095403722543 Global-Ocean-Sampling_GS-28-01-01-1... 38 2e-06 5
(ER604955) 1093016270597 Global-Ocean-Sampling_GS-36-01-01-2... 50 2e-06 2
(EJ237258) 1095313003678 Global-Ocean-Sampling_GS-27-01-01-1... 34 2e-06 7
(CJ960486) Triticum aestivum cDNA clone:whchul23e05, 3' end. 50 2e-06 2
(EJ322988) 1095403425579 Global-Ocean-Sampling_GS-27-01-01-1... 42 2e-06 3
(EK201870) 1095460059020 Global-Ocean-Sampling_GS-31-01-01-1... 42 2e-06 4
(EJ276820) 1095366024896 Global-Ocean-Sampling_GS-27-01-01-1... 44 2e-06 4
(EJ859166) 1093017963820 Global-Ocean-Sampling_GS-30-02-01-1... 50 2e-06 3
(EJ882168) 1093018400453 Global-Ocean-Sampling_GS-30-02-01-1... 44 2e-06 3
(EJ090354) 1095460168937 Global-Ocean-Sampling_GS-26-01-01-1... 56 2e-06 2
(EJ181292) 1092344125643 Global-Ocean-Sampling_GS-27-01-01-1... 54 2e-06 3
(EJ058004) 1095456040956 Global-Ocean-Sampling_GS-26-01-01-1... 54 2e-06 3
(EK170773) 1095458073178 Global-Ocean-Sampling_GS-31-01-01-1... 36 3e-06 5
(ER583196) 1093015852084 Global-Ocean-Sampling_GS-36-01-01-2... 44 3e-06 3
(EJ825206) 1093017556869 Global-Ocean-Sampling_GS-30-02-01-1... 50 3e-06 3
(EJ781835) 1093017261954 Global-Ocean-Sampling_GS-30-02-01-1... 40 3e-06 4
(EJ261114) 1095349039479 Global-Ocean-Sampling_GS-27-01-01-1... 44 3e-06 3
(ER596385) 1093016224197 Global-Ocean-Sampling_GS-36-01-01-2... 44 3e-06 3
(EJ550419) 1092959437738 Global-Ocean-Sampling_GS-29-01-01-1... 44 3e-06 3
(AY744396) Uncultured proteobacterium RedeBAC7D11 contig 0, ... 52 3e-06 3
(EJ933251) 1093018816924 Global-Ocean-Sampling_GS-30-02-01-1... 50 3e-06 3
(EK247365) 1095460263821 Global-Ocean-Sampling_GS-31-01-01-1... 44 3e-06 3
(EJ158473) 1092344038584 Global-Ocean-Sampling_GS-27-01-01-1... 44 3e-06 3
(BE493668) WHE0574_A02_B04ZE Triticum monococcum vegetative ... 50 3e-06 3
(EJ373026) 1092963730210 Global-Ocean-Sampling_GS-28-01-01-1... 44 3e-06 3
(EJ451835) 1093015431114 Global-Ocean-Sampling_GS-28-01-01-1... 50 4e-06 3
(EJ211640) 1092347007074 Global-Ocean-Sampling_GS-27-01-01-1... 54 4e-06 3
(EJ562161) 1092959667548 Global-Ocean-Sampling_GS-29-01-01-1... 40 4e-06 4
(ER349999) 1092346001482 Global-Ocean-Sampling_GS-34-01-01-1... 46 4e-06 3
(CD923476) G750.108K08F010530 G750 Triticum aestivum cDNA cl... 50 4e-06 3
(BQ763564) EBro02_SQ008_E19 _R root, 3 week, hydroponic grow... 42 4e-06 3
(D89121) Schizosaccharomyces pombe mRNA, partial cds, clone:... 44 5e-06 4
(EH230499) JGI_ACAC6587.fwd ACAC Phakopsora pachyrhizi TW72-... 54 5e-06 2
(EK322023) 1095462432466 Global-Ocean-Sampling_GS-31-01-01-1... 58 5e-06 2
(EK399686) 1095469536010 Global-Ocean-Sampling_GS-31-01-01-1... 52 6e-06 2
(EJ349505) 1092963573135 Global-Ocean-Sampling_GS-28-01-01-1... 54 6e-06 2
(EJ992050) 1093023058195 Global-Ocean-Sampling_GS-30-02-01-1... 46 6e-06 4
(EJ435300) 1093015277397 Global-Ocean-Sampling_GS-28-01-01-1... 60 6e-06 2
(EJ674603) 1092955073147 Global-Ocean-Sampling_GS-30-02-01-1... 42 6e-06 4
(EK060250) 1092960072370 Global-Ocean-Sampling_GS-31-01-01-1... 60 6e-06 2
(EA397610) Sequence 46434 from patent US 7314974. 44 6e-06 4
(EK095680) 1092962034676 Global-Ocean-Sampling_GS-31-01-01-1... 44 6e-06 4
(EJ313545) 1095403251982 Global-Ocean-Sampling_GS-27-01-01-1... 48 6e-06 2
(EK364667) 1095469391710 Global-Ocean-Sampling_GS-31-01-01-1... 56 6e-06 2
(DY891973) CeleSEQ8847 Cunninghamella elegans pBluescript (E... 56 7e-06 2
(EJ976283) 1093022120980 Global-Ocean-Sampling_GS-30-02-01-1... 46 7e-06 4
(BJ252381) Triticum aestivum cDNA clone:whf24b09, 3' end, si... 42 7e-06 3
(EK043987) 1092959539494 Global-Ocean-Sampling_GS-31-01-01-1... 60 7e-06 2
(ER350868) 1092346006130 Global-Ocean-Sampling_GS-34-01-01-1... 66 7e-06 1
(EJ461342) 1093018551506 Global-Ocean-Sampling_GS-28-01-01-1... 66 7e-06 1
(EE008723) ROE00003804 Rhizopus oryzae Company Rhizopus oryz... 66 7e-06 1
(EJ005411) 1091138272116 Global-Ocean-Sampling_GS-26-01-01-1... 36 7e-06 4
(CD862317) AZO1.103C21F010126 AZO1 Triticum aestivum cDNA cl... 50 7e-06 3
(CJ905534) Triticum aestivum cDNA clone:whthkles38k22, 5' end. 50 7e-06 3
(CJ582164) Triticum aestivum cDNA clone rwhrd14l23 3', Y.Ogi... 50 7e-06 3
(EK340264) 1095467059264 Global-Ocean-Sampling_GS-31-01-01-1... 38 7e-06 4
(EK157299) 1095458010909 Global-Ocean-Sampling_GS-31-01-01-1... 42 8e-06 4
(CJ836938) Triticum aestivum cDNA clone:whatlal13n24, 3' end. 50 8e-06 3
(CJ585497) Triticum aestivum cDNA clone rwhrd6o14 3', Y.Ogih... 50 8e-06 3
(CJ529228) Triticum aestivum cDNA clone rwhec10d02 3', Y.Ogi... 50 8e-06 3
(EK329854) 1095467019728 Global-Ocean-Sampling_GS-31-01-01-1... 42 8e-06 3
(EJ188659) 1092344172226 Global-Ocean-Sampling_GS-27-01-01-1... 42 8e-06 3
(CJ905242) Triticum aestivum cDNA clone:whthkles37k22, 5' end. 50 8e-06 3
(EJ142933) 1092343667016 Global-Ocean-Sampling_GS-27-01-01-1... 42 8e-06 4
(U24082) Cryptosporidium parvum acetyl-CoA synthetase gene, ... 40 8e-06 4
(ER398053) 1095349011460 Global-Ocean-Sampling_GS-34-01-01-1... 40 8e-06 4
(EJ188947) 1092344174379 Global-Ocean-Sampling_GS-27-01-01-1... 42 9e-06 4
(ER331388) 1092344266384 Global-Ocean-Sampling_GS-34-01-01-1... 44 9e-06 3
(EJ481208) 1095403469898 Global-Ocean-Sampling_GS-28-01-01-1... 36 1e-05 5
(EJ196516) 1092344244071 Global-Ocean-Sampling_GS-27-01-01-1... 50 1e-05 3
(EJ444066) 1093015316252 Global-Ocean-Sampling_GS-28-01-01-1... 40 1e-05 4
(CX635294) UCRPT02_10H02_g Poncirus trifoliata Roots with Ir... 40 1e-05 3
(EJ935579) 1093018835919 Global-Ocean-Sampling_GS-30-02-01-1... 42 1e-05 3
(CK202678) FGAS011203 Triticum aestivum FGAS: Library 3 Gate... 50 1e-05 3
(CK202991) FGAS011517 Triticum aestivum FGAS: Library 3 Gate... 50 1e-05 3
(ER374173) 1093030509402 Global-Ocean-Sampling_GS-34-01-01-1... 44 1e-05 4
(EJ891623) 1093018445556 Global-Ocean-Sampling_GS-30-02-01-1... 42 1e-05 4
(EJ997749) 1093024005969 Global-Ocean-Sampling_GS-30-02-01-1... 48 1e-05 3
(EJ031274) 1095454047842 Global-Ocean-Sampling_GS-26-01-01-1... 44 1e-05 3
(EK273149) 1095462266084 Global-Ocean-Sampling_GS-31-01-01-1... 44 1e-05 3
(EJ758909) 1092963107022 Global-Ocean-Sampling_GS-30-02-01-1... 54 1e-05 3
(EJ684199) 1092955162390 Global-Ocean-Sampling_GS-30-02-01-1... 46 1e-05 3
(CJ959906) Triticum aestivum cDNA clone:whchul21g21, 3' end. 50 1e-05 3
(EJ139029) 1092343632202 Global-Ocean-Sampling_GS-27-01-01-1... 46 1e-05 4
(EK224931) 1095460155302 Global-Ocean-Sampling_GS-31-01-01-1... 48 1e-05 3
(EJ084301) 1095460084194 Global-Ocean-Sampling_GS-26-01-01-1... 46 1e-05 3
(EK225124) 1095460155989 Global-Ocean-Sampling_GS-31-01-01-1... 44 1e-05 3
(EJ793843) 1093017390137 Global-Ocean-Sampling_GS-30-02-01-1... 44 1e-05 3
(EJ919073) 1093018590724 Global-Ocean-Sampling_GS-30-02-01-1... 46 1e-05 4
(EK138020) 1095454025914 Global-Ocean-Sampling_GS-31-01-01-1... 42 1e-05 3
(AJ877231) Mucor circinelloides partial mRNA for acetyl-coen... 38 1e-05 5
(ER324733) 1092344201580 Global-Ocean-Sampling_GS-34-01-01-1... 46 1e-05 3
(EJ741918) 1092962023593 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-05 3
(DQ366721) Uncultured Prochlorococcus marinus clone HF10-11A... 50 2e-05 5
(EJ045511) 1095454116011 Global-Ocean-Sampling_GS-26-01-01-1... 46 2e-05 5
(ER552960) 1093016263161 Global-Ocean-Sampling_GS-35-01-01-1... 46 2e-05 2
