NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U16491-1
Contig ID Contig-U16491-1
Contig update 2004. 6.11
Contig sequence 
>Contig-U16491-1 (Contig-U16491-1Q) /CSM_Contig/Contig-U16491-1Q.Seq.d
CGCGTCCGGTTGCCCTCCACACAAAATAAAATTTTTTACTCTCACTCGGC
CTTTTCAAACTTACGTTAATCAAATATGGCAGATAAAAAAAAGAAGGGAT
CCAAAAAAGGTGGTAAAAAAGTCGACCCATTCACCCGTAAGGAATGGTAT
GTTGTAAGAGCACCAACTCAATTCTTCAAATCACCAGCTGATAACAAAGT
CGGTTTCACTCCAGTTAACAGAACCCAAGGTACCAAACTTGCTTCTGATG
GTTTAAAGGGTCGTGTCTACGAAGTTTCACTCGCTGATATGAAAGACGAT
GAATCCCAAGTCTTCAGAAAGATCAAATTAAGAGCTGAAGAAGTTGAAGG
TAGAAACGTTTTAACCAACTTTTACGGTATGGATTTAACCTCAGACAAAC
TCCGTTCATTAATCCACAAATGGTCCACCTTGATCGAATGTTTTGTTGAT
GTTAAGACCACTGATGGTTATTTCCTCCGTGTCTTTGCCATCTGTTTCAC
CAAAAAGGGTGAATCCCAAAAGAAAAAGACCTCATACGCCAAGACCTCCC
GTGTTAAGGCTATCCGTAAGAAGATGGTTGACATTTTAACCGAAACCGTC
TCATCCAACGACCTCAAAACCGTTGTTGACTATTTAATTGGTGTCTCATT
AAACGGTGTTACCACTAACGCCTCTGGTTTTGCCCCAACCCTCGCTGAAA
AAATCAGAATATCAGAATCGAAGGTTCATCAATCTTCCCAATCCACAACG
TCTTCATCAGAAAGGTTAAAGTCCTCAAGACTCCAAAAGTTGATGCTGCT
AAATTATCTGAACTCTATGCTTCATCTGCCACCTCAACCATCGCCCCAAC
TGAAGAAGTAGGTACCGCTGTTGAAAGAACTGAAGAAACCACCACCACCG
CTTAAACAAATAAAAAAAAATAAAATAATTCCTTATTTTTAAAAATATAA
AAAAAAAAAAAAAAAAACAAAAAAAAAAAAAAAAAAAA
Gap no gap
Contig length 988
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 7774476
End point 7775398
Strand (PLUS/MINUS) PLUS
Number of clones 44
Number of EST 43
Link to clone list U16491
List of clone(s) 

est1=VSJ141E,1,910
est2=VSI836E,64,934
est3=FC-AG13E,71,951
est4=VSF675E,71,934
est5=VSF812E,71,867
est6=VSG754F,71,640
est7=VSH214E,71,923
est8=VSD331E,72,937
est9=VSF516E,72,918
est10=VSK462E,72,917
est11=VSH871E,76,917
est12=FC-IC0481E,78,231
est13=SSH744F,78,386
est14=VSJ445E,78,935
est15=FC-AK15E,86,976
est16=VHH888Z,109,900
est17=SSE533E,161,938
est18=FC-BS17Z,216,957
est19=VSA592Z,230,936
est20=FC-IC0794E,232,864
est21=FC-BP05Z,246,960
est22=FC-BL12Z,259,957
est23=FC-BQ08Z,259,960
est24=FC-BO06Z,276,974
est25=FC-BO17Z,276,974
est26=VSF854E,284,934
est27=FC-AX19Z,295,954
est28=FC-BA16Z,304,951
est29=FC-BP23Z,314,966
est30=VSC455Z,320,940
est31=FC-AZ09Z,322,951
est32=VSC789Z,322,947
est33=FC-AF09Z,332,982
est34=VSB383Z,362,940
est35=FC-AQ15Z,364,951
est36=SLG119E,396,939
est37=FC-AS08Z,399,986
est38=FC-AX13Z,407,976
est39=SLB607E,444,941
est40=SLB619Z,514,941
est41=VSH364F,770,950
est42=VSH364Z,770,937
est43=FC-BG01Z,811,988
Translated Amino Acid sequence 
rvrlpstqnkifyshsafsnlr*SNMADKKKKGSKKGGKKVDPFTRKEWYVVRAPTQFFK
SPADNKVGFTPVNRTQGTKLASDGLKGRVYEVSLADMKDDESQVFRKIKLRAEEVEGRNV
LTNFYGMDLTSDKLRSLIHKWSTLIECFVDVKTTDGYFLRVFAICFTKKGESQKKKTSYA
KTSRVKAIRKKMVDILTETVSSNDLKTVVDYLIGVSLNGVTTNASGFAPTLAEKIRISES
KVHQSSQSTTSSSERLKSSRLQKLMLLNYLNSMLHLPPQPSPQLKK*vpllkelkkpppp
lkqikknkiipyf*kykkkkkktkkkkkk
Translated Amino Acid sequence (All Frames) 
Frame A:
rvrlpstqnkifyshsafsnlr*SNMADKKKKGSKKGGKKVDPFTRKEWYVVRAPTQFFK
SPADNKVGFTPVNRTQGTKLASDGLKGRVYEVSLADMKDDESQVFRKIKLRAEEVEGRNV
LTNFYGMDLTSDKLRSLIHKWSTLIECFVDVKTTDGYFLRVFAICFTKKGESQKKKTSYA
KTSRVKAIRKKMVDILTETVSSNDLKTVVDYLIGVSLNGVTTNASGFAPTLAEKIRISES
KVHQSSQSTTSSSERLKSSRLQKLMLLNYLNSMLHLPPQPSPQLKK*vpllkelkkpppp
lkqikknkiipyf*kykkkkkktkkkkkk


Frame B:
asgcpphkikfftltrpfqtyvnqiwqikkrrdpkkvvkksthspvrngml*ehqlnssn
hqlitksvslqltepkvpnlllmv*rvvstkfhsli*ktmnpkssersn*elkklkvetf
*ptftvwi*pqtnsvh*stngpp*snvllmlrplmvissvslpsvspkrvnpkrkrphtp
rppvlrlsvrrwltf*pkpshpttskpllti*lvsh*tvlpltplvlpqpslkkseyqnr
rfinlpnpqrlhqkg*spqdsks*cc*ii*tlcfichlnhrpn*rsryrc*kn*rnhhhr
lnk*kkik*flifknikkkkkkqkkkkkk


Frame C:
rpvalhtk*nfllslglfkltlikygr*kkegiqkrw*ksrpihp*gmvcckstnsilqi
ts**qsrfhss*qnpryqtcf*wfkgsclrsftr*yerr*ipslqkdqiks*rs*r*krf
nqllrygfnlrqtpfinpqmvhldrmfc*c*dh*wlfppclchlfhqkg*ipkekdlirq
dlpc*gyp*edg*hfnrnrliqrpqnrc*lfnwclikrcyh*rlwfcpnpr*knqnirie
gssifpihnvfirkvkvlktpkvdaaklselyassatstiapteevgtaverteetttta
*tnkkk*nnslflki*kkkkknkkkkkk
own update 2004. 6.23
Homology vs CSM-cDNA 
Query= Contig-U16491-1 (Contig-U16491-1Q)
/CSM_Contig/Contig-U16491-1Q.Seq.d
         (988 letters)

Database: CSM
           8402 sequences; 8,075,542 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U16491-1 (Contig-U16491-1Q) /CSM_Contig/Conti...  1741  0.0
Contig-U15696-1 (Contig-U15696-1Q) /CSM_Contig/Conti...    38  0.025
Contig-U14022-1 (Contig-U14022-1Q) /CSM_Contig/Conti...    38  0.025
Contig-U04285-1 (Contig-U04285-1Q) /CSM_Contig/Conti...    34  0.39
Contig-U16487-1 (Contig-U16487-1Q) /CSM_Contig/Conti...    32  1.6
Contig-U16409-1 (Contig-U16409-1Q) /CSM_Contig/Conti...    32  1.6
Contig-U15450-1 (Contig-U15450-1Q) /CSM_Contig/Conti...    32  1.6
Contig-U15434-1 (Contig-U15434-1Q) /CSM_Contig/Conti...    32  1.6
Contig-U13748-1 (Contig-U13748-1Q) /CSM_Contig/Conti...    32  1.6

>Contig-U16491-1 (Contig-U16491-1Q) /CSM_Contig/Contig-U16491-1Q.Seq.d
          Length = 988

 Score = 1741 bits (878), Expect = 0.0
 Identities = 894/902 (99%)
 Strand = Plus / Plus

                                                                       
Query: 1   cgcgtccggttgccctccacacaaaataaaattttttactctcactcggccttttcaaac 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   cgcgtccggttgccctccacacaaaataaaattttttactctcactcggccttttcaaac 60

                                                                       
Query: 61  ttacgttaatcaaatatggcagatnnnnnnnngaagggatccaaaaaaggtggtaaaaaa 120
           ||||||||||||||||||||||||        ||||||||||||||||||||||||||||
Sbjct: 61  ttacgttaatcaaatatggcagataaaaaaaagaagggatccaaaaaaggtggtaaaaaa 120

                                                                       
Query: 121 gtcgacccattcacccgtaaggaatggtatgttgtaagagcaccaactcaattcttcaaa 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gtcgacccattcacccgtaaggaatggtatgttgtaagagcaccaactcaattcttcaaa 180

                                                                       
Query: 181 tcaccagctgataacaaagtcggtttcactccagttaacagaacccaaggtaccaaactt 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tcaccagctgataacaaagtcggtttcactccagttaacagaacccaaggtaccaaactt 240