(FD528453) RUS97H02w HZ Hordeum vulgare subsp. vulgare cDNA ... 50 2e-05 2
(ER333703) 1092344285620 Global-Ocean-Sampling_GS-34-01-01-1... 46 2e-05 2
(EJ885512) 1093018414904 Global-Ocean-Sampling_GS-30-02-01-1... 46 2e-05 2
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 50 2e-05 14
(EK209162) 1095460092427 Global-Ocean-Sampling_GS-31-01-01-1... 50 2e-05 2
(EJ616766) 1092963024008 Global-Ocean-Sampling_GS-29-01-01-1... 40 2e-05 4
(EK388552) 1095469492257 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-05 2
(EJ861890) 1093018205361 Global-Ocean-Sampling_GS-30-02-01-1... 46 3e-05 2
(EJ250816) 1095344031347 Global-Ocean-Sampling_GS-27-01-01-1... 40 3e-05 4
(ER570505) 1093015790483 Global-Ocean-Sampling_GS-36-01-01-2... 46 3e-05 2
(EJ687933) 1092955206349 Global-Ocean-Sampling_GS-30-02-01-1... 50 3e-05 2
(EK217261) 1095460122922 Global-Ocean-Sampling_GS-31-01-01-1... 64 3e-05 1
(CP000553) Prochlorococcus marinus str. NATL1A, complete gen... 64 3e-05 1
(AE017126) Prochlorococcus marinus subsp. marinus str. CCMP1... 64 3e-05 1
(EE009584) ROE00005880 Rhizopus oryzae Company Rhizopus oryz... 46 3e-05 3
(CA213103) SCQGSB1137D05.g SB1 Saccharum officinarum cDNA cl... 42 3e-05 2
(CA259054) SCEQRT3016A02.g RT3 Saccharum officinarum cDNA cl... 42 3e-05 2
(CF008133) QBI7f12.xg QBI Zea mays cDNA clone QBI7f12, mRNA ... 42 3e-05 2
>(AC115612) Dictyostelium discoideum chromosome 2 map 6245135-6357017
strain AX4, complete sequence.
Length = 111882
Score = 3116 bits (1572), Expect(2) = 0.0
Identities = 1581/1585 (99%)
Strand = Plus / Minus
Query: 584 gatcattcgaaaaaggtgatatttcatggtttttaaatggtaaaattaatgtttcatata 643
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79634 gatcattcgaaaaaggtgatatttcatggtttttaaatggtaaaattaatgtttcatata 79575
Query: 644 attgtatcgatagacatttaaaagagaatgcagataaagttgcaatactatttgaaggtg 703
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79574 attgtatcgatagacatttaaaagagaatgcagataaagttgcaatactatttgaaggtg 79515
Query: 704 atgaagaaacaatggttaaaaaagttacatatagagagatgtttgaagaggtttgtagat 763
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79514 atgaagaaacaatggttaaaaaagttacatatagagagatgtttgaagaggtttgtagat 79455
Query: 764 tatcaaatcttttgatatcacttggcgttggtaaaggagatacggtagcgatctatctac 823
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79454 tatcaaatcttttgatatcacttggcgttggtaaaggagatacggtagcgatctatctac 79395
Query: 824 caaacacaccaaccgccatttattcaatgttagcatgcgctagaattggagcaattcatt 883
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79394 caaacacaccaaccgccatttattcaatgttagcatgcgctagaattggagcaattcatt 79335
Query: 884 cagttatttttgcaggatttggttatgaatccattgtttcacgtgttcatgatgcaaaat 943
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79334 cagttatttttgcaggatttggttatgaatccattgtttcacgtgttcatgatgcaaaat 79275
Query: 944 gtagagtgatcataacggctgatgaaggtttaagaggtggtagatatataccactaaaag 1003
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79274 gtagagtgatcataacggctgatgaaggtttaagaggtggtagatatataccactaaaag 79215
Query: 1004 aaaagattgatcaagttgttcaacattgcaaattggtacaacatgtacttgtttttaaaa 1063
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79214 aaaagattgatcaagttgttcaacattgcaaattggtacaacatgtacttgtttttaaaa 79155
Query: 1064 atacaggtagaccaacaattacatttaatccatcaattgatatttgggcagatgaagcaa 1123
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79154 atacaggtagaccaacaattacatttaatccatcaattgatatttgggcagatgaagcaa 79095
Query: 1124 tgttggatcatcgtccatattgtccaccagtttggttagattcagaagatcccttattta 1183
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79094 tgttggatcatcgtccatattgtccaccagtttggttagattcagaagatcccttattta 79035
Query: 1184 tcctttacacaagtggtagcactggtacaccaaagggtttagtacatactcaggctggtt 1243
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79034 tcctttacacaagtggtagcactggtacaccaaagggtttagtacatactcaggctggtt 78975
Query: 1244 atctactatacgccgcaatgactcatcgttatgttttcgattatcacgattccgatgttt 1303
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78974 atctactatacgccgcaatgactcatcgttatgttttcgattatcacgattccgatgttt 78915
Query: 1304 atgcttgtatggctgatgttggttggattacaggtcatagttatatcgtttatggtccat 1363
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78914 atgcttgtatggctgatgttggttggattacaggtcatagttatatcgtttatggtccat 78855
Query: 1364 tggcaaatgnnncaacaacttttatctttgagggtactcctctttatccaactccagcac 1423
||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78854 tggcaaatggtgcaacaacttttatctttgagggtactcctctttatccaactccagcac 78795
Query: 1424 gttattgggaaatggtacaacgtcataaaatcactcaattctatacagcaccaactgcaa 1483
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78794 gttattgggaaatggtacaacgtcataaaatcactcaattctatacagcaccaactgcaa 78735
Query: 1484 ttcgttcactaatgaaattcccaatatcatttactcaacaatccgataaatcatccctta 1543
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78734 ttcgttcactaatgaaattcccaatatcatttactcaacaatccgataaatcatccctta 78675
Query: 1544 gagttttaggttcagtcggtgaaccaattaatcctgaagcctggagatggttcaatacaa 1603
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78674 gagttttaggttcagtcggtgaaccaattaatcctgaagcctggagatggttcaatacaa 78615
Query: 1604 acgttggtgaaggtcgttgtgcaatcgttgatacctattggcaaactgaaagtggtggtc 1663
||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||
Sbjct: 78614 acgttggtgaaggtcgttgtgcaatcgttgatacctattggcaaattgaaagtggtggtc 78555
Query: 1664 atttaattactccattacctggtgttacttcaactaaacctggttcagcaactaaacctt 1723
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78554 atttaattactccattacctggtgttacttcaactaaacctggttcagcaactaaacctt 78495
Query: 1724 tctttggtatagaattacaagttttagactcaaaaactggtgaacgtttatatattaatc 1783
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78494 tctttggtatagaattacaagttttagactcaaaaactggtgaacgtttatatattaatc 78435
Query: 1784 ccgatatcaatggttgtaaagaaatttctggtgtattggcaatctctaaaccttggccag 1843
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78434 ccgatatcaatggttgtaaagaaatttctggtgtattggcaatctctaaaccttggccag 78375
Query: 1844 gtattgctcgttcagtttatcgttctcatggtcgttatcttcaaacttatatgactcaat 1903
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78374 gtattgctcgttcagtttatcgttctcatggtcgttatcttcaaacttatatgactcaat 78315
Query: 1904 ataaaggtcactatttcactggtgatggtgtaaaacttgactctgatggttattattgga 1963
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78314 ataaaggtcactatttcactggtgatggtgtaaaacttgactctgatggttattattgga 78255
Query: 1964 tcgaaggtagagtagatgatgttatcaatgttagtggtcatagattaggtactgctgaat 2023
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78254 tcgaaggtagagtagatgatgttatcaatgttagtggtcatagattaggtactgctgaat 78195
Query: 2024 tagagagtgccctcgttggttgttcaatttgtgcagaggctgccgttgttggttatcctc 2083
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78194 tagagagtgccctcgttggttgttcaatttgtgcagaggctgccgttgttggttatcctc 78135
Query: 2084 atgatatcaaaggtcaaggtattttagcattttgtacactcaaagaaggttatcaagagg 2143
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78134 atgatatcaaaggtcaaggtattttagcattttgtacactcaaagaaggttatcaagagg 78075
Query: 2144 atgaatcaaatgttattatgatgtt 2168
|||||||||||||||||||||||||
Sbjct: 78074 atgaatcaaatgttattatgatgtt 78050
Score = 377 bits (190), Expect(2) = 0.0
Identities = 190/190 (100%)
Strand = Plus / Minus
Query: 2176 gaagttagaaatgtaattggtccatttgcaacacctgatgtaattgttataacaccttca 2235
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 78042 gaagttagaaatgtaattggtccatttgcaacacctgatgtaattgttataacaccttca 77983
Query: 2236 cttccaaaaactcgtagtggtaaaattatgagaagaattcttagaaaaattggttgtcat 2295
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77982 cttccaaaaactcgtagtggtaaaattatgagaagaattcttagaaaaattggttgtcat 77923
Query: 2296 gaatcttctgctgaacaattaggtgatatttcaactttagctgaacctgaagttgtcaaa 2355
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77922 gaatcttctgctgaacaattaggtgatatttcaactttagctgaacctgaagttgtcaaa 77863
Query: 2356 cttttaattg 2365
||||||||||
Sbjct: 77862 cttttaattg 77853
Score = 444 bits (224), Expect = e-120
Identities = 224/224 (100%)
Strand = Plus / Minus
Query: 361 ttaagatagttgaacatgcaaattacagaaaaagaaacagtacaagaagaacaacaaaaa 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79953 ttaagatagttgaacatgcaaattacagaaaaagaaacagtacaagaagaacaacaaaaa 79894
Query: 421 ttactatatccaccaccttcttttagtacaaaatgtcatatatcatcagtagaacaatat 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79893 ttactatatccaccaccttcttttagtacaaaatgtcatatatcatcagtagaacaatat 79834
Query: 481 aatgaaatgtataaagaaagtattgaatcaccaaatcaattttgggataaaaaagctaaa 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79833 aatgaaatgtataaagaaagtattgaatcaccaaatcaattttgggataaaaaagctaaa 79774
Query: 541 gaatttttaacttggttttctgattatacaactgttcaacatgg 584
||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 79773 gaatttttaacttggttttctgattatacaactgttcaacatgg 79730
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 2,827,745,961
Number of extensions: 168499705
Number of successful extensions: 13564205
Number of sequences better than 10.0: 1653
Length of query: 2439
Length of database: 101,790,757,118
Length adjustment: 25
Effective length of query: 2414
Effective length of database: 99,238,119,368
Effective search space: 239560820154352
Effective search space used: 239560820154352
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 7.28 |
| Homology vs Protein |
Query= Contig-U16501-1 (Contig-U16501-1Q) /CSM_Contig/Contig-U16501-1Q.Seq.d
(2439 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54Z60) RecName: Full=Acetyl-coenzyme A synthetase; EC... 1355 0.0
AC115612_37(AC115612|pid:none) Dictyostelium discoideum chromoso... 1352 0.0
CR940353_190(CR940353|pid:none) Theileria annulata strain Ankara... 726 0.0
(Q01576) RecName: Full=Acetyl-coenzyme A synthetase; EC... 725 0.0
CP000744_5378(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 723 0.0
FM209186_5118(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 721 0.0
(B5ZV36) RecName: Full=Acetyl-coenzyme A synthetase; EC... 716 0.0
AM236080_4723(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 715 0.0
CP000083_3831(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 714 0.0
(Q21LV0) RecName: Full=Acetyl-coenzyme A synthetase; EC... 714 0.0
AM236082_44(AM236082|pid:none) Rhizobium leguminosarum bv. vicia... 712 0.0
(A0LG91) RecName: Full=Acetyl-coenzyme A synthetase; EC... 712 0.0
(Q6MNF1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 711 0.0
(Q0AAW0) RecName: Full=Acetyl-coenzyme A synthetase; EC... 710 0.0
(Q89WV5) RecName: Full=Acetyl-coenzyme A synthetase; EC... 708 0.0
BA000040_573(BA000040|pid:none) Bradyrhizobium japonicum USDA 11... 708 0.0
(Q2K2T1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 706 0.0
Y15418_1(Y15418|pid:none) Coprinus cinereus acs-1 gene. 706 0.0
(A1WY97) RecName: Full=Acetyl-coenzyme A synthetase; EC... 706 0.0
(Q92KX2) RecName: Full=Acetyl-coenzyme A synthetase 2; ... 704 0.0
CP000377_1489(CP000377|pid:none) Silicibacter sp. TM1040, comple... 704 0.0
BX572593_212(BX572593|pid:none) Rhodopseudomonas palustris CGA00... 704 0.0
CP000301_42(CP000301|pid:none) Rhodopseudomonas palustris BisB18... 704 0.0
AP009384_301(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 704 0.0
CP001096_207(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 704 0.0
CP000628_3731(CP000628|pid:none) Agrobacterium radiobacter K84 c... 703 0.0
(Q07VK4) RecName: Full=Acetyl-coenzyme A synthetase; EC... 703 0.0
CP001157_4130(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 702 0.0
(B8FIN2) RecName: Full=Acetyl-coenzyme A synthetase; EC... 702 0.0
(B1M0M1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 701 0.0
CP000934_2904(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 700 0.0
(B2IB12) RecName: Full=Acetyl-coenzyme A synthetase; EC... 700 0.0
CP000680_3568(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 699 0.0
CP000494_320(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 699 0.0
CP000115_466(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,... 698 0.0
CP000250_318(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 697 0.0
CP000143_2185(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 696 0.0
CP000613_2284(CP000613|pid:none) Rhodospirillum centenum SW, com... 696 0.0
CP000094_4809(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 696 0.0
CP000319_546(CP000319|pid:none) Nitrobacter hamburgensis X14, co... 696 0.0
AE008688_2695(AE008688|pid:none) Agrobacterium tumefaciens str. ... 696 0.0
(A5VSF3) RecName: Full=Acetyl-coenzyme A synthetase; EC... 696 0.0
(Q8UBV5) RecName: Full=Acetyl-coenzyme A synthetase; EC... 696 0.0
(A6WXV8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 696 0.0
CP000577_2215(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 696 0.0
(Q6FYL4) RecName: Full=Acetyl-coenzyme A synthetase; EC... 696 0.0
(Q6G1W0) RecName: Full=Acetyl-coenzyme A synthetase; EC... 695 0.0
CP000633_3221(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 695 0.0
(A7HSR8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 694 0.0
CP000830_3537(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 694 0.0
(B1ZB59) RecName: Full=Acetyl-coenzyme A synthetase; EC... 694 0.0
CP000390_3397(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 694 0.0
CP000661_504(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 693 0.0
(A9WWT6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 693 0.0
(A7IFD4) RecName: Full=Acetyl-coenzyme A synthetase; EC... 692 0.0
CP001510_2336(CP001510|pid:none) Methylobacterium extorquens AM1... 692 0.0
CP001196_325(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 691 0.0
CP001103_707(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 691 0.0
CP000500_267(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 691 0.0
CP001488_1709(CP001488|pid:none) Brucella melitensis ATCC 23457 ... 691 0.0
(P16929) RecName: Full=Acetyl-coenzyme A synthetase; EC... 691 0.0
CP001298_2654(CP001298|pid:none) Methylobacterium chloromethanic... 691 0.0
(Q8YJ48) RecName: Full=Acetyl-coenzyme A synthetase; EC... 690 0.0
CP001280_1210(CP001280|pid:none) Methylocella silvestris BL2, co... 688 0.0
(A4YK73) RecName: Full=Acetyl-coenzyme A synthetase; EC... 688 0.0
CP000113_5707(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 688 0.0
(Q98ET8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 688 0.0
CU459003_1196(CU459003|pid:none) Magnetospirillum gryphiswaldens... 687 0.0
CP001339_1001(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 687 0.0
CP000285_857(CP000285|pid:none) Chromohalobacter salexigens DSM ... 685 0.0
AP007255_4177(AP007255|pid:none) Magnetospirillum magneticum AMB... 684 0.0