                                                                       
Query: 241 gcttctgatggtttaaagggtcgtgtctacgaagtttcactcgctgatatgaaagacgat 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gcttctgatggtttaaagggtcgtgtctacgaagtttcactcgctgatatgaaagacgat 300

                                                                       
Query: 301 gaatcccaagtcttcagaaagatcaaattaagagctgaagaagttgaaggtagaaacgtt 360
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gaatcccaagtcttcagaaagatcaaattaagagctgaagaagttgaaggtagaaacgtt 360

                                                                       
Query: 361 ttaaccaacttttacggtatggatttaacctcagacaaactccgttcattaatccacaaa 420
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 ttaaccaacttttacggtatggatttaacctcagacaaactccgttcattaatccacaaa 420

                                                                       
Query: 421 tggtccaccttgatcgaatgttttgttgatgttaagaccactgatggttatttcctccgt 480
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 tggtccaccttgatcgaatgttttgttgatgttaagaccactgatggttatttcctccgt 480

                                                                       
Query: 481 gtctttgccatctgtttcaccaaaaagggtgaatcccaaaagaaaaagacctcatacgcc 540
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 gtctttgccatctgtttcaccaaaaagggtgaatcccaaaagaaaaagacctcatacgcc 540

                                                                       
Query: 541 aagacctcccgtgttaaggctatccgtaagaagatggttgacattttaaccgaaaccgtc 600
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 aagacctcccgtgttaaggctatccgtaagaagatggttgacattttaaccgaaaccgtc 600

                                                                       
Query: 601 tcatccaacgacctcaaaaccgttgttgactatttaattggtgtctcattaaacggtgtt 660
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 tcatccaacgacctcaaaaccgttgttgactatttaattggtgtctcattaaacggtgtt 660

                                                                       
Query: 661 accactaacgcctctggttttgccccaaccctcgctgaaaaaatcagaatatcagaatcg 720
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 accactaacgcctctggttttgccccaaccctcgctgaaaaaatcagaatatcagaatcg 720

                                                                       
Query: 721 aaggttcatcaatcttcccaatccacaacgtcttcatcagaaaggttaaagtcctcaaga 780
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 aaggttcatcaatcttcccaatccacaacgtcttcatcagaaaggttaaagtcctcaaga 780

                                                                       
Query: 781 ctccaaaagttgatgctgctaaattatctgaactctatgcttcatctgccacctcaacca 840
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 781 ctccaaaagttgatgctgctaaattatctgaactctatgcttcatctgccacctcaacca 840

                                                                       
Query: 841 tcgccccaactgaagaagtaggtaccgctgttgaaagaactgaagaaaccaccaccaccg 900
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 841 tcgccccaactgaagaagtaggtaccgctgttgaaagaactgaagaaaccaccaccaccg 900

             
Query: 901 ct 902
           ||
Sbjct: 901 ct 902


>Contig-U15696-1 (Contig-U15696-1Q) /CSM_Contig/Contig-U15696-1Q.Seq.d
          Length = 2936

 Score = 38.2 bits (19), Expect = 0.025
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                               
Query: 103  aaaaaaggtggtaaaaaag 121
            |||||||||||||||||||
Sbjct: 1320 aaaaaaggtggtaaaaaag 1338


 Score = 32.2 bits (16), Expect = 1.6
 Identities = 16/16 (100%)
 Strand = Plus / Plus

                            
Query: 106  aaaggtggtaaaaaag 121
            ||||||||||||||||
Sbjct: 2830 aaaggtggtaaaaaag 2845


 Score = 32.2 bits (16), Expect = 1.6
 Identities = 16/16 (100%)
 Strand = Plus / Plus

                           
Query: 106 aaaggtggtaaaaaag 121
           ||||||||||||||||
Sbjct: 933 aaaggtggtaaaaaag 948


 Score = 30.2 bits (15), Expect = 6.1
 Identities = 15/15 (100%)
 Strand = Plus / Plus

                          
Query: 103 aaaaaaggtggtaaa 117
           |||||||||||||||
Sbjct: 462 aaaaaaggtggtaaa 476


 Score = 30.2 bits (15), Expect = 6.1
 Identities = 15/15 (100%)
 Strand = Plus / Plus

                          
Query: 103 aaaaaaggtggtaaa 117
           |||||||||||||||
Sbjct: 837 aaaaaaggtggtaaa 851


>Contig-U14022-1 (Contig-U14022-1Q) /CSM_Contig/Contig-U14022-1Q.Seq.d
          Length = 991

 Score = 38.2 bits (19), Expect = 0.025
 Identities = 19/19 (100%)
 Strand = Plus / Minus

                              
Query: 869 tgttgaaagaactgaagaa 887
           |||||||||||||||||||
Sbjct: 603 tgttgaaagaactgaagaa 585


  Database: CSM
    Posted date:  Jun 21, 2004  1:35 PM
  Number of letters in database: 8,075,542
  Number of sequences in database:  8402
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 11,200
Number of Sequences: 8402
Number of extensions: 11200
Number of successful extensions: 991
Number of sequences better than 10.0: 97
length of query: 988
length of database: 8,075,542
effective HSP length: 16
effective length of query: 972
effective length of database: 7,941,110
effective search space: 7718758920
effective search space used: 7718758920
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 4. 9
Homology vs DNA 
Query= Contig-U16491-1 (Contig-U16491-1Q) /CSM_Contig/Contig-U16491-1Q.Seq.d
         (988 letters)