CP000362_2174(CP000362|pid:none) Roseobacter denitrificans OCh 1... 684 0.0
CP000949_730(CP000949|pid:none) Pseudomonas putida W619, complet... 683 0.0
DQ068067_97(DQ068067|pid:none) Uncultured bacterium BAC13K9BAC, ... 682 0.0
CP001349_4595(CP001349|pid:none) Methylobacterium nodulans ORS 2... 682 0.0
CP000712_4510(CP000712|pid:none) Pseudomonas putida F1, complete... 681 0.0
(Q88DW6) RecName: Full=Acetyl-coenzyme A synthetase 2; ... 681 0.0
CP000943_2776(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 681 0.0
(Q750T7) RecName: Full=Acetyl-coenzyme A synthetase 2; ... 678 0.0
(A4Y7Y7) RecName: Full=Acetyl-coenzyme A synthetase; EC... 677 0.0
CP000449_1617(CP000449|pid:none) Maricaulis maris MCS10, complet... 676 0.0
CT573326_4400(CT573326|pid:none) Pseudomonas entomophila str. L4... 676 0.0
(B0TPY4) RecName: Full=Acetyl-coenzyme A synthetase; EC... 676 0.0
CP000964_5077(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 676 0.0
AP006725_311(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 676 0.0
AE017340_1995(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 674 0.0
CP000491_35(CP000491|pid:none) Paracoccus denitrificans PD1222 p... 674 0.0
(A1U2S9) RecName: Full=Acetyl-coenzyme A synthetase; EC... 674 0.0
(Q2NR28) RecName: Full=Acetyl-coenzyme A synthetase; EC... 674 0.0
(Q0HHN4) RecName: Full=Acetyl-coenzyme A synthetase; EC... 673 0.0
(Q0VSR6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 673 0.0
(A3QD52) RecName: Full=Acetyl-coenzyme A synthetase; EC... 673 0.0
(Q0HTY6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 673 0.0
CP000880_3276(CP000880|pid:none) Salmonella enterica subsp. ariz... 672 0.0
CP000026_3797(CP000026|pid:none) Salmonella enterica subsp. ente... 672 0.0
A18007_1(A18007|pid:none) FacA gene seq ID No:1. 672 0.0
CP000264_3703(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 672 0.0
(A0KY83) RecName: Full=Acetyl-coenzyme A synthetase; EC... 672 0.0
(P36333) RecName: Full=Acetyl-coenzyme A synthetase; EC... 672 0.0
(Q8Z1R0) RecName: Full=Acetyl-coenzyme A synthetase; EC... 672 0.0
CU928178_617(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 672 0.0
(A7MPJ7) RecName: Full=Acetyl-coenzyme A synthetase; EC... 672 0.0
(A8AN29) RecName: Full=Acetyl-coenzyme A synthetase; EC... 671 0.0
CP000857_4205(CP000857|pid:none) Salmonella enterica subsp. ente... 671 0.0
CP001127_4201(CP001127|pid:none) Salmonella enterica subsp. ente... 671 0.0
(Q8ZKF6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 671 0.0
CR543861_3123(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 671 0.0
CU928171_466(CU928171|pid:none) Kluyveromyces thermotolerans str... 671 0.0
CP000439_710(CP000439|pid:none) Francisella tularensis subsp. no... 670 0.0
FM180568_4392(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 669 0.0
(Q8FAY8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 669 0.0
CP000243_4557(CP000243|pid:none) Escherichia coli UTI89, complet... 669 0.0
FM992689_942(FM992689|pid:none) Candida dubliniensis CD36 chromo... 669 0.0
CP000802_4072(CP000802|pid:none) Escherichia coli HS, complete g... 669 0.0
CP000521_3617(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 669 0.0
FM178379_2832(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 668 0.0
AM933173_3976(AM933173|pid:none) Salmonella enterica subsp. ente... 668 0.0
CP000038_3949(CP000038|pid:none) Shigella sonnei Ss046, complete... 668 0.0
(P27550) RecName: Full=Acetyl-coenzyme A synthetase; EC... 668 0.0
(A0KNI2) RecName: Full=Acetyl-coenzyme A synthetase; EC... 668 0.0
CP000886_5102(CP000886|pid:none) Salmonella enterica subsp. ente... 667 0.0
CP000961_2700(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 667 0.0
CP000094_4288(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 667 0.0
CP000927_111(CP000927|pid:none) Caulobacter sp. K31, complete ge... 666 0.0
(Q6BS00) RecName: Full=Acetyl-coenzyme A synthetase 2; ... 666 0.0
CP000926_4671(CP000926|pid:none) Pseudomonas putida GB-1, comple... 666 0.0
EU891278_1(EU891278|pid:none) Escherichia coli strain TB182A ace... 666 0.0
CP000266_3838(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 666 0.0
(Q8EDK3) RecName: Full=Acetyl-coenzyme A synthetase; EC... 666 0.0
(A4TS06) RecName: Full=Acetyl-coenzyme A synthetase; EC... 665 0.0
(Q2G512) RecName: Full=Acetyl-coenzyme A synthetase; EC... 665 0.0
(A7FNG1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 665 0.0
CP000950_3872(CP000950|pid:none) Yersinia pseudotuberculosis YPI... 664 0.0
(P16928) RecName: Full=Acetyl-coenzyme A synthetase; EC... 664 0.0
CT573326_3599(CT573326|pid:none) Pseudomonas entomophila str. L4... 664 0.0
AE009952_503(AE009952|pid:none) Yersinia pestis KIM, complete ge... 663 0.0
(Q88EH6) RecName: Full=Acetyl-coenzyme A synthetase 1; ... 663 0.0
CP000712_1409(CP000712|pid:none) Pseudomonas putida F1, complete... 663 0.0
CP000076_4455(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 662 0.0
CP000499_534(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 662 0.0
AM942759_3012(AM942759|pid:none) Proteus mirabilis strain HI4320... 662 0.0
CP000158_1385(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 662 0.0
CU468230_3285(CU468230|pid:none) Acinetobacter baumannii str. SD... 662 0.0
(Q9KV59) RecName: Full=Acetyl-coenzyme A synthetase; EC... 662 0.0
CP001157_3334(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 662 0.0
AM181176_4658(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 661 0.0
FM992688_400(FM992688|pid:none) Candida dubliniensis CD36 chromo... 661 0.0
FP236842_3273(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 661 0.0
SYASAA(S09245) acetate-CoA ligase (EC 6.2.1.1) - Emericella nidu... 661 0.0
AM270079_4(AM270079|pid:none) Aspergillus niger contig An04c0180... 660 0.0
(Q6BQF2) RecName: Full=Acetyl-coenzyme A synthetase 1; ... 660 0.0
CP000699_3452(CP000699|pid:none) Sphingomonas wittichii RW1, com... 660 0.0
(Q15YI8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 660 0.0
AM039952_4275(AM039952|pid:none) Xanthomonas campestris pv. vesi... 658 0.0
AM920689_4303(AM920689|pid:none) Xanthomonas campestris pv. camp... 658 0.0
CP000697_2254(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 658 0.0
CU468135_3068(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 658 0.0
(Q8DCZ9) RecName: Full=Acetyl-coenzyme A synthetase; EC... 657 0.0
(Q7MBA6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 657 0.0
(P78773) RecName: Full=Probable acetyl-coenzyme A synthetase; ... 657 0.0
(Q7MGU3) RecName: Full=Acetyl-coenzyme A synthetase; EC... 657 0.0
BA000037_3133(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 657 0.0
(Q72LY9) RecName: Full=Acetyl-coenzyme A synthetase; EC... 656 0.0
AE013598_4448(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 656 0.0
(Q2NXE2) RecName: Full=Acetyl-coenzyme A synthetase; EC... 655 0.0
CP000941_1319(CP000941|pid:none) Xylella fastidiosa M12, complet... 655 0.0
(A1S7C8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 655 0.0
CP000680_3087(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 654 0.0
(Q056J9) RecName: Full=Acetyl-coenzyme A synthetase; EC... 654 0.0
CP000155_4837(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 654 0.0
CP000937_1881(CP000937|pid:none) Francisella philomiragia subsp.... 653 0.0
AP010904_1777(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 653 0.0
(Q885K7) RecName: Full=Acetyl-coenzyme A synthetase; EC... 651 0.0
AK158119_1(AK158119|pid:none) Mus musculus adult inner ear cDNA,... 651 0.0
(Q9PB89) RecName: Full=Acetyl-coenzyme A synthetase; EC... 648 0.0
(Q48G09) RecName: Full=Acetyl-coenzyme A synthetase; EC... 648 0.0
FM954972_2773(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 647 0.0
AF521015_14(AF521015|pid:none) Rhizobium vitis strain F2/5 parti... 647 0.0
AP009389_2131(AP009389|pid:none) Pelotomaculum thermopropionicum... 647 0.0
(Q87C00) RecName: Full=Acetyl-coenzyme A synthetase; EC... 647 0.0
BC072788_1(BC072788|pid:none) Xenopus laevis MGC80104 protein, m... 646 0.0
(Q87KU7) RecName: Full=Acetyl-coenzyme A synthetase; EC... 645 0.0
CP000789_156(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 644 0.0
BC159207_1(BC159207|pid:none) Danio rerio zgc:113194, mRNA (cDNA... 644 0.0
CP000713_619(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 643 0.0
CP000859_1969(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 640 0.0
CP000112_3200(CP000112|pid:none) Desulfovibrio desulfuricans G20... 640 0.0
(Q01574) RecName: Full=Acetyl-coenzyme A synthetase 1; ... 640 0.0
CP000157_932(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 639 0.0
AY723758_1(AY723758|pid:none) Saccharomyces cerevisiae clone FLH... 639 0.0
BC039261_1(BC039261|pid:none) Homo sapiens acyl-CoA synthetase s... 638 0.0
(A6VZN8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 637 0.0
CU928175_23(CU928175|pid:none) Zygosaccharomyces rouxii strain C... 635 e-180
BC114698_1(BC114698|pid:none) Bos taurus acyl-CoA synthetase sho... 634 e-180
CP001649_2809(CP001649|pid:none) Desulfovibrio salexigens DSM 26... 634 e-180
AB046741_1(AB046741|pid:none) Bos taurus AceCS2 mRNA for acetyl-... 634 e-180
DQ272742_14(DQ272742|pid:none) Uncultured Bacteroidetes bacteriu... 634 e-180
AK092281_1(AK092281|pid:none) Homo sapiens cDNA FLJ34962 fis, cl... 634 e-180
AL049709_4(AL049709|pid:none) Human DNA sequence from clone RP1-... 633 e-180
BC044588_1(BC044588|pid:none) Homo sapiens acyl-CoA synthetase s... 630 e-179
AK053877_1(AK053877|pid:none) Mus musculus 0 day neonate eyeball... 630 e-179
AK029014_1(AK029014|pid:none) Mus musculus 10 days neonate skin ... 630 e-179
CP001334_106(CP001334|pid:none) Micromonas sp. RCC299 chromosome... 627 e-178
(Q9QXG4) RecName: Full=Acetyl-coenzyme A synthetase, cytoplasmic... 627 e-178
CR628336_141(CR628336|pid:none) Legionella pneumophila str. Pari... 625 e-177
AK093831_1(AK093831|pid:none) Mus musculus cDNA fis, clone TRACH... 625 e-177
BA000045_159(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 625 e-177
(Q4FVA1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 625 e-177
CP000661_776(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 625 e-177
(Q1QEB6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 624 e-177
CP001197_1758(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 622 e-176
CR628337_126(CR628337|pid:none) Legionella pneumophila str. Lens... 622 e-176
CP000527_400(CP000527|pid:none) Desulfovibrio vulgaris subsp. vu... 621 e-176
CP000553_675(CP000553|pid:none) Prochlorococcus marinus str. NAT... 621 e-176
CP000675_146(CP000675|pid:none) Legionella pneumophila str. Corb... 617 e-175
AM236084_118(AM236084|pid:none) Rhizobium leguminosarum bv. vici... 617 e-175
AK317115_1(AK317115|pid:none) Arabidopsis thaliana AT5G36880 mRN... 617 e-175
AB025605_15(AB025605|pid:none) Arabidopsis thaliana genomic DNA,... 617 e-175
A56614(A56614;S24925) acetate-CoA ligase (EC 6.2.1.1) - basidiom... 616 e-174
CU207366_1881(CU207366|pid:none) Gramella forsetii KT0803 comple... 615 e-174
(Q5SIW6) RecName: Full=Acetyl-coenzyme A synthetase; EC... 614 e-174
CP001472_2676(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 613 e-174
CR855110_5(CR855110|pid:none) Oryza sativa genomic DNA, chromoso... 613 e-174
AC136505_13(AC136505|pid:none) Medicago truncatula clone mth2-24... 612 e-173
BX548174_676(BX548174|pid:none) Prochlorococcus marinus MED4 com... 610 e-173
SYNCAA(S09244) acetate-CoA ligase (EC 6.2.1.1) - Neurospora cras... 607 e-172
X98506_1(X98506|pid:none) S.tuberosum mRNA for acetyl-CoA synthe... 604 e-171
CP000582_350(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 603 e-170
AP006840_881(AP006840|pid:none) Symbiobacterium thermophilum IAM... 598 e-169
AL844852_8(AL844852|pid:none) Mouse DNA sequence from clone RP23... 598 e-169
CP000109_1116(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 596 e-168
CP001154_1220(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 596 e-168
AL117263_1(AL117263|pid:none) Leishmania major Friedlin chromoso... 596 e-168
AM502241_87(AM502241|pid:none) Leishmania infantum chromosome 23. 596 e-168
AK029262_1(AK029262|pid:none) Mus musculus 0 day neonate head cD... 595 e-168
CP000576_646(CP000576|pid:none) Prochlorococcus marinus str. MIT... 595 e-168
CP001275_686(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 595 e-168
AM502241_57(AM502241|pid:none) Leishmania infantum chromosome 23. 593 e-168
(Q1AXQ5) RecName: Full=Acetyl-coenzyme A synthetase; EC... 593 e-167
CT005262_57(CT005262|pid:none) Leishmania major strain Friedlin,... 593 e-167
(Q9CMW1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 592 e-167
CP001032_2820(CP001032|pid:none) Opitutus terrae PB90-1, complet... 592 e-167
AM889285_2446(AM889285|pid:none) Gluconacetobacter diazotrophicu... 592 e-167
CR954202_325(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 591 e-167
AP008230_515(AP008230|pid:none) Desulfitobacterium hafniense Y51... 591 e-167
CP000825_698(CP000825|pid:none) Prochlorococcus marinus str. MIT... 590 e-167
CP000551_674(CP000551|pid:none) Prochlorococcus marinus str. AS9... 590 e-167
CP000552_685(CP000552|pid:none) Prochlorococcus marinus str. MIT... 590 e-167
(Q8DKH2) RecName: Full=Acetyl-coenzyme A synthetase; EC... 590 e-167
AE017126_1039(AE017126|pid:none) Prochlorococcus marinus subsp. ... 590 e-166
AM494960_80(AM494960|pid:none) Leishmania braziliensis chromosom... 589 e-166
CP000097_1308(CP000097|pid:none) Synechococcus sp. CC9902, compl... 589 e-166
D89121_1(D89121|pid:none) Schizosaccharomyces pombe mRNA, partia... 587 e-166
CP001132_1597(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 587 e-166
CP001279_969(CP001279|pid:none) Nautilia profundicola AmH, compl... 587 e-166
(Q8KBY0) RecName: Full=Acetyl-coenzyme A synthetase; EC... 587 e-166
CP000554_1885(CP000554|pid:none) Prochlorococcus marinus str. MI... 586 e-165
AC159420_28(AC159420|pid:none) Trypanosoma brucei chromosome 8 c... 586 e-165
CP000393_2061(CP000393|pid:none) Trichodesmium erythraeum IMS101... 585 e-165
CP001099_531(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 585 e-165
BT053784_1(BT053784|pid:none) Zea mays full-length cDNA clone ZM... 583 e-165
AM902716_1790(AM902716|pid:none) Bordetella petrii strain DSM 12... 583 e-164
CT971583_1040(CT971583|pid:none) Synechococcus WH7803 complete g... 582 e-164
CP000951_1808(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 581 e-164