Database: ddbj_A
           102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU284312) Dictyostelium discoideum gamete cDNA clone:FC-AK1...  1168   0.0    2
(C23652) Dictyostelium discoideum gamete cDNA, clone FC-AG13.    1168   0.0    3
(BJ441524) Dictyostelium discoideum cDNA clone:ddv46p22, 3' ...  1160   0.0    4
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173...  1152   0.0    2
(AU284996) Dictyostelium discoideum gamete cDNA clone:FC-BS1...   981   0.0    2
(AU263855) Dictyostelium discoideum vegetative cDNA clone:VS...   952   0.0    3
(AU271832) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   950   0.0    2
(AU271831) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   950   0.0    2
(AU261590) Dictyostelium discoideum vegetative cDNA clone:VS...   946   0.0    2
(AU268101) Dictyostelium discoideum vegetative cDNA clone:VS...   910   0.0    4
(AU284802) Dictyostelium discoideum gamete cDNA clone:FC-BL1...   896   0.0    2
(C92427) Dictyostelium discoideum slug cDNA, clone SSE533.        896   0.0    2
(AU284920) Dictyostelium discoideum gamete cDNA clone:FC-BP2...   890   0.0    3
(AU284889) Dictyostelium discoideum gamete cDNA clone:FC-BO1...   862   0.0    2
(AU284878) Dictyostelium discoideum gamete cDNA clone:FC-BO0...   862   0.0    2
(AU269310) Dictyostelium discoideum vegetative cDNA clone:VS...   841   0.0    3
(AU284467) Dictyostelium discoideum gamete cDNA clone:FC-AX1...   825   0.0    2
(AU265898) Dictyostelium discoideum vegetative cDNA clone:VS...   817   0.0    3
(AU284511) Dictyostelium discoideum gamete cDNA clone:FC-BA1...   809   0.0    2
(AU284930) Dictyostelium discoideum gamete cDNA clone:FC-BQ0...   805   0.0    3
(AU284489) Dictyostelium discoideum gamete cDNA clone:FC-AZ0...   773   0.0    2
(AU284901) Dictyostelium discoideum gamete cDNA clone:FC-BP0...   769   0.0    4
(AU262791) Dictyostelium discoideum vegetative cDNA clone:VS...   759   0.0    2
(C23759) Dictyostelium discoideum gamete cDNA, clone FC-AF09.     753   0.0    2
(AU265603) Dictyostelium discoideum vegetative cDNA clone:VS...   745   0.0    2
(AU262578) Dictyostelium discoideum vegetative cDNA clone:VS...   706   0.0    3
(AU269470) Dictyostelium discoideum vegetative cDNA clone:VS...   936   0.0    2
(AU284381) Dictyostelium discoideum gamete cDNA clone:FC-AQ1...   690   0.0    2
(AU261987) Dictyostelium discoideum vegetative cDNA clone:VS...   688   0.0    2
(AU269930) Dictyostelium discoideum vegetative cDNA clone:VS...   712   0.0    3
(AU269471) Dictyostelium discoideum vegetative cDNA clone:VS...   710   0.0    3
(AU266785) Dictyostelium discoideum vegetative cDNA clone:VS...   991   0.0    3
(AU271240) Dictyostelium discoideum vegetative cDNA clone:VS...   997   0.0    1
(AU265351) Dictyostelium discoideum vegetative cDNA clone:VS...   545   0.0    3
(AU265825) Dictyostelium discoideum vegetative cDNA clone:VS...   987   0.0    2
(AU263854) Dictyostelium discoideum vegetative cDNA clone:VS...   991   0.0    1
(AU269929) Dictyostelium discoideum vegetative cDNA clone:VS...   987   0.0    1
(AU265350) Dictyostelium discoideum vegetative cDNA clone:VS...   987   0.0    1
(AU267082) Dictyostelium discoideum vegetative cDNA clone:VS...   670   0.0    3
(AU039653) Dictyostelium discoideum slug cDNA, clone SLG119.      624   0.0    2
(AU265897) Dictyostelium discoideum vegetative cDNA clone:VS...   848   0.0    2
(AU284464) Dictyostelium discoideum gamete cDNA clone:FC-AX1...   605   0.0    2
(AU284401) Dictyostelium discoideum gamete cDNA clone:FC-AS0...   605   0.0    2
(AU265826) Dictyostelium discoideum vegetative cDNA clone:VS...   656   0.0    3
(AU271241) Dictyostelium discoideum vegetative cDNA clone:VS...   549   0.0    2
(AU060822) Dictyostelium discoideum slug cDNA, clone SLB607.      505   0.0    2
(AU268100) Dictyostelium discoideum vegetative cDNA clone:VS...   797   0.0    1
(AU265602) Dictyostelium discoideum vegetative cDNA clone:VS...   771   0.0    2
(AU269309) Dictyostelium discoideum vegetative cDNA clone:VS...   686   0.0    3
(AU033913) Dictyostelium discoideum slug cDNA, clone SLB607.      396   0.0    2
(AU033923) Dictyostelium discoideum slug cDNA, clone SLB619.      391   0.0    2
(AU267081) Dictyostelium discoideum vegetative cDNA clone:VS...   692   0.0    2
(BJ435549) Dictyostelium discoideum cDNA clone:ddv27a15, 3' ...   626   e-175  1
(AU072445) Dictyostelium discoideum slug cDNA, clone SSE533.      476   e-130  1
(AU073652) Dictyostelium discoideum slug cDNA, clone SSH744.      389   e-103  1
(AU267333) Dictyostelium discoideum vegetative cDNA clone:VS...   254   6e-63  1
(AU267332) Dictyostelium discoideum vegetative cDNA clone:VS...   244   5e-60  1
(AU284645) Dictyostelium discoideum gamete cDNA clone:FC-BG0...   184   4e-42  1
(AU271633) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   101   3e-30  2
(EC761615) PSE00004132 rw_mgpallid Polysphondylium pallidum ...    88   9e-28  4
(EC762277) PSE00007899 rw_mgpallid Polysphondylium pallidum ...   101   2e-26  3
(EC762330) PSE00007917 rw_mgpallid Polysphondylium pallidum ...    88   3e-22  3
(EC761709) PSE00001413 rw_mgpallid Polysphondylium pallidum ...    88   3e-22  3
(EC762187) PSE00006963 rw_mgpallid Polysphondylium pallidum ...    88   3e-22  3
(CO202092) Cs_wimC_05C12_SAC Cs_wim Cupiennius salei cDNA cl...    56   8e-18  4
(CO202056) Cs_wim_04H06_SAC Cs_wim Cupiennius salei cDNA clo...    56   4e-16  3
(DY891794) CeleSEQ8465 Cunninghamella elegans pBluescript (E...    52   5e-15  4
(DY895653) CeleSEQ15532 Cunninghamella elegans pBluescript (...    52   5e-15  4
(DY894121) CeleSEQ13619 Cunninghamella elegans pBluescript (...    52   7e-15  4
(DY884992) CeleSEQ158 Cunninghamella elegans pBluescript (Ec...    52   7e-15  4
(DY885172) CeleSEQ36 Cunninghamella elegans pBluescript (Eco...    52   8e-15  4
(DY885431) CeleSEQ99 Cunninghamella elegans pBluescript (Eco...    52   8e-15  4
(DY891238) CeleSEQ7930 Cunninghamella elegans pBluescript (E...    52   9e-15  4
(DY890450) CeleSEQ9459 Cunninghamella elegans pBluescript (E...    52   9e-15  4
(DY894626) CeleSEQ14241 Cunninghamella elegans pBluescript (...    52   9e-15  4
(DY893624) CeleSEQ13017 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY893821) CeleSEQ13263 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY893790) CeleSEQ13223 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY886946) CeleSEQ2785 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY888543) CeleSEQ5636 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY887628) CeleSEQ4132 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY888185) CeleSEQ3674 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY887189) CeleSEQ3110 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY886907) CeleSEQ2737 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY892486) CeleSEQ10737 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY891327) CeleSEQ8051 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY888701) CeleSEQ5933 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY888022) CeleSEQ4952 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY885894) CeleSEQ989 Cunninghamella elegans pBluescript (Ec...    52   1e-14  4
(DY885441) CeleSEQ687 Cunninghamella elegans pBluescript (Ec...    52   1e-14  4
(DY886858) CeleSEQ2677 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY889554) CeleSEQ11453 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY885547) CeleSEQ831 Cunninghamella elegans pBluescript (Ec...    52   1e-14  4
(DY890936) CeleSEQ7427 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY889598) CeleSEQ11526 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY887494) CeleSEQ3860 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY885883) CeleSEQ975 Cunninghamella elegans pBluescript (Ec...    52   1e-14  4
(DY887054) CeleSEQ2924 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY887818) CeleSEQ4538 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY890579) CeleSEQ9633 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY889401) CeleSEQ10930 Cunninghamella elegans pBluescript (...    52   1e-14  4
(DY887516) CeleSEQ3900 Cunninghamella elegans pBluescript (E...    52   1e-14  4
(DY888738) CeleSEQ6008 Cunninghamella elegans pBluescript (E...    52   2e-14  4
(DY892863) CeleSEQ11885 Cunninghamella elegans pBluescript (...    52   2e-14  4
(DY889820) CeleSEQ6775 Cunninghamella elegans pBluescript (E...    52   2e-14  4
(DY886007) CeleSEQ1479 Cunninghamella elegans pBluescript (E...    52   2e-14  4
(DY893371) CeleSEQ12695 Cunninghamella elegans pBluescript (...    52   2e-14  4
(EC761394) PSE00007248 rw_mgpallid Polysphondylium pallidum ...    60   4e-14  3
(DY895219) CeleSEQ14996 Cunninghamella elegans pBluescript (...    46   1e-12  4
(DY885640) CeleSEQ959 Cunninghamella elegans pBluescript (Ec...    46   3e-12  4
(EU247153) Lycosa singoriensis clone LSsin618 40S ribosomal ...    72   6e-12  2
(DY894546) CeleSEQ14140 Cunninghamella elegans pBluescript (...    52   1e-11  3
(DY894275) CeleSEQ13811 Cunninghamella elegans pBluescript (...    52   1e-11  3
(DY894113) CeleSEQ13608 Cunninghamella elegans pBluescript (...    52   2e-11  3
(DY891296) CeleSEQ8012 Cunninghamella elegans pBluescript (E...    52   2e-11  3
(DY894947) CeleSEQ14641 Cunninghamella elegans pBluescript (...    52   2e-11  3
(DY889142) CeleSEQ6679 Cunninghamella elegans pBluescript (E...    52   2e-11  3
(FE354894) CBIC757.rev CBIC_Daphnia_pulex_Chosen_One_Library...    50   9e-10  3
(FE354895) CBIC757.fwd CBIC_Daphnia_pulex_Chosen_One_Library...    50   9e-10  3
(FE351804) CBIC2897.fwd CBIC_Daphnia_pulex_Chosen_One_Librar...    50   9e-10  3
(EH014233) USDA-FP_186954 Lysiphlebus testaceipes adult whol...    42   4e-09  4
(DY892116) CeleSEQ9031 Cunninghamella elegans pBluescript (E...    52   5e-09  2
(EH017340) USDA-FP_182761 Lysiphlebus testaceipes adult whol...    42   8e-09  4
(EH011045) USDA-FP_184083 Lysiphlebus testaceipes adult whol...    42   9e-09  4
(EW768189) ST020005A20A05 Normalized and subtracted western ...    60   9e-09  2
(EH015902) USDA-FP_188457 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EH016626) USDA-FP_182511 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EH009792) USDA-FP_182955 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EH011021) USDA-FP_184062 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EH016997) USDA-FP_189442 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EH016691) USDA-FP_189167 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EH015706) USDA-FP_188279 Lysiphlebus testaceipes adult whol...    42   1e-08  4
(EW766861) ST050001000C02 Normalized and subtracted western ...    60   1e-08  2
(CS592054) Sequence 774 from Patent WO2007035650.                  60   2e-08  2
(AY961531) Lysiphlebus testaceipes ribosomal protein S3a (Rp...    42   2e-08  4
(FE418451) CBTW3224.rev CBTW_Daphnia_pulex_Chosen_One_Librar...    42   4e-08  4
(GE751712) MUS14-P03.x1d-t SHGC-MUS Mytilus californianus cD...    42   4e-08  4
(GE752029) MUS14-P03.y1d-s SHGC-MUS Mytilus californianus cD...    42   6e-08  4
(CO157387) Ep_TT_04F01_SKPL Eurydice pulchra TT library Eury...    44   5e-07  3
(CO869121) Ep_CT_05G07_SKPL Eurydice pulchra CT library Eury...    44   6e-07  3
(DL264810) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS.       56   8e-07  2
(DJ131259) Method for identification of useful proteins deri...    56   8e-07  2
(EH011296) USDA-FP_184309 Lysiphlebus testaceipes adult whol...    42   2e-06  4
(EE005677) ROE00013406 Rhizopus oryzae Company Rhizopus oryz...    44   5e-06  3
(EE008408) ROE00006012 Rhizopus oryzae Company Rhizopus oryz...    44   7e-06  3
(EH216327) USDA-FP_179143 WHMH (pink hibiscus mealybug) Maco...    46   7e-06  3
(EE010275) ROE00001450 Rhizopus oryzae Company Rhizopus oryz...    44   1e-05  3
(FE418452) CBTW3224.fwd CBTW_Daphnia_pulex_Chosen_One_Librar...    42   1e-05  3
(EE682791) WFes0000839 Daphnia pDNR-LIB Library HCGSest1 Dap...    42   1e-05  3
(FE317994) CANW567.fwd CANW_Daphnia_pulex_Log50_Library_6 Da...    42   1e-05  3
(FE317993) CANW567.rev CANW_Daphnia_pulex_Log50_Library_6 Da...    42   1e-05  3
(AL404835) T3 end of clone XAT0AA002H02 of library XAT0AA fr...    48   2e-05  3
(FE341716) CAOF3167.fwd CAOF_Daphnia_pulex_Log50_Library_12 ...    42   2e-05  3
(FE341715) CAOF3167.rev CAOF_Daphnia_pulex_Log50_Library_12 ...    42   2e-05  3
(FE328655) CANY4332.rev CANY_Daphnia_pulex_Log50_Library_20 ...    42   2e-05  3
(FE387651) CBNT920.rev CBNT_Daphnia_pulex_Chosen_One_Library...    42   2e-05  3
(FE425605) CUCS765.rev CUCS_Daphnia_pulex_Log50_Library_14 D...    42   2e-05  3
(FE425606) CUCS765.fwd CUCS_Daphnia_pulex_Log50_Library_14 D...    42   2e-05  3
(FE423870) CBTX4311.rev CBTX_Daphnia_pulex_Chosen_One_Librar...    42   2e-05  3
(FE391787) CBTO3464.rev CBTO_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE387697) CBNT949.fwd CBNT_Daphnia_pulex_Chosen_One_Library...    42   3e-05  3
(FE384172) CBNT2896.rev CBNT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE300301) CANP1531.rev CANP_Daphnia_pulex_Log50_Library_2 D...    42   3e-05  3