CP001108_494(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 578 e-163
CP000480_5976(CP000480|pid:none) Mycobacterium smegmatis str. MC... 577 e-163
CP000360_3516(CP000360|pid:none) Acidobacteria bacterium Ellin34... 577 e-163
CP000117_1204(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 577 e-163
AM420293_331(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 577 e-163
FN318860_1(FN318860|pid:none) Schistosoma japonicum isolate Anhu... 577 e-163
AM420293_4642(AM420293|pid:none) Saccharopolyspora erythraea NRR... 577 e-163
AM420293_2320(AM420293|pid:none) Saccharopolyspora erythraea NRR... 576 e-162
CP001358_1726(CP001358|pid:none) Desulfovibrio desulfuricans sub... 576 e-162
FN314427_1(FN314427|pid:none) Schistosoma japonicum isolate Anhu... 575 e-162
CP000607_1408(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 575 e-162
(Q3SLF4) RecName: Full=Acetyl-coenzyme A synthetase; EC... 575 e-162
CP000435_1519(CP000435|pid:none) Synechococcus sp. CC9311, compl... 574 e-162
CP000492_529(CP000492|pid:none) Chlorobium phaeobacteroides DSM ... 574 e-162
AM167904_1144(AM167904|pid:none) Bordetella avium 197N complete ... 574 e-162
(P59872) RecName: Full=Acetyl-coenzyme A synthetase; EC... 572 e-161
CP001230_825(CP001230|pid:none) Persephonella marina EX-H1, comp... 571 e-161
AE006470_1630(AE006470|pid:none) Chlorobium tepidum TLS, complet... 569 e-160
AK125058_1(AK125058|pid:none) Homo sapiens cDNA FLJ43068 fis, cl... 569 e-160
AK296306_1(AK296306|pid:none) Homo sapiens cDNA FLJ58578 complet... 569 e-160
CP001287_3371(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 567 e-160
FN357665_1(FN357665|pid:none) Schistosoma mansoni genome sequenc... 566 e-159
AP009552_5922(AP009552|pid:none) Microcystis aeruginosa NIES-843... 566 e-159
CP001101_523(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 565 e-159
BX640418_101(BX640418|pid:none) Bordetella pertussis strain Toha... 565 e-159
CP000860_1505(CP000860|pid:none) Candidatus Desulforudis audaxvi... 564 e-159
AM481065_1(AM481065|pid:none) Vitis vinifera contig VV78X110080.... 561 e-158
CP001503_2401(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 560 e-158
T19768(T19768) hypothetical protein C36A4.9 - Caenorhabditis ele... 559 e-157
Z66495_13(Z66495|pid:none) Caenorhabditis elegans Cosmid C36A4, ... 559 e-157
CP001110_604(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 558 e-157
AM711867_938(AM711867|pid:none) Clavibacter michiganensis subsp.... 556 e-156
S52154(S52154) acetyl-CoA synthetase - fruit fly (Drosophila mel... 556 e-156
CP000384_4791(CP000384|pid:none) Mycobacterium sp. MCS, complete... 556 e-156
CP000481_1980(CP000481|pid:none) Acidothermus cellulolyticus 11B... 556 e-156
CP000555_1385(CP000555|pid:none) Methylibium petroleiphilum PM1,... 556 e-156
CP001636_65(CP001636|pid:none) Variovorax paradoxus S110 chromos... 555 e-156
AP009493_3326(AP009493|pid:none) Streptomyces griseus subsp. gri... 555 e-156
CP000269_882(CP000269|pid:none) Janthinobacterium sp. Marseille,... 555 e-156
CP000580_5147(CP000580|pid:none) Mycobacterium sp. JLS, complete... 555 e-156
(A4G3L8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 555 e-156
CP000359_1745(CP000359|pid:none) Deinococcus geothermalis DSM 11... 554 e-156
CP000958_2196(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 553 e-155
CR555306_97(CR555306|pid:none) Azoarcus sp. EbN1 complete genome. 553 e-155
CU695239_343(CU695239|pid:none) Ralstonia solanacearum strain Mo... 551 e-155
(B3R1X2) RecName: Full=Acetyl-coenzyme A synthetase; EC... 551 e-155
(P31638) RecName: Full=Acetyl-coenzyme A synthetase; EC... 551 e-155
CP000511_5344(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 551 e-155
AM746676_7941(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 551 e-155
AM747720_2280(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 551 e-155
(B2JD61) RecName: Full=Acetyl-coenzyme A synthetase; EC... 551 e-155
CP000379_252(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 551 e-155
CP000440_2222(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 550 e-155
CP001229_1498(CP001229|pid:none) Sulfurihydrogenibium azorense A... 550 e-155
(Q9X928) RecName: Full=Acetyl-coenzyme A synthetase; EC... 550 e-155
(Q7M9Y2) RecName: Full=Acetyl-coenzyme A synthetase; EC... 550 e-155
CP001013_3047(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 550 e-155
(Q9RRL7) RecName: Full=Acetyl-coenzyme A synthetase; EC... 550 e-154
AM747721_2380(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 550 e-154
CP000431_4286(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 549 e-154
DQ355203_1(DQ355203|pid:none) Methanothermobacter thermautotroph... 549 e-154
CP000820_1055(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 549 e-154
CP000870_641(CP000870|pid:none) Burkholderia multivorans ATCC 17... 548 e-154
AP009387_188(AP009387|pid:none) Burkholderia multivorans ATCC 17... 548 e-154
(Q2T3N9) RecName: Full=Acetyl-coenzyme A synthetase; EC... 548 e-154
AM260480_820(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 548 e-154
CP000088_2849(CP000088|pid:none) Thermobifida fusca YX, complete... 548 e-154
CP000909_3(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl, ... 548 e-154
CP001628_1731(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 547 e-154
CP001644_1744(CP001644|pid:none) Ralstonia pickettii 12D chromos... 546 e-153
(B2U6V1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 546 e-153
CP000442_582(CP000442|pid:none) Burkholderia ambifaria AMMD chro... 546 e-153
CP000270_1328(CP000270|pid:none) Burkholderia xenovorans LB400 c... 545 e-153
CP000454_1750(CP000454|pid:none) Arthrobacter sp. FB24, complete... 545 e-153
CP001337_3672(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 544 e-153
CP000505_884(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 543 e-153
AJ965256_942(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 543 e-152
CP000688_1007(CP000688|pid:none) Dehalococcoides sp. BAV1, compl... 542 e-152
AE016958_407(AE016958|pid:none) Mycobacterium avium subsp. parat... 542 e-152
(Q46Z41) RecName: Full=Acetyl-coenzyme A synthetase; EC... 541 e-152
AP009179_1150(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 541 e-152
CP000769_3425(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 541 e-152
CP000509_340(CP000509|pid:none) Nocardioides sp. JS614, complete... 540 e-151
CP000434_190(CP000434|pid:none) Rhodococcus jostii RHA1 plasmid ... 540 e-151
(B5Z6E9) RecName: Full=Acetyl-coenzyme A synthetase; EC... 539 e-151
CT573213_5743(CT573213|pid:none) Frankia alni str. ACN14A chromo... 539 e-151
CP001359_3512(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 539 e-151
CP001131_3449(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 538 e-151
CP000251_3385(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 538 e-151
(B6JKX8) RecName: Full=Acetyl-coenzyme A synthetase; EC... 538 e-151
CP000025_1657(CP000025|pid:none) Campylobacter jejuni RM1221, co... 538 e-151
CP001618_607(CP001618|pid:none) Beutenbergia cavernae DSM 12333,... 537 e-151
(Q1CUA3) RecName: Full=Acetyl-coenzyme A synthetase; EC... 536 e-150
CP000750_3459(CP000750|pid:none) Kineococcus radiotolerans SRS30... 536 e-150
CP000750_413(CP000750|pid:none) Kineococcus radiotolerans SRS302... 535 e-150
CP000854_5090(CP000854|pid:none) Mycobacterium marinum M, comple... 533 e-150
CP000884_2738(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 533 e-150
(P59871) RecName: Full=Acetyl-coenzyme A synthetase; EC... 533 e-149
CP000529_2852(CP000529|pid:none) Polaromonas naphthalenivorans C... 533 e-149
CP001230_588(CP001230|pid:none) Persephonella marina EX-H1, comp... 531 e-149
CP000768_1557(CP000768|pid:none) Campylobacter jejuni subsp. doy... 531 e-149
(O69635) RecName: Full=Acetyl-coenzyme A synthetase; EC... 531 e-149
CP000474_3216(CP000474|pid:none) Arthrobacter aurescens TC1, com... 530 e-148
CU458896_421(CU458896|pid:none) Mycobacterium abscessus chromoso... 530 e-148
CP000512_1471(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 530 e-148
DQ274062_1(DQ274062|pid:none) Methanothermobacter thermautotroph... 529 e-148
AK127566_1(AK127566|pid:none) Homo sapiens cDNA FLJ45659 fis, cl... 529 e-148
CP000686_1946(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 528 e-148
CP000477_1173(CP000477|pid:none) Methanosaeta thermophila PT, co... 526 e-147
CP000745_1141(CP000745|pid:none) Methanococcus maripaludis C7, c... 525 e-147
CP001053_1569(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 525 e-147
AP006618_1802(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 525 e-147
BX950229_148(BX950229|pid:none) Methanococcus maripaludis strain... 525 e-147
CP000609_1507(CP000609|pid:none) Methanococcus maripaludis C5, c... 524 e-147
CP000867_793(CP000867|pid:none) Methanococcus maripaludis C6, co... 524 e-147
CP000254_341(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 524 e-147
AP006618_358(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 523 e-147
CP001636_910(CP001636|pid:none) Variovorax paradoxus S110 chromo... 523 e-146
CP000804_3828(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 523 e-146
BT001456_1(BT001456|pid:none) Drosophila melanogaster GM15363 fu... 523 e-146
CP000539_1046(CP000539|pid:none) Acidovorax sp. JS42, complete g... 521 e-146
AM180088_557(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 518 e-145
CP000477_1172(CP000477|pid:none) Methanosaeta thermophila PT, co... 515 e-144
CP000542_3155(CP000542|pid:none) Verminephrobacter eiseniae EF01... 511 e-143
AF290478_1(AF290478|pid:none) Bradyrhizobium japonicum acetyl-Co... 510 e-143
CP000300_1038(CP000300|pid:none) Methanococcoides burtonii DSM 6... 508 e-142
CP000780_909(CP000780|pid:none) Candidatus Methanoregula boonei ... 506 e-141
CP000477_1174(CP000477|pid:none) Methanosaeta thermophila PT, co... 505 e-141
AY596297_2844(AY596297|pid:none) Haloarcula marismortui ATCC 430... 503 e-140
CP001398_231(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 503 e-140
CP000254_546(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 499 e-139
CP000254_1663(CP000254|pid:none) Methanospirillum hungatei JF-1,... 496 e-138
CP001338_468(CP001338|pid:none) Candidatus Methanosphaerula palu... 491 e-137
(P27095) RecName: Full=Acetyl-coenzyme A synthetase; EC... 483 e-134
AK022608_1(AK022608|pid:none) Homo sapiens cDNA FLJ12546 fis, cl... 483 e-134
(A4WJG1) RecName: Full=Acetyl-coenzyme A synthetase; EC... 482 e-134
CP001401_2341(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 478 e-133
CP001014_1802(CP001014|pid:none) Thermoproteus neutrophilus V24S... 478 e-133
AE006641_2621(AE006641|pid:none) Sulfolobus solfataricus P2, com... 476 e-132
BC075933_1(BC075933|pid:none) Danio rerio acyl-CoA synthetase sh... 475 e-132
BA000023_796(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 475 e-132
CP001197_2759(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 475 e-132
AE000666_214(AE000666|pid:none) Methanothermobacter thermautotro... 475 e-132
CP001403_2532(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 475 e-132
CP001404_289(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 474 e-132
CP000682_1334(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 474 e-132
AK098026_1(AK098026|pid:none) Homo sapiens cDNA FLJ40707 fis, cl... 471 e-131
CP001649_91(CP001649|pid:none) Desulfovibrio salexigens DSM 2638... 470 e-130
BA000023_2177(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 469 e-130
CP000454_531(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 466 e-129
BC114612_1(BC114612|pid:none) Homo sapiens acyl-CoA synthetase s... 465 e-129
CP000112_2817(CP000112|pid:none) Desulfovibrio desulfuricans G20... 464 e-129
AL590445_31(AL590445|pid:none) chromosome V of strain GB-M1 of E... 462 e-128
CP000769_1750(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 461 e-128
CP000477_1385(CP000477|pid:none) Methanosaeta thermophila PT, co... 459 e-127
CP000251_2039(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 455 e-126
AM910993_215(AM910993|pid:none) Plasmodium knowlesi strain H chr... 455 e-126
AL844505_273(AL844505|pid:none) Plasmodium falciparum 3D7 chromo... 455 e-126
AP006840_2321(AP006840|pid:none) Symbiobacterium thermophilum IA... 452 e-125
AE000782_359(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 452 e-125
BC030930_1(BC030930|pid:none) Mus musculus acyl-CoA synthetase s... 451 e-125
CP001100_2136(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 451 e-125
CP001628_227(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 449 e-124
AY596297_2846(AY596297|pid:none) Haloarcula marismortui ATCC 430... 449 e-124
CP001087_2837(CP001087|pid:none) Desulfobacterium autotrophicum ... 448 e-124
BC129436_1(BC129436|pid:none) Danio rerio cDNA clone IMAGE:79183... 446 e-123
CP000159_1645(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 444 e-123
AB2338(AB2338) acetyl-coenzyme A synthetase [imported] - Nostoc ... 444 e-123
AP010904_666(AP010904|pid:none) Desulfovibrio magneticus RS-1 DN... 433 e-119
CP001337_3673(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 432 e-119
AK092295_1(AK092295|pid:none) Homo sapiens cDNA FLJ34976 fis, cl... 431 e-119
CP000386_1690(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 431 e-119
CP001365_1290(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 431 e-119
AE006641_2951(AE006641|pid:none) Sulfolobus solfataricus P2, com... 431 e-119
CP001402_2128(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 428 e-118
CP001400_2004(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 427 e-117
BA000023_854(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 426 e-117
FJ445416_1(FJ445416|pid:none) Sulfolobus tokodaii strain DSMZ 16... 426 e-117
CP000655_1554(CP000655|pid:none) Polynucleobacter necessarius su... 426 e-117
CP000682_1436(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 423 e-116
CP000481_1064(CP000481|pid:none) Acidothermus cellulolyticus 11B... 422 e-116
AM260479_1596(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 419 e-115
AE000657_1449(AE000657|pid:none) Aquifex aeolicus VF5, complete ... 417 e-115
AE017221_882(AE017221|pid:none) Thermus thermophilus HB27, compl... 414 e-114
CP000316_3301(CP000316|pid:none) Polaromonas sp. JS666, complete... 411 e-113
CP001111_792(CP001111|pid:none) Stenotrophomonas maltophilia R55... 410 e-113
CP001635_2142(CP001635|pid:none) Variovorax paradoxus S110 chrom... 404 e-111