(FE423377) CBTX3997.rev CBTX_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE423468) CBTX4052.rev CBTX_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE400286) CBTS2577.rev CBTS_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE367571) CBNO5042.rev CBNO_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE423378) CBTX3997.fwd CBTX_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE385952) CBNT4209.fwd CBNT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE383880) CBNT2678.rev CBNT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE394250) CBTP1720.rev CBTP_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE305180) CANS1051.fwd CANS_Daphnia_pulex_Log50_Library_3 D...    42   3e-05  3
(FE403849) CBTT2350.fwd CBTT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE400287) CBTS2577.fwd CBTS_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE387652) CBNT920.fwd CBNT_Daphnia_pulex_Chosen_One_Library...    42   3e-05  3
(FE382874) CBNT1956.rev CBNT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(AA533662) nj96e05.s1 NCI_CGAP_Pr11 Homo sapiens cDNA clone ...    48   3e-05  2
(FE394251) CBTP1720.fwd CBTP_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE385951) CBNT4209.rev CBNT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE313637) CANU4523.rev CANU_Daphnia_pulex_Log50_Library_7 D...    42   3e-05  3
(FE403848) CBTT2350.rev CBTT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE309717) CANU2041.fwd CANU_Daphnia_pulex_Log50_Library_7 D...    42   3e-05  3
(FE387696) CBNT949.rev CBNT_Daphnia_pulex_Chosen_One_Library...    42   3e-05  3
(FE313638) CANU4523.fwd CANU_Daphnia_pulex_Log50_Library_7 D...    42   3e-05  3
(FE387147) CBNT524.rev CBNT_Daphnia_pulex_Chosen_One_Library...    42   3e-05  3
(FE305179) CANS1051.rev CANS_Daphnia_pulex_Log50_Library_3 D...    42   3e-05  3
(FE382875) CBNT1956.fwd CBNT_Daphnia_pulex_Chosen_One_Librar...    42   3e-05  3
(FE314961) CANW1257.rev CANW_Daphnia_pulex_Log50_Library_6 D...    38   5e-05  4
(BX355517) human full-length cDNA 5-PRIME end of clone CS0DD...    50   6e-05  2
(FE334824) CAOC3982.fwd CAOC_Daphnia_pulex_Log50_Library_9 D...    42   6e-05  3
(FE334823) CAOC3982.rev CAOC_Daphnia_pulex_Log50_Library_9 D...    42   6e-05  3
(FE314962) CANW1257.fwd CANW_Daphnia_pulex_Log50_Library_6 D...    38   6e-05  4
(FE311237) CANU3041.rev CANU_Daphnia_pulex_Log50_Library_7 D...    38   6e-05  4
(AL397917) T3 end of clone AS0AA005H09 of library AS0AA from...    60   6e-05  2
(FE311238) CANU3041.fwd CANU_Daphnia_pulex_Log50_Library_7 D...    38   7e-05  4
(FE322490) CANX3410.rev CANX_Daphnia_pulex_Log50_Library_8 D...    38   7e-05  4
(FE341076) CAOF2711.rev CAOF_Daphnia_pulex_Log50_Library_12 ...    38   8e-05  4
(FE275019) CANA1138.rev CANA_Daphnia_pulex_Log50_Library_14 ...    38   9e-05  4
(EE683408) WFes0013392 Daphnia pDNR-LIB Library HCGSest1 Dap...    38   9e-05  4
(FE341077) CAOF2711.fwd CAOF_Daphnia_pulex_Log50_Library_12 ...    38   9e-05  4
(EY495368) CBBP2257.rev CBBP Hirudo medicinalis hermaphrodit...    46   9e-05  3
(EY488854) CBBP16686.fwd CBBP Hirudo medicinalis hermaphrodi...    46   9e-05  3
(FE323217) CANX3850.rev CANX_Daphnia_pulex_Log50_Library_8 D...    38   9e-05  4
(EY498505) CBBP4164.rev CBBP Hirudo medicinalis hermaphrodit...    46   9e-05  3
(EY488853) CBBP16686.rev CBBP Hirudo medicinalis hermaphrodi...    46   9e-05  3
(EY480817) CBBP11033.fwd CBBP Hirudo medicinalis hermaphrodi...    46   1e-04  3
(FE328656) CANY4332.fwd CANY_Daphnia_pulex_Log50_Library_20 ...    42   1e-04  3
(CR539958) Pongo abelii mRNA; EST DKFZp459N145_r1 (from clon...    48   1e-04  2
(FE423469) CBTX4052.fwd CBTX_Daphnia_pulex_Chosen_One_Librar...    42   1e-04  3
(FE328520) CANY4239.rev CANY_Daphnia_pulex_Log50_Library_20 ...    42   1e-04  3
(EY498506) CBBP4164.fwd CBBP Hirudo medicinalis hermaphrodit...    46   1e-04  3
(FE283327) CANH1786.rev CANH_Daphnia_pulex_Log50_Library_21 ...    38   1e-04  4
(EY495369) CBBP2257.fwd CBBP Hirudo medicinalis hermaphrodit...    46   1e-04  3
(DN364732) LIB3629-018-Q1-K1-E1 LIB3629 Canis lupus familiar...    48   2e-04  2
(BX428999) human full-length cDNA 3-PRIME end of clone CS0DG...    60   2e-04  1
(EX815746) CBNA469.rev CBNA Phycomyces blakesleeanus NRRL155...    52   2e-04  2
(EX858696) CBNF4624.rev CBNF Phycomyces blakesleeanus NRRL15...    52   2e-04  2
(EX841149) CBNB8811.rev CBNB Phycomyces blakesleeanus NRRL15...    52   2e-04  2
(EX854938) CBNF11078.rev CBNF Phycomyces blakesleeanus NRRL1...    52   2e-04  2
(EX864409) CBNF7488.rev CBNF Phycomyces blakesleeanus NRRL15...    52   2e-04  2
(EX832673) CBNB3579.rev CBNB Phycomyces blakesleeanus NRRL15...    52   2e-04  2
(BX464444) human full-length cDNA 5-PRIME end of clone CS0DA...    48   2e-04  2
(BX446942) human full-length cDNA 5-PRIME end of clone CL0BB...    48   2e-04  2
(CR860858) Pongo abelii mRNA; cDNA DKFZp469E172 (from clone ...    48   2e-04  2
(CD049289) AGENCOURT_13976536 NIH_MGC_172 Homo sapiens cDNA ...    48   2e-04  2
(FE423498) CBTX4071.rev CBTX_Daphnia_pulex_Chosen_One_Librar...    42   2e-04  3
(FE310533) CANU2579.fwd CANU_Daphnia_pulex_Log50_Library_7 D...    38   3e-04  4
(AI076995) BSBmMFSZ10J18SK Brugia malayi microfilaria cDNA (...    42   4e-04  2
(FE039313) JGI_CAON1026.rev CAON Montastraea faveolata 13 da...    50   4e-04  2
(EH218802) USDA-FP_181732 WHMH (pink hibiscus mealybug) Maco...    46   4e-04  2
(AI944370) KJBmL3SZ4F24SK Brugia malayi infective larva cDNA...    42   6e-04  2
(BG395053) 602457514F1 NIH_MGC_16 Homo sapiens cDNA clone IM...    58   7e-04  1
(FK029480) RM_G_02688 hemocytes of freshwater pearl mussel c...    58   7e-04  1
(AV717095) Homo sapiens cDNA clone:DCBAZD05, 5'end, expresse...    48   7e-04  2
(EE002886) ROE00002950 Rhizopus oryzae Company Rhizopus oryz...    42   8e-04  3
(CN810053) Ls_J1_05F11_SAC Lymnaea stagnalis J1 Lymnaea stag...    40   0.001  3
(GE907673) 9549023_L16.ab1_c Past_norm2007 Porites astreoide...    38   0.001  3
(GD204301) G1045P390FO18.T1 Aplysia californica Pooled Norma...    38   0.001  3
(CN810161) Ls_J1_07B07_SAC Lymnaea stagnalis J1 Lymnaea stag...    40   0.001  3
(GD228447) G1045P399FO17.T1 Aplysia californica Pooled Norma...    38   0.001  3
(FF080789) G1045P338RL2.T0 Aplysia californica Pooled Normal...    38   0.001  3
(FF080741) G1045P338FL2.T0 Aplysia californica Pooled Normal...    38   0.002  3
(GD204349) G1045P390RO18.T1 Aplysia californica Pooled Norma...    38   0.002  3
(GD228495) G1045P399RO17.T1 Aplysia californica Pooled Norma...    38   0.002  3
(W59914) SWAMCA964SK Brugia malayi adult male cDNA (SAW94NL-...    42   0.002  2
(EH648522) AU_Cv_EST_016B_B04 Oyster mixed tissue normalized...    40   0.002  2
(DX697333) 2118440 VV03 Ustilago maydis genomic clone 896849...    40   0.002  2
(EW280828) rjca10c_e21.y1 jca Sus scrofa cDNA 5', mRNA seque...    42   0.002  2
(FE423871) CBTX4311.fwd CBTX_Daphnia_pulex_Chosen_One_Librar...    42   0.002  2
(EV243494) kn-469-01_e02_t7 Pythium oligandrum vegetative my...    48   0.002  2
(EV243918) kn-469-02_h09_t7 Pythium oligandrum vegetative my...    48   0.002  2
(FE300302) CANP1531.fwd CANP_Daphnia_pulex_Log50_Library_2 D...    42   0.002  2
(EV243473) kn-469-01_c24_t7 Pythium oligandrum vegetative my...    48   0.002  2
(FE391788) CBTO3464.fwd CBTO_Daphnia_pulex_Chosen_One_Librar...    42   0.003  2
(EV244081) kn-469-02_o12_t7 Pythium oligandrum vegetative my...    48   0.003  2
(EV243804) kn-469-02_c14_t7 Pythium oligandrum vegetative my...    48   0.003  2
(FE384173) CBNT2896.fwd CBNT_Daphnia_pulex_Chosen_One_Librar...    42   0.003  2
(FE367572) CBNO5042.fwd CBNO_Daphnia_pulex_Chosen_One_Librar...    42   0.003  2
(FE328521) CANY4239.fwd CANY_Daphnia_pulex_Log50_Library_20 ...    42   0.003  2
(BX429000) human full-length cDNA 5-PRIME end of clone CS0DG...    48   0.003  2
(FE293339) CANN2600.rev CANN_Daphnia_pulex_Log50_Library_17 ...    38   0.003  3
(EV244052) kn-469-02_n04_t7 Pythium oligandrum vegetative my...    48   0.003  2
(FE383881) CBNT2678.fwd CBNT_Daphnia_pulex_Chosen_One_Librar...    42   0.003  2
(EV245259) g882p33fe4.t0 P. oligandrum interaction with kill...    48   0.003  2
(EV247091) g882p33re4.t0 P. oligandrum interaction with kill...    48   0.003  2
(EV244119) kn-469-03_a03_t7 Pythium oligandrum vegetative my...    48   0.003  2
(EV244260) kn-469-03_j07_t7 Pythium oligandrum vegetative my...    48   0.003  2
(EV244252) kn-469-03_i20_t7 Pythium oligandrum vegetative my...    48   0.003  2
(EV244155) kn-469-03_c24_t7 Pythium oligandrum vegetative my...    48   0.003  2
(EV244282) kn-469-03_k14_t7 Pythium oligandrum vegetative my...    48   0.003  2
(AC196872) Macaca mulatta clone CH250-8I4, WORKING DRAFT SEQ...    56   0.003  1
(CJ997011) Saccharomyces pastorianus mRNA, clone: D028-46, 5...    56   0.003  1
(CD385731) AGENCOURT_14303568 NIH_MGC_173 Homo sapiens cDNA ...    56   0.003  1
(BX367580) human full-length cDNA 3-PRIME end of clone CS0DC...    56   0.003  1
(BQ648783) AGENCOURT_8352583 NIH_MGC_100 Homo sapiens cDNA c...    56   0.003  1
(BM910221) AGENCOURT_6607640 NIH_MGC_98 Homo sapiens cDNA cl...    56   0.003  1
(BE259670) 601145806F1 NIH_MGC_19 Homo sapiens cDNA clone IM...    56   0.003  1
(BE259314) 601106669F1 NIH_MGC_16 Homo sapiens cDNA clone IM...    56   0.003  1
(BE019455) bb56a03.y1 NIH_MGC_17 Homo sapiens cDNA clone IMA...    56   0.003  1
(GE903925) 1112997433724 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE903213) 1112997340218 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE898578) 1112934806662 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE886399) 1112934343424 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE876813) 1112870199208 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE874919) 1112870170964 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE867551) 1112870070400 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE865015) 1112870049196 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE862191) 1112870022143 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE860148) 1112869999552 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE855439) 1112869955368 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE849024) 1112869890068 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE848814) 1112869888742 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE848503) 1112854377015 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(GE846159) 1112870082700 BABEVCEREB-C-01-1-7KB Papio anubis ...    56   0.003  1
(FC178798) 1106909241486 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC178553) 1106909238878 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC178338) 1106909237554 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC178163) 1106909236968 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC177371) 1106909232947 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC177190) 1106909232343 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC177030) 1106909231744 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC176977) 1106909231006 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC176802) 1106909229259 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC176800) 1106909229257 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC176401) 1106908965608 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC176119) 1106908915919 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC175665) 1106908889232 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC175580) 1106908888468 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC175559) 1106908888446 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC175526) 1106908880953 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC175310) 1106908874642 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC175036) 1106908870393 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC174605) 1106908860571 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC174445) 1106908855586 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC174386) 1106908852155 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC174277) 1106908851743 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC174136) 1106908847688 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC173990) 1106908844077 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC173676) 1106908835256 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC173451) 1106908832503 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC173119) 1106908822897 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC172631) 1106908809083 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC172589) 1106908807789 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC172398) 1106908803711 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC172026) 1106908790115 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171985) 1106908790064 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171981) 1106908790059 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171980) 1106908790058 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171759) 1106908776844 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171692) 1106908775708 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171263) 1106908766074 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171115) 1106908762627 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171040) 1106908761100 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC171034) 1106908761092 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC170637) 1106908754362 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC170332) 1106908751901 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC170012) 1106908747684 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC169629) 1106908741845 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC169528) 1106908741344 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC169426) 1106908740921 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC169413) 1106908740902 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC169329) 1106908739069 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC169072) 1106908736760 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168962) 1106908736343 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168736) 1106908732723 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168225) 1106908727131 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168181) 1106908727076 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168104) 1106908725816 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168032) 1106908725620 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC168017) 1106908725605 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC167733) 1106908723085 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC167515) 1106908719452 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC167114) 1106908715227 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC166956) 1106908712185 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC166339) 1106908707876 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC166040) 1106908703478 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC165879) 1106908701363 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC165650) 1106908698268 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC165228) 1106908692306 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC165087) 1106908690985 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC164794) 1106908688628 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC164380) 1106908686202 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC164187) 1106908685609 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC163716) 1106908683641 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC163698) 1106908683622 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC163538) 1106908683260 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC163448) 1106908682879 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC163396) 1106908682724 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC163067) 1106908681372 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC162852) 1106908680936 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC162456) 1106908679668 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC161926) 1106908677291 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC161529) 1106908674228 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC161445) 1106908673837 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC161332) 1106908673142 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160680) 1106908670839 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160536) 1106908670588 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160353) 1106908670201 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160350) 1106908670198 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160345) 1106908670193 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160303) 1106908670051 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160255) 1106908670000 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160251) 1106908669995 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC160250) 1106908669994 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC159665) 1106908667952 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC159588) 1106908667377 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC159022) 1106908665387 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC158848) 1106908663936 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC158216) 1106908661154 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC157746) 1106908658274 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC157441) 1106908656593 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC157268) 1106908655836 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC157197) 1106908655657 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC157026) 1106908655260 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC156830) 1106908654856 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC156809) 1106908654832 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC156310) 1106908652112 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC156119) 1106908650794 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC155496) 1106908648820 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC155467) 1106908648688 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC155402) 1106908648615 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC154867) 1106908643239 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC154665) 1106908641391 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC154136) 1106908639419 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC154003) 1106908638277 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC153924) 1106908638080 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC153558) 1106908636098 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC153520) 1106908635957 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC153217) 1106908635316 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC153123) 1106908635121 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC153091) 1106908634990 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC152756) 1106908633030 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC152027) 1106908627645 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC151728) 1106908622786 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC151588) 1106908621476 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC151319) 1106908617396 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC151315) 1106908617391 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC151158) 1106908614510 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC150972) 1106908612660 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC150762) 1106908612035 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC150658) 1106908611812 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC150630) 1106908610530 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC150172) 1106908608375 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC150156) 1106908608356 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC149822) 1106908606523 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC149042) 1106908597591 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC148949) 1106908597091 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC148472) 1106908595101 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC148378) 1106908594139 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC148279) 1106908593813 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC148063) 1106908587872 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC147959) 1106908587071 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC147934) 1106908587035 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC147649) 1106908584767 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC147047) 1106908581283 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC146998) 1106908581130 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC146986) 1106908581116 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC146623) 1106908579730 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC146432) 1106908575747 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC146148) 1106908572884 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC145673) 1106908569994 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC145592) 1106908569808 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC145467) 1106908569364 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC145354) 1106908567690 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC145282) 1106908567515 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC145137) 1106908567062 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC143791) 1106908556520 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC143737) 1106908556365 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC143160) 1106908553478 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC143005) 1106908553119 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC142611) 1106908546787 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC142361) 1106908545240 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC142057) 1106908543647 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC142012) 1106908542148 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC141922) 1106908541947 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC141521) 1106908540032 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC141194) 1106908536766 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC140629) 1106908531946 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC140492) 1106908531397 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC140384) 1106908530418 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC139588) 1106908526195 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC139472) 1106908525282 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC139147) 1106908521605 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC139104) 1106908521559 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC138981) 1106908520662 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC138932) 1106908520611 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC138612) 1106908518495 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC138588) 1106908517606 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC138524) 1106908517527 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC138165) 1106908514475 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC137732) 1106908508783 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC137582) 1106908506863 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC137534) 1106908506801 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC137328) 1106908506271 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC137187) 1106908506005 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC136817) 1106908503341 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC136684) 1106908501067 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC136627) 1106908500707 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC136303) 1106908498359 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC136284) 1106908498335 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC136139) 1106908497561 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC135960) 1106908495131 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC135823) 1106908494866 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC135591) 1106908493741 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC135028) 1106908488008 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC134986) 1106908487959 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC134793) 1106908485891 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC134718) 1106908485705 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC134642) 1106908485486 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC134079) 1106908481500 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC133405) 1106908470845 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC133138) 1106908468694 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC132875) 1106908467773 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC132798) 1106908467574 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC132667) 1106908467011 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC132609) 1106908466455 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC131910) 1106908455297 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC131865) 1106908453603 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC131818) 1106908453541 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1
(FC131599) 1106908453008 BABEVPN-C-01-1-7KB Papio anubis cDN...    56   0.003  1

>(AU284312) Dictyostelium discoideum gamete cDNA clone:FC-AK15,
           single read.
          Length = 874

 Score = 1168 bits (589), Expect(2) = 0.0
 Identities = 589/589 (100%)
 Strand = Plus / Plus


Query: 122 tcgacccattcacccgtaaggaatggtatgttgtaagagcaccaactcaattcttcaaat 181
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 37  tcgacccattcacccgtaaggaatggtatgttgtaagagcaccaactcaattcttcaaat 96


Query: 182 caccagctgataacaaagtcggtttcactccagttaacagaacccaaggtaccaaacttg 241
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 97  caccagctgataacaaagtcggtttcactccagttaacagaacccaaggtaccaaacttg 156


Query: 242 cttctgatggtttaaagggtcgtgtctacgaagtttcactcgctgatatgaaagacgatg 301
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 157 cttctgatggtttaaagggtcgtgtctacgaagtttcactcgctgatatgaaagacgatg 216


Query: 302 aatcccaagtcttcagaaagatcaaattaagagctgaagaagttgaaggtagaaacgttt 361
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 217 aatcccaagtcttcagaaagatcaaattaagagctgaagaagttgaaggtagaaacgttt 276


Query: 362 taaccaacttttacggtatggatttaacctcagacaaactccgttcattaatccacaaat 421
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 277 taaccaacttttacggtatggatttaacctcagacaaactccgttcattaatccacaaat 336


Query: 422 ggtccaccttgatcgaatgttttgttgatgttaagaccactgatggttatttcctccgtg 481
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 337 ggtccaccttgatcgaatgttttgttgatgttaagaccactgatggttatttcctccgtg 396


Query: 482 tctttgccatctgtttcaccaaaaagggtgaatcccaaaagaaaaagacctcatacgcca 541
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 397 tctttgccatctgtttcaccaaaaagggtgaatcccaaaagaaaaagacctcatacgcca 456


Query: 542 agacctcccgtgttaaggctatccgtaagaagatggttgacattttaaccgaaaccgtct 601
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 457 agacctcccgtgttaaggctatccgtaagaagatggttgacattttaaccgaaaccgtct 516


Query: 602 catccaacgacctcaaaaccgttgttgactatttaattggtgtctcattaaacggtgtta 661
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 517 catccaacgacctcaaaaccgttgttgactatttaattggtgtctcattaaacggtgtta 576


Query: 662 ccactaacgcctctggttttgccccaaccctcgctgaaaaaatcagaat 710
           |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 577 ccactaacgcctctggttttgccccaaccctcgctgaaaaaatcagaat 625

 Score =  381 bits (192), Expect(2) = 0.0
 Identities = 192/192 (100%)
 Strand = Plus / Plus


Query: 711 atcagaatcgaaggttcatcaatcttcccaatccacaacgtcttcatcagaaaggttaaa 770
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 618 atcagaatcgaaggttcatcaatcttcccaatccacaacgtcttcatcagaaaggttaaa 677


Query: 771 gtcctcaagactccaaaagttgatgctgctaaattatctgaactctatgcttcatctgcc 830
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 678 gtcctcaagactccaaaagttgatgctgctaaattatctgaactctatgcttcatctgcc 737


Query: 831 acctcaaccatcgccccaactgaagaagtaggtaccgctgttgaaagaactgaagaaacc 890
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 738 acctcaaccatcgccccaactgaagaagtaggtaccgctgttgaaagaactgaagaaacc 797


Query: 891 accaccaccgct 902
           ||||||||||||
Sbjct: 798 accaccaccgct 809

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 949,353,808
Number of extensions: 55093023
Number of successful extensions: 4316705
Number of sequences better than 10.0: 10420
Length of query: 988
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 964
Effective length of database: 99,340,224,878
Effective search space: 95763976782392
Effective search space used: 95763976782392
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
protein update 2009. 7.28
Homology vs Protein 
Query= Contig-U16491-1 (Contig-U16491-1Q) /CSM_Contig/Contig-U16491-1Q.Seq.d
         (988 letters)

Database: nrp_A
           3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q54ZW5) RecName: Full=40S ribosomal protein S3a;                     394   e-108
AC116977_69(AC116977|pid:none) Dictyostelium discoideum chromoso...   392   e-108
EU683898_1(EU683898|pid:none) Chironomus riparius ribosomal prot...   219   5e-63
AY603568_1(AY603568|pid:none) Culicoides sonorensis clone CsRPS3...   218   4e-61
AY857460_1(AY857460|pid:none) Suberites domuncula S3a mRNA, comp...   209   3e-60
AY850276_1(AY850276|pid:none) Periplaneta americana Parcxpwex01 ...   211   3e-59
DQ252485_1(DQ252485|pid:none) Solanum tuberosum clone 048H05 cyc...   207   4e-59
DQ440031_1(DQ440031|pid:none) Aedes aegypti clone AE-259 40S rib...   210   5e-59
AB029635_1(AB029635|pid:none) Daucus carota mRNA for cyc07, comp...   204   8e-59
DQ241862_1(DQ241862|pid:none) Solanum tuberosum clone 027B03 40S...   205   1e-58
AP004001_29(AP004001|pid:none) Oryza sativa Japonica Group genom...   203   2e-58
AJ783867_1(AJ783867|pid:none) Biphyllus lunatus mRNA for S3Ae ri...   206   2e-58
DQ252490_1(DQ252490|pid:none) Solanum tuberosum clone 059D09 cyc...   204   2e-58
EU124994_1(EU124994|pid:none) Eurythoe complanata ribosomal prot...   203   4e-58
EF675773_1(EF675773|pid:none) Artemia franciscana 40S ribosomal ...   203   5e-58
AM446364_1(AM446364|pid:none) Vitis vinifera contig VV78X167880....   204   5e-58
DQ268849_1(DQ268849|pid:none) Solanum tuberosum clone 155F06 cyc...   202   1e-57
EU247153_1(EU247153|pid:none) Lycosa singoriensis clone LSsin618...   213   1e-57
JC5250(JC5250;PC4306;A41974;S45052)ribosomal protein S3a, cytoso...   202   2e-57
(Q6DV02) RecName: Full=40S ribosomal protein S3a;                     201   2e-57
BC066926_1(BC066926|pid:none) Homo sapiens ribosomal protein S3A...   201   2e-57
L13802_1(L13802|pid:none) Homo sapiens (clone 03) liver expessed...   201   2e-57
AB171328_1(AB171328|pid:none) Macaca fascicularis brain cDNA clo...   201   2e-57
(P61247) RecName: Full=40S ribosomal protein S3a;  &(Q56JV9) Rec...   201   2e-57
(P61246) RecName: Full=40S ribosomal protein S3a; Flags: Fragmen...   201   2e-57
CS559986_1(CS559986|pid:none) Sequence 573 from Patent WO2006032...   200   2e-57
(P97351) RecName: Full=40S ribosomal protein S3a;  &AK010605_1(A...   201   2e-57
BT065729_1(BT065729|pid:none) Zea mays full-length cDNA clone ZM...   200   2e-57
CS559752_1(CS559752|pid:none) Sequence 339 from Patent WO2006032...   199   3e-57
(Q42262) RecName: Full=40S ribosomal protein S3a-2;  &AJ001342_1...   203   3e-57
DQ886750_1(DQ886750|pid:none) Argas monolakensis 40S ribosomal p...   205   3e-57
AM048925_1(AM048925|pid:none) Timarcha balearica mRNA for riboso...   204   4e-57
EF639009_1(EF639009|pid:none) Triatoma infestans clone TI-461 40...   204   4e-57
CS559904_1(CS559904|pid:none) Sequence 491 from Patent WO2006032...   198   6e-57
CS559646_1(CS559646|pid:none) Sequence 233 from Patent WO2006032...   198   6e-57
CS560132_1(CS560132|pid:none) Sequence 719 from Patent WO2006032...   198   6e-57
AK003158_1(AK003158|pid:none) Mus musculus 18-day embryo whole b...   200   6e-57
(Q4T8S6) RecName: Full=40S ribosomal protein S3a;                     200   6e-57
(Q4R4Z6) RecName: Full=40S ribosomal protein S3a;  &AB169748_1(A...   199   6e-57
AF052503_1(AF052503|pid:none) Oryza sativa S-phase-specific ribo...   198   6e-57
BT034241_1(BT034241|pid:none) Zea mays full-length cDNA clone ZM...   198   6e-57
BT043775_1(BT043775|pid:none) Salmo salar clone HM6_1240 V-Fos t...   200   8e-57
CS559714_1(CS559714|pid:none) Sequence 301 from Patent WO2006032...   202   1e-56
AF402811_1(AF402811|pid:none) Ictalurus punctatus 40S ribosomal ...   199   1e-56
EU961149_1(EU961149|pid:none) Zea mays clone 232905 40S ribosoma...   197   1e-56
EF444539_1(EF444539|pid:none) Pteromalus puparum ribosomal prote...   202   1e-56
DQ066297_1(DQ066297|pid:none) Ixodes scapularis isolate is-all-3...   202   2e-56
DQ214670_1(DQ214670|pid:none) Taeniopygia guttata clone 0058P003...   201   2e-56
EF147866_1(EF147866|pid:none) Populus trichocarpa clone WS0125_I...   198   2e-56
(Q6PBY1) RecName: Full=40S ribosomal protein S3a;  &AY648734_1(A...   199   2e-56
(O73813) RecName: Full=40S ribosomal protein S3a; AltName: Full=...   201   2e-56
BT083120_1(BT083120|pid:none) Anoplopoma fimbria clone afim-evh-...   198   2e-56
AE017342_493(AE017342|pid:none) Cryptococcus neoformans var. neo...   199   2e-56
(Q642T2) RecName: Full=40S ribosomal protein S3a;  &BC080969_1(B...   201   3e-56
(Q98TX2) RecName: Full=40S ribosomal protein S3a;  &AF321768_1(A...   199   4e-56
AY550961_1(AY550961|pid:none) Sparus aurata V-Fos transformation...   199   4e-56
(Q801S3) RecName: Full=40S ribosomal protein S3a;  &BC047260_1(B...   200   5e-56
(P52813) RecName: Full=40S ribosomal protein S3a; AltName: Full=...   201   6e-56
EU934301_1(EU934301|pid:none) TSA: Anopheles darlingi AD-167 40S...   200   8e-56
CS559810_1(CS559810|pid:none) Sequence 397 from Patent WO2006032...   194   8e-56
GQ229194_1(GQ229194|pid:none) Actias selene s3a protein mRNA, co...   204   1e-55
(O43999) RecName: Full=40S ribosomal protein S3a; AltName: Full=...   199   1e-55
AY961531_1(AY961531|pid:none) Lysiphlebus testaceipes ribosomal ...   197   1e-55
D01058_1(D01058|pid:none) Catharanthus roseus cyc07 mRNA, comple...   195   1e-55
BC153786_1(BC153786|pid:none) Xenopus laevis hypothetical protei...   199   1e-55
FJ268645_1(FJ268645|pid:none) Sus scrofa ribosomal protein S3A m...   196   1e-55
(P49198) RecName: Full=40S ribosomal protein S3a;  &L31645_1(L31...   195   1e-55
D26058_1(D26058|pid:none) Catharanthus roseus cyc07 gene, comple...   196   1e-55
(Q9CAV0) RecName: Full=40S ribosomal protein S3a-1;  &AC009465_2...   198   2e-55
AY752836_1(AY752836|pid:none) Culicoides sonorensis clone CsRPS3...   218   2e-55
AM048964_1(AM048964|pid:none) Georissus sp. APV-2005 mRNA for ri...   193   3e-55
(P49396) RecName: Full=40S ribosomal protein S3a; AltName: Full=...   197   3e-55
EF565369_1(EF565369|pid:none) Bombyx mandarina s3a protein mRNA,...   202   4e-55
CS559692_1(CS559692|pid:none) Sequence 279 from Patent WO2006032...   191   1e-54
AY705974_1(AY705974|pid:none) Bombyx mori ribosomal protein S3A ...   201   1e-54
(P49395) RecName: Full=40S ribosomal protein S3a; AltName: Full=...   214   4e-54
(P48154) RecName: Full=40S ribosomal protein S3a;  &S43584(S4358...   192   7e-54
CP001330_369(CP001330|pid:none) Micromonas sp. RCC299 chromosome...   191   2e-53
EF634853_1(EF634853|pid:none) Koerneria sp. RS1982 small subunit...   192   5e-53
EF634852_1(EF634852|pid:none) Pristionchus sp. 15 RS5229 small s...   194   6e-53
EF634838_1(EF634838|pid:none) Pristionchus entomophagus small su...   192   1e-52
EF634835_1(EF634835|pid:none) Pristionchus pacificus small subun...   191   1e-52
EF634845_1(EF634845|pid:none) Pristionchus pauli small subunit r...   191   2e-52
BT083412_1(BT083412|pid:none) Drosophila melanogaster LD08549 fu...   186   2e-52
AE014135_4(AE014135|pid:none) Drosophila melanogaster chromosome...   186   2e-52
AM920435_44(AM920435|pid:none) Penicillium chrysogenum Wisconsin...   189   2e-52
FM992688_285(FM992688|pid:none) Candida dubliniensis CD36 chromo...   190   4e-52
EF634847_1(EF634847|pid:none) Pristionchus sp. 10 RS5133 small s...   192   4e-52
AF542188_1(AF542188|pid:none) Triticum aestivum cyc07 mRNA, comp...   207   6e-52
EF082968_1(EF082968|pid:none) Picea sitchensis clone WS02910_B19...   207   6e-52
EF634843_1(EF634843|pid:none) Pristionchus sp. 6 RS5101 small su...   191   7e-52
CP000500_196(CP000500|pid:none) Pichia stipitis CBS 6054 chromos...   189   1e-51
EF065683_1(EF065683|pid:none) Cymbidium hybrid cultivar RPS3 mRN...   206   1e-51
AE016818_476(AE016818|pid:none) Ashbya gossypii (= Eremothecium ...   187   1e-51
EF634836_1(EF634836|pid:none) Pristionchus maupasi small subunit...   187   2e-51
BX294022_16(BX294022|pid:none) Neurospora crassa DNA linkage gro...   189   3e-51
(P33442) RecName: Full=40S ribosomal protein S1-A; AltName: Full...   188   3e-51
AP007150_601(AP007150|pid:none) Aspergillus oryzae RIB40 genomic...   187   3e-51
(P49397) RecName: Full=40S ribosomal protein S3a; AltName: Full=...   204   4e-51
(P23248) RecName: Full=40S ribosomal protein S1-B; AltName: Full...   187   4e-51
(P40910) RecName: Full=40S ribosomal protein S3aE; AltName: Full...   187   6e-51
EF145218_1(EF145218|pid:none) Populus trichocarpa clone WS01121_...   203   9e-51
EU139170_1(EU139170|pid:none) Flustra foliacea putative 40S ribo...   202   1e-50
AP008218_722(AP008218|pid:none) Oryza sativa (japonica cultivar-...   202   1e-50
CS559766_1(CS559766|pid:none) Sequence 353 from Patent WO2006032...   176   3e-50
FN392322_546(FN392322|pid:none) Pichia pastoris GS115 chromosome...   186   4e-50
BT053090_1(BT053090|pid:none) Medicago truncatula clone MTYFL_FM...   199   9e-50
AK296121_1(AK296121|pid:none) Homo sapiens cDNA FLJ51870 complet...   199   9e-50
EU558333_1(EU558333|pid:none) Phoronis muelleri putative 40S rib...   199   1e-49
CP000499_73(CP000499|pid:none) Pichia stipitis CBS 6054 chromoso...   179   5e-49
CR940352_673(CR940352|pid:none) Theileria annulata strain Ankara...   174   6e-48
(Q9XEG7) RecName: Full=40S ribosomal protein S3a;  &AF093109_1(A...   176   7e-48
AY849388_1(AY849388|pid:none) Vitis vinifera cultivar Riesling c...   191   3e-47
AY232076_1(AY232076|pid:none) Drosophila yakuba clone yak-ad_RpS...   186   2e-46
EF085220_1(EF085220|pid:none) Picea sitchensis clone WS0273_M24 ...   188   3e-46
AL034559_37(AL034559|pid:none) Plasmodium falciparum MAL3P7, com...   163   4e-45
EU366502_1(EU366502|pid:none) Taenia solium Ts6 protein mRNA, co...   183   7e-45
(O94438) RecName: Full=40S ribosomal protein S3aE-B; AltName: Fu...   182   2e-44
AY383658_1(AY383658|pid:none) Rattus norvegicus LRRGT00003 mRNA,...   162   3e-44
CR382136_400(CR382136|pid:none) Debaryomyces hansenii strain CBS...   181   5e-44
(Q09781) RecName: Full=40S ribosomal protein S3aE-A; AltName: Fu...   177   7e-43
FN315293_1(FN315293|pid:none) Schistosoma japonicum isolate Anhu...   173   9e-42
EU124932_1(EU124932|pid:none) Arenicola marina ribosomal protein...   150   6e-41
AB099017_1(AB099017|pid:none) Bos taurus mRNA for similar to rib...   170   8e-41
AY914942_1(AY914942|pid:none) Schistosoma japonicum SJCHGC01276 ...   170   8e-41
FN357545_8(FN357545|pid:none) Schistosoma mansoni genome sequenc...   169   1e-40
AM849484_1(AM849484|pid:none) Pomphorhynchus laevis partial mRNA...   163   8e-39
AE014135_5(AE014135|pid:none) Drosophila melanogaster chromosome...   140   1e-38
CP000882_96(CP000882|pid:none) Hemiselmis andersenii chromosome ...   144   5e-37
AM494971_43(AM494971|pid:none) Leishmania braziliensis chromosom...   140   3e-35
AM502253_49(AM502253|pid:none) Leishmania infantum chromosome 35.     140   7e-35
AM502253_50(AM502253|pid:none) Leishmania infantum chromosome 35...   140   7e-35
FJ384979_1(FJ384979|pid:none) Bombina orientalis ribosomal prote...   123   5e-33
BT055335_1(BT055335|pid:none) Zea mays full-length cDNA clone ZM...    97   2e-26
AE014135_6(AE014135|pid:none) Drosophila melanogaster chromosome...    97   8e-26
AB098918_1(AB098918|pid:none) Bos taurus mRNA for similar to rib...   117   5e-25
AM048963_1(AM048963|pid:none) Eucinetus sp. APV-2005 partial mRN...    94   7e-24
AB098785_1(AB098785|pid:none) Bos taurus mRNA for similar to rib...    87   4e-23
CS560138_1(CS560138|pid:none) Sequence 725 from Patent WO2006032...   110   8e-23
EZ000612_1(EZ000612|pid:none) TSA: Culex tarsalis Ctar-83 40S ri...    87   6e-22
AX884862_1(AX884862|pid:none) Sequence 725 from Patent EP1033401.      82   8e-22
AJ010592_18(AJ010592|pid:none) Guillardia theta DNA for complete...    96   3e-18
CP000300_2166(CP000300|pid:none) Methanococcoides burtonii DSM 6...    89   3e-16
(Q8TVD1) RecName: Full=30S ribosomal protein S3Ae;  &AE009439_14...    82   9e-16
(Q46AN4) RecName: Full=30S ribosomal protein S3Ae;  &CP000099_20...    85   4e-15
(Q5V296) RecName: Full=30S ribosomal protein S3Ae;  &AY596297_12...    83   1e-14
(Q8TKI9) RecName: Full=30S ribosomal protein S3Ae;                     83   2e-14
(Q8Q0F2) RecName: Full=30S ribosomal protein S3Ae;  &AE008384_18...    83   2e-14
(Q8TZE1) RecName: Full=30S ribosomal protein S3Ae;  &AE009950_20...    73   6e-14
(O57803) RecName: Full=30S ribosomal protein S3Ae;  &A71225(A712...    73   1e-13
AJ248283_68(AJ248283|pid:none) Pyrococcus abyssi complete genome...    72   4e-13
(Q9V2K7) RecName: Full=30S ribosomal protein S3Ae;                     72   4e-13
(A3MVE0) RecName: Full=30S ribosomal protein S3Ae;  &CP000561_11...    77   7e-13
(Q8ZT21) RecName: Full=30S ribosomal protein S3Ae;  &AE009441_24...    77   1e-12
AM114193_868(AM114193|pid:none) Uncultured methanogenic archaeon...    76   2e-12
AE010299_3329(AE010299|pid:none) Methanosarcina acetivorans str....    75   5e-12
(Q9YCV8) RecName: Full=30S ribosomal protein S3Ae;  &BA000002_77...    74   6e-12
CP000743_747(CP000743|pid:none) Methanococcus aeolicus Nankai-3,...    74   8e-12
DQ118403_36(DQ118403|pid:none) Uncultured euryarchaeote Alv-FOS1...    72   9e-12
AK318918_1(AK318918|pid:none) Arabidopsis thaliana AT4G34670 mRN...    51   9e-12
CP001338_2525(CP001338|pid:none) Candidatus Methanosphaerula pal...    74   1e-11
CP000866_1508(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ...    73   2e-11
(Q4JB17) RecName: Full=30S ribosomal protein S3Ae;  &CP000077_58...    73   2e-11
CP001399_1345(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    69   4e-11
CP001463_1250(CP001463|pid:none) Thermococcus sibiricus MM 739, ...    71   5e-11
(A6USE4) RecName: Full=30S ribosomal protein S3Ae;  &CP000742_15...    71   5e-11
CR860858_1(CR860858|pid:none) Pongo abelii mRNA; cDNA DKFZp469E1...    71   7e-11
(Q975F8) RecName: Full=30S ribosomal protein S3Ae;  &BA000023_50...    70   9e-11
(Q5JGM4) RecName: Full=30S ribosomal protein S3Ae;  &AP006878_12...    70   9e-11
(A5UKY8) RecName: Full=30S ribosomal protein S3Ae;  &CP000678_66...    70   9e-11
(Q18HQ7) RecName: Full=30S ribosomal protein S3Ae;  &AM180088_14...    70   1e-10
CP000493_413(CP000493|pid:none) Hyperthermus butylicus DSM 5456,...    69   2e-10
CP001398_863(CP001398|pid:none) Thermococcus gammatolerans EJ3, ...    69   3e-10
(A9A7B4) RecName: Full=30S ribosomal protein S3Ae;  &CP000867_21...    67   1e-09
EF089401_14(EF089401|pid:none) Uncultured marine bacterium HF10_...    66   2e-09
CP001365_614(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49...    66   2e-09
(A3CSL0) RecName: Full=30S ribosomal protein S3Ae;  &CP000562_42...    66   2e-09
D64422(D64422)ribosomal protein S3a - Methanococcus jannaschii         65   4e-09
(P54059) RecName: Full=30S ribosomal protein S3Ae;  &L77117_1002...    65   4e-09
EF558552_7(EF558552|pid:none) Halorubrum sp. TP009 clone 4 seque...    65   5e-09
CP000780_2228(CP000780|pid:none) Candidatus Methanoregula boonei...    64   1e-08
AY550075_1(AY550075|pid:none) Sus scrofa 40S ribosomal protein S...    46   2e-08
AB027994_1(AB027994|pid:none) Schizosaccharomyces pombe gene for...    61   5e-08
EU963400_1(EU963400|pid:none) Zea mays clone 261912 unknown mRNA.      61   7e-08
(Q2FS35) RecName: Full=30S ribosomal protein S3Ae;  &CP000254_24...    60   9e-08
S62679(S62679)ribosomal protein S3a, cytosolic - Emericella nidu...    59   2e-07
(A8AAU3) RecName: Full=30S ribosomal protein S3Ae;  &CP000816_86...    59   3e-07
EU016664_12(EU016664|pid:none) Uncultured marine microorganism H...    55   3e-06
EU016635_21(EU016635|pid:none) Uncultured Group I marine crenarc...    53   2e-05
DQ158857_52(DQ158857|pid:none) Bigelowiella natans nucleomorph c...    51   5e-05
CP000559_285(CP000559|pid:none) Methanocorpusculum labreanum Z, ...    50   1e-04
EF576486_1(EF576486|pid:none) Oryza sativa (indica cultivar-grou...    48   5e-04
AB098832_1(AB098832|pid:none) Bos taurus mRNA for similar to rib...    46   0.002
EU971458_1(EU971458|pid:none) Zea mays clone 365353 unknown mRNA.      45   0.005
AY909417_1(AY909417|pid:none) Siniperca chuatsi clone C175 40S r...    44   0.009
AF117889_1(AF117889|pid:none) Avena fatua 40S ribosomal protein ...    44   0.009
Z18417_1(Z18417|pid:none) Arabidopsis thaliana transcribed seque...    42   0.025
DQ675535_1(DQ675535|pid:none) Diaphorina citri clone WHDc0001 ri...    42   0.025
AK220818_1(AK220818|pid:none) Arabidopsis thaliana mRNA for 40S ...    42   0.033
DQ214673_1(DQ214673|pid:none) Taeniopygia guttata clone 0061P000...    39   0.21
AB373032_32(AB373032|pid:none) Staphylococcus aureus DNA, type 5...    35   5.3
(P52087) RecName: Full=UvrABC system protein A;          Short=U...    34   9.0
AY714855_28(AY714855|pid:none) Uncultured archaeon GZfos32E7 clo...    34   9.0

>(Q54ZW5) RecName: Full=40S ribosomal protein S3a;
          Length = 273

 Score =  394 bits (1011), Expect = e-108
 Identities = 201/217 (92%), Positives = 202/217 (93%)
 Frame = +1

Query: 76  MADXXXXXXXXXXXXVDPFTRKEWYVVRAPTQFFKSPADNKVGFTPVNRTQGTKLASDGL 255
           MAD            VDPFTRKEWYVVRAPTQFFKSPADNKVGFTPVNRTQGTKLASDGL
Sbjct: 1   MADKKKKGSKKGGKKVDPFTRKEWYVVRAPTQFFKSPADNKVGFTPVNRTQGTKLASDGL 60

Query: 256 KGRVYEVSLADMKDDESQVFRKIKLRAEEVEGRNVLTNFYGMDLTSDKLRSLIHKWSTLI 435
           KGRVYEVSLADMKDDESQVFRKIKLRAEEVEGRNVLTNFYGMDLTSDKLRSLIHKWSTLI
Sbjct: 61  KGRVYEVSLADMKDDESQVFRKIKLRAEEVEGRNVLTNFYGMDLTSDKLRSLIHKWSTLI 120

Query: 436 ECFVDVKTTDGYFLRVFAICFTKKGESQKKKTSYAKTSRVKAIRKKMVDILTETVSSNDL 615
           ECFVDVKTTDGYFLRVFAICFTKKGESQKKKTSYAKTSRVKAIRKKMVDILTETVSSNDL
Sbjct: 121 ECFVDVKTTDGYFLRVFAICFTKKGESQKKKTSYAKTSRVKAIRKKMVDILTETVSSNDL 180

Query: 616 KTVVDYLIGVSLNGVTTNASGFAPTLAEKIRISESKV 726
           KTVVDYLIGVSLNGVTTNASGFAPTLAEKIRI  S +
Sbjct: 181 KTVVDYLIGVSLNGVTTNASGFAPTLAEKIRIEGSSI 217

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 46/48 (95%), Positives = 47/48 (97%)
 Frame = +3

Query: 705 QNIRIEGSSIFPIHNVFIRKVKVLKTPKVDAAKLSELYASSATSTIAP 848
           + IRIEGSSIFPIHNVFIRKVKVLKTPKVDAAKLSELYASSATSTIAP
Sbjct: 208 EKIRIEGSSIFPIHNVFIRKVKVLKTPKVDAAKLSELYASSATSTIAP 255

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,380,966,500
Number of extensions: 25641206
Number of successful extensions: 59290
Number of sequences better than 10.0: 203
Number of HSP's gapped: 59045
Number of HSP's successfully gapped: 342
Length of query: 329
Length of database: 1,061,185,681
Length adjustment: 129
Effective length of query: 200
Effective length of database: 639,555,889
Effective search space: 127911177800
Effective search space used: 127911177800
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
PSORT 

 psg: 0.43  gvh: 0.30  alm: 0.44  top: 0.53  tms: 0.00  mit: 0.15  mip: 0.00
 nuc: 0.17  erl: 0.00  erm: 0.20  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: cytoplasmic
	 44.0 %: nuclear
	  4.0 %: cytoskeletal
	  4.0 %: mitochondrial

>> prediction for Contig-U16491-1 is cyt
VS (DIR, S) 17
VH (FL, L) 1
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 3
SS (DIR, S) 2
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 19
FC-IC (SUB) 2