AM902716_1787(AM902716|pid:none) Bordetella petrii strain DSM 12... 403 e-110
CP000316_2582(CP000316|pid:none) Polaromonas sp. JS666, complete... 403 e-110
CP000077_1101(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 402 e-110
CP000359_1736(CP000359|pid:none) Deinococcus geothermalis DSM 11... 402 e-110
CP000655_1014(CP000655|pid:none) Polynucleobacter necessarius su... 402 e-110
CP000561_152(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 401 e-110
CP001013_2680(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 399 e-109
CP000386_1668(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 399 e-109
CP000660_1331(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 397 e-109
CP000539_1936(CP000539|pid:none) Acidovorax sp. JS42, complete g... 397 e-109
CP000471_380(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 397 e-109
AL445065_116(AL445065|pid:none) Thermoplasma acidophilum complet... 397 e-108
CP000712_2853(CP000712|pid:none) Pseudomonas putida F1, complete... 396 e-108
CP000267_2278(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 395 e-108
CP000555_2506(CP000555|pid:none) Methylibium petroleiphilum PM1,... 395 e-108
CP001114_2545(CP001114|pid:none) Deinococcus deserti VCD115, com... 395 e-108
BA000011_1289(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 395 e-108
CP000529_1787(CP000529|pid:none) Polaromonas naphthalenivorans C... 394 e-108
CP000352_2196(CP000352|pid:none) Ralstonia metallidurans CH34, c... 393 e-107
CP000555_395(CP000555|pid:none) Methylibium petroleiphilum PM1, ... 393 e-107
CP001068_2004(CP001068|pid:none) Ralstonia pickettii 12J chromos... 392 e-107
Y07914_1(Y07914|pid:none) Lysobacter sp. ATCC 53042 acsL gene fo... 392 e-107
CP000949_1789(CP000949|pid:none) Pseudomonas putida W619, comple... 390 e-106
FM211044_38(FM211044|pid:none) Photorhabdus asymbiotica subsp. a... 390 e-106
CP000926_1938(CP000926|pid:none) Pseudomonas putida GB-1, comple... 390 e-106
CP001101_1121(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 390 e-106
CP001097_843(CP001097|pid:none) Chlorobium limicola DSM 245, com... 389 e-106
CU207211_3102(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 388 e-106
AL646052_1519(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 388 e-106
CP000544_12(CP000544|pid:none) Halorhodospira halophila SL1, com... 387 e-106
AP006618_672(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 387 e-106
CP000270_3076(CP000270|pid:none) Burkholderia xenovorans LB400 c... 387 e-105
CU459003_1967(CU459003|pid:none) Magnetospirillum gryphiswaldens... 386 e-105
CP000090_2167(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 386 e-105
CP001052_2736(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 386 e-105
CP000082_899(CP000082|pid:none) Psychrobacter arcticus 273-4, co... 384 e-105
CP000243_357(CP000243|pid:none) Escherichia coli UTI89, complete... 384 e-104
CU928162_353(CU928162|pid:none) Escherichia coli ED1a chromosome... 384 e-104
CP000247_403(CP000247|pid:none) Escherichia coli 536, complete g... 384 e-104
CP000453_1386(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 382 e-104
CU651637_317(CU651637|pid:none) Escherichia coli LF82 chromosome... 382 e-104
CU914168_1091(CU914168|pid:none) Ralstonia solanacearum strain I... 382 e-104
FM954972_1252(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 382 e-104
CP001099_818(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 381 e-104
AE014075_433(AE014075|pid:none) Escherichia coli CFT073, complet... 381 e-104
CU695239_391(CU695239|pid:none) Ralstonia solanacearum strain Mo... 380 e-103
CP001110_1087(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 379 e-103
FM180568_294(FM180568|pid:none) Escherichia coli 0127:H6 E2348/6... 379 e-103
CP000891_2955(CP000891|pid:none) Shewanella baltica OS195, compl... 379 e-103
>(Q54Z60) RecName: Full=Acetyl-coenzyme A synthetase;
EC=6.2.1.1; AltName: Full=Acetate--CoA ligase; AltName:
Full=Acyl-activating enzyme;
Length = 674
Score = 1355 bits (3506), Expect = 0.0
Identities = 657/659 (99%), Positives = 657/659 (99%)
Frame = +1
Query: 421 LLYPPPSFSTKCHISSVEQYNEMYKESIESPNQFWDKKAKEFLTWFSDYTTVQHGSFEKG 600
LLYPPPSFSTKCHISSVEQYNEMYKESIESPNQFWDKKAKEFLTWFSDYTTVQHGSFEKG
Sbjct: 16 LLYPPPSFSTKCHISSVEQYNEMYKESIESPNQFWDKKAKEFLTWFSDYTTVQHGSFEKG 75
Query: 601 DISWFLNGKINVSYNCIDRHLKENADKVAILFEGDEETMVKKVTYREMFEEVCRLSNLLI 780
DISWFLNGKINVSYNCIDRHLKENADKVAILFEGDEETMVKKVTYREMFEEVCRLSNLLI
Sbjct: 76 DISWFLNGKINVSYNCIDRHLKENADKVAILFEGDEETMVKKVTYREMFEEVCRLSNLLI 135
Query: 781 SLGVGKGDTVAIYLPNTPTAIYSMLACARIGAIHSVIFAGFGYESIVSRVHDAKCRVIIT 960
SLGVGKGDTVAIYLPNTPTAIYSMLACARIGAIHSVIFAGFGYESIVSRVHDAKCRVIIT
Sbjct: 136 SLGVGKGDTVAIYLPNTPTAIYSMLACARIGAIHSVIFAGFGYESIVSRVHDAKCRVIIT 195
Query: 961 ADEGLRGGRYIPLKEKIDQVVQHCKLVQHVLVFKNTGRPTITFNPSIDIWADEAMLDHRP 1140
ADEGLRGGRYIPLKEKIDQVVQHCKLVQHVLVFKNTGRPTITFNPSIDIWADEAMLDHRP
Sbjct: 196 ADEGLRGGRYIPLKEKIDQVVQHCKLVQHVLVFKNTGRPTITFNPSIDIWADEAMLDHRP 255
Query: 1141 YCPPVWLDSEDPLFILYTSGSTGTPKGLVHTQAGYLLYAAMTHRYVFDYHDSDVYACMAD 1320
YCPPVWLDSEDPLFILYTSGSTGTPKGLVHTQAGYLLYAAMTHRYVFDYHDSDVYACMAD
Sbjct: 256 YCPPVWLDSEDPLFILYTSGSTGTPKGLVHTQAGYLLYAAMTHRYVFDYHDSDVYACMAD 315
Query: 1321 VGWITGHSYIVYGPLANXXTTFIFEGTPLYPTPARYWEMVQRHKITQFYTAPTAIRSLMK 1500
VGWITGHSYIVYGPLAN TTFIFEGTPLYPTPARYWEMVQRHKITQFYTAPTAIRSLMK
Sbjct: 316 VGWITGHSYIVYGPLANGATTFIFEGTPLYPTPARYWEMVQRHKITQFYTAPTAIRSLMK 375
Query: 1501 FPISFTQQSDKSSLRVLGSVGEPINPEAWRWFNTNVGEGRCAIVDTYWQTESGGHLITPL 1680
FPISFTQQSDKSSLRVLGSVGEPINPEAWRWFNTNVGEGRCAIVDTYWQTESGGHLITPL
Sbjct: 376 FPISFTQQSDKSSLRVLGSVGEPINPEAWRWFNTNVGEGRCAIVDTYWQTESGGHLITPL 435
Query: 1681 PGVTSTKPGSATKPFFGIELQVLDSKTGERLYINPDINGCKEISGVLAISKPWPGIARSV 1860
PGVTSTKPGSATKPFFGIELQVLDSKTGERLYINPDINGCKEISGVLAISKPWPGIARSV
Sbjct: 436 PGVTSTKPGSATKPFFGIELQVLDSKTGERLYINPDINGCKEISGVLAISKPWPGIARSV 495
Query: 1861 YRSHGRYLQTYMTQYKGHYFTGDGVKLDSDGYYWIEGRVDDVINVSGHRLGTAELESALV 2040
YRSHGRYLQTYMTQYKGHYFTGDGVKLDSDGYYWIEGRVDDVINVSGHRLGTAELESALV
Sbjct: 496 YRSHGRYLQTYMTQYKGHYFTGDGVKLDSDGYYWIEGRVDDVINVSGHRLGTAELESALV 555
Query: 2041 GCSICAEAAVVGYPHDIKGQGILAFCTLKEGYQEDESNVIMMLKKEVRNVIGPFATPDVI 2220
GCSICAEAAVVGYPHDIKGQGILAFCTLKEGYQEDESNVIMMLKKEVRNVIGPFATPDVI
Sbjct: 556 GCSICAEAAVVGYPHDIKGQGILAFCTLKEGYQEDESNVIMMLKKEVRNVIGPFATPDVI 615
Query: 2221 VITPSLPKTRSGKIMRRILRKIGCHESSAEQLGDISTLAEPEVVKLLIEKVSKVIPKTH 2397
VITPSLPKTRSGKIMRRILRKIGCHESSAEQLGDISTLAEPEVVKLLIEKVSKVIPKTH
Sbjct: 616 VITPSLPKTRSGKIMRRILRKIGCHESSAEQLGDISTLAEPEVVKLLIEKVSKVIPKTH 674
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 3,859,688,609
Number of extensions: 81550457
Number of successful extensions: 249359
Number of sequences better than 10.0: 6393
Number of HSP's gapped: 237447
Number of HSP's successfully gapped: 9986
Length of query: 813
Length of database: 1,061,185,681
Length adjustment: 137
Effective length of query: 676
Effective length of database: 613,408,305
Effective search space: 414664014180
Effective search space used: 414664014180
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
6 |
| VF (FL, S) |
1 |
| AH (FL, L) |
2 |
| AF (FL, S) |
3 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
3 |
| SH (FL, L) |
0 |
| SF (FL, S) |
4 |
| CH (FL, L) |
6 |
| CF (FL, S) |
4 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |