Contig-U16451-1 |
Contig ID |
Contig-U16451-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
no gap |
Contig length |
1850 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
1790029 |
End point |
1791878 |
Strand (PLUS/MINUS) |
PLUS |
Number of clones |
15 |
Number of EST |
23 |
Link to clone list |
U16451 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 4. 3 |
Homology vs DNA |
Query= Contig-U16451-1 (Contig-U16451-1Q) /CSM_Contig/Contig-U16451-1Q.Seq.d (1850 letters)
Database: ddbj_A 102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AY387644) Dictyostelium discoideum malic enzyme gene, compl... 1830 0.0 2 (AC115680) Dictyostelium discoideum chromosome 2 map 4915084... 1822 0.0 2 (AU033786) Dictyostelium discoideum slug cDNA, clone SLB437. 1366 0.0 1 (BJ377655) Dictyostelium discoideum cDNA clone:ddc25c08, 3' ... 1338 0.0 1 (BJ399704) Dictyostelium discoideum cDNA clone:dds7i02, 3' e... 1300 0.0 1 (BJ433424) Dictyostelium discoideum cDNA clone:ddv21g20, 3' ... 1298 0.0 1 (BJ432732) Dictyostelium discoideum cDNA clone:ddv19h17, 3' ... 1296 0.0 2 (BJ377101) Dictyostelium discoideum cDNA clone:ddc22i15, 3' ... 1273 0.0 2 (BJ374915) Dictyostelium discoideum cDNA clone:ddc16d21, 3' ... 1265 0.0 2 (BJ372673) Dictyostelium discoideum cDNA clone:ddc13j18, 3' ... 1253 0.0 3 (BJ431949) Dictyostelium discoideum cDNA clone:ddv17k01, 3' ... 1237 0.0 1 (BJ375598) Dictyostelium discoideum cDNA clone:ddc19d09, 3' ... 1231 0.0 2 (AU060773) Dictyostelium discoideum slug cDNA, clone SLB437. 1221 0.0 1 (BJ359266) Dictyostelium discoideum cDNA clone:ddc13j18, 5' ... 1207 0.0 1 (BJ414556) Dictyostelium discoideum cDNA clone:ddv19h17, 5' ... 1174 0.0 1 (BJ377054) Dictyostelium discoideum cDNA clone:ddc22n08, 3' ... 1174 0.0 1 (BJ361902) Dictyostelium discoideum cDNA clone:ddc19d09, 5' ... 1156 0.0 1 (BJ432092) Dictyostelium discoideum cDNA clone:ddv17i14, 3' ... 1138 0.0 3 (BJ415212) Dictyostelium discoideum cDNA clone:ddv21g20, 5' ... 1116 0.0 1 (AU039567) Dictyostelium discoideum slug cDNA, clone SLE765. 1110 0.0 1 (BJ413838) Dictyostelium discoideum cDNA clone:ddv17k01, 5' ... 1110 0.0 1 (BJ361333) Dictyostelium discoideum cDNA clone:ddc16d21, 5' ... 975 0.0 2 (BJ388901) Dictyostelium discoideum cDNA clone:dds16p16, 5' ... 1019 0.0 1 (BJ413975) Dictyostelium discoideum cDNA clone:ddv17i14, 5' ... 1001 0.0 1 (BJ362773) Dictyostelium discoideum cDNA clone:ddc23n08, 5' ... 979 0.0 1 (BJ363130) Dictyostelium discoideum cDNA clone:ddc25c08, 5' ... 753 0.0 1 (BJ387956) Dictyostelium discoideum cDNA clone:dds7i02, 5' e... 480 0.0 2 (BJ402398) Dictyostelium discoideum cDNA clone:dds16p16, 3' ... 624 0.0 2 (BJ362813) Dictyostelium discoideum cDNA clone:ddc23i15, 5' ... 573 e-159 1 (FE242780) CAPG733.fwd CAPG Naegleria gruberi amoeba stage N... 78 3e-15 3 (DY886886) CeleSEQ2710 Cunninghamella elegans pBluescript (E... 66 3e-10 2 (FE262255) CAZO2506.fwd CAZO Naegleria gruberi Flagellate St... 78 1e-09 1 (FE245819) CAPG9086.fwd CAPG Naegleria gruberi amoeba stage ... 78 1e-09 1 (DY894906) CeleSEQ14594 Cunninghamella elegans pBluescript (... 66 2e-09 3 (DY886615) CeleSEQ2339 Cunninghamella elegans pBluescript (E... 60 2e-08 2 (EU286807) Umbelopsis isabellina strain CBS 194.28 malic enz... 50 1e-07 3 (DY893302) CeleSEQ12600 Cunninghamella elegans pBluescript (... 56 4e-06 2 (DY887642) CeleSEQ4161 Cunninghamella elegans pBluescript (E... 56 4e-06 2 (DY889651) CeleSEQ11601 Cunninghamella elegans pBluescript (... 66 5e-06 1 (CT904801) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 2e-05 3 (CT886326) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 2e-05 3 (CT936317) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 3e-05 3 (CT927882) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 3e-05 3 (CU716405) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 4e-05 3 (CP000020) Vibrio fischeri ES114 chromosome I, complete sequ... 62 8e-05 1 (AR375993) Sequence 999 from patent US 6605709. 46 3e-04 3 (EC825507) SME00008975 esmbsro2 Sawyeria marylandensis cDNA,... 44 7e-04 3 (EF410852) Synthetic construct Bacillus anthracis clone FLH2... 52 9e-04 3 (FC549494) AIAI-aad07d11.b1 Anclostoma_caninum_EST_L3_Activa... 42 0.001 2 (CU709261) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.002 3 (CT931264) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.002 3 (DY861356) ApulSEQ14842 Aureobasidium pullulans pBluescript ... 40 0.002 3 (FC536713) CBPC487.fwd CBPC Thalassiosira pseudonana Tempera... 44 0.003 2 (DY861140) ApulSEQ14514 Aureobasidium pullulans pBluescript ... 40 0.003 3 (CT878250) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.003 3 (CT889423) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.004 3 (CT887806) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.005 3 (CT884723) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.005 3 (CT888186) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.005 3 (DY885254) CeleSEQ479 Cunninghamella elegans pBluescript (Ec... 56 0.005 1 (FE493861) CAOT6472.rev CAOT Selaginella moellendorffii mixe... 56 0.005 1 (FE483209) CAOS9369.rev CAOS Selaginella moellendorffii mixe... 56 0.005 1 (FE469744) CAOS26365.fwd CAOS Selaginella moellendorffii mix... 56 0.005 1 (FE469743) CAOS26365.rev CAOS Selaginella moellendorffii mix... 56 0.005 1 (FE467147) CAOS24996.rev CAOS Selaginella moellendorffii mix... 56 0.005 1 (EU007696) Flaveria floridana NADP-malic enzyme mRNA, partia... 48 0.006 2 (CN629740) taf39c02.y1 Hydra EST Darmstadt I Hydra magnipapi... 42 0.006 2 (CU709235) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.006 3 (AY863144) Flaveria bidentis chloroplast NADP-dependent mali... 48 0.007 2 (CN633487) taf11e01.y1 Hydra EST Darmstadt I Hydra magnipapi... 42 0.007 2 (CN633232) taf11e01.x1 Hydra EST Darmstadt I Hydra magnipapi... 42 0.008 2 (CU711820) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.014 3 (CU714137) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.014 3 (CT931656) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.015 3 (CT887491) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.016 3 (FG300099) 1108793359240 New World Screwworm Larvae 9387 EST... 54 0.020 1 (FG293884) 1108770683244 New World Screwworm Larvae 9387 EST... 54 0.020 1 (FG287203) 1108770734707 New World Screwworm Egg 9261 ESTs C... 54 0.020 1 (FG283554) 1108770623926 New World Screwworm Egg 9261 ESTs C... 54 0.020 1 (DQ975377) Mucor circinelloides malic enzyme (mce2) gene, co... 42 0.024 2 (CU698998) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.031 2 (FE262254) CAZO2506.rev CAZO Naegleria gruberi Flagellate St... 44 0.032 2 (CU717855) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.035 2 (FE242779) CAPG733.rev CAPG Naegleria gruberi amoeba stage N... 44 0.036 2 (CU725938) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.036 2 (FE251539) CAPH3506.fwd CAPH Naegleria gruberi amoeba stage ... 44 0.036 2 (FE245818) CAPG9086.rev CAPG Naegleria gruberi amoeba stage ... 44 0.038 2 (FE251538) CAPH3506.rev CAPH Naegleria gruberi amoeba stage ... 44 0.038 2 (CZ210981) AIAA-aah47a20.g1 Ancylostoma caninum whole genome... 46 0.038 2 (Y09212) B.cereus partial gltT, aspA and partial maoX genes. 52 0.039 2 (FE241279) CAPG6608.rev CAPG Naegleria gruberi amoeba stage ... 44 0.039 2 (CU714786) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.039 2 (CW710297) AIAA-aab30e06.b1 Ancylostoma caninum whole genome... 46 0.041 2 (CT930467) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.042 2 (CU708509) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.043 2 (CU714850) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 0.043 2 (CT926796) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.044 2 (CT896189) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.045 2 (CT884804) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.046 2 (CT935408) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.046 2 (CT901555) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.047 2 (CT890868) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.047 2 (CT928327) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.047 2 (CT908338) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.048 2 (CT937378) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.048 2 (CT895313) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.049 2 (CT909594) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.052 2 (AR547848) Sequence 2979 from patent US 6747137. 40 0.064 4 (CP001283) Bacillus cereus AH820, complete genome. 52 0.079 1 (CP001177) Bacillus cereus AH187, complete genome. 52 0.079 1 (CP000485) Bacillus thuringiensis str. Al Hakam, complete ge... 52 0.079 1 (CP000227) Bacillus cereus Q1, complete genome. 52 0.079 1 (CP000001) Bacillus cereus E33L, complete genome. 52 0.079 1 (AE017355) Bacillus thuringiensis serovar konkukian str. 97-... 52 0.079 1 (AE017334) Bacillus anthracis str. 'Ames Ancestor', complete... 52 0.079 1 (AE017225) Bacillus anthracis str. Sterne, complete genome. 52 0.079 1 (AE017194) Bacillus cereus ATCC 10987, complete genome. 52 0.079 1 (AE016879) Bacillus anthracis str. Ames, complete genome. 52 0.079 1 (ES736292) MytUSCGM5pFLC-I 15k07f1 Mytilus californianus lib... 42 0.12 2 (ES736603) MytUSCGM5pFLC-I 12k02f1 Mytilus californianus lib... 42 0.13 2 (EX119894) BR103724 cotyledon cDNA library KHCT Brassica rap... 42 0.13 2 (FE245893) CAPG9127.fwd CAPG Naegleria gruberi amoeba stage ... 36 0.13 3 (CT921044) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.15 2 (CT935356) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.16 2 (CT907905) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.16 2 (CT932194) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.16 2 (ES396537) MUS06-L02.x1d-t SHGC-MUS Mytilus californianus cD... 42 0.16 2 (CT921043) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.16 2 (CT924986) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.17 2 (ES387980) MUS03-K07.x1d-t SHGC-MUS Mytilus californianus cD... 42 0.17 2 (CT921144) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.17 2 (CT906991) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.17 2 (CT947120) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 0.18 2 (FG299696) 1108793346161 New World Screwworm Larvae 9387 EST... 38 0.23 2 (FE230880) CAPG10035.fwd CAPG Naegleria gruberi amoeba stage... 36 0.23 2 (ER630245) 1093018417216 Global-Ocean-Sampling_GS-36-01-01-2... 50 0.31 1 (CZ288556) cp58h02.f Candida parapsilosis Random Genomic Lib... 50 0.31 1 (EL477185) CHUL5403.b1_E07.ab1 CHU(LMS) puzzle sunflower Hel... 50 0.31 1 (EH420618) OL4542F Brassica oleracea var. alboglabra leaf cD... 50 0.31 1 (EE614517) CHWM1950.b1_K07.ab1 CHW(LMS) silverleaf sunflower... 50 0.31 1 (EE472827) BNSCS5CT_UP_029_F05_26JAN2005_037 Brassica napus ... 50 0.31 1 (AM387351) Brassica oleracea var. alboglabra EST, clone AAF... 50 0.31 1 (AM060771) Brassica oleracea var. alboglabra EST, clone AAF... 50 0.31 1 (FD967070) RR2G719JQ RR2(MS) Raphanus raphanistrum subsp. ra... 50 0.31 1 (FD549071) RR3ER04TF RR3(NY) Raphanus raphanistrum subsp. ra... 50 0.31 1 (FD547011) RR3FG56JQ RR3(NY) Raphanus raphanistrum subsp. ra... 50 0.31 1 (FD545164) RR3ER04JQ RR3(NY) Raphanus raphanistrum subsp. ra... 50 0.31 1 (FD535269) RR1FG54TF RR1(CS) Raphanus raphanistrum subsp. ma... 50 0.31 1 (EY908028) RR2E251TF RR2(MS) Raphanus raphanistrum subsp. ra... 50 0.31 1 (EY899472) RR1DV28TF RR1(CS) Raphanus raphanistrum subsp. ma... 50 0.31 1 (EY895234) RR1DV28JQ RR1(CS) Raphanus raphanistrum subsp. ma... 50 0.31 1 (EX768990) RR3CO11JQ RR3(NY) Raphanus raphanistrum subsp. ra... 50 0.31 1 (EX760883) RR2CM15JQ RR2(MS) Raphanus raphanistrum subsp. ra... 50 0.31 1 (EX129210) BR113040 ovule and silique cDNA library KHOS Bras... 50 0.31 1 (EX128652) BR112482 ovule and silique cDNA library KHOS Bras... 50 0.31 1 (EX126506) BR110336 etiolated mature leaf cDNA library KHLW ... 50 0.31 1 (EX123046) BR106876 mature green leaf cDNA library KHLM Bras... 50 0.31 1 (EX107208) BR093498 whole plant cDNA library KFYP Brassica r... 50 0.31 1 (EX100961) BR087251 root cDNA library KFRT Brassica rapa sub... 50 0.31 1 (EX029030) BR013674 callus cDNA library KBCG Brassica rapa s... 50 0.31 1 (EX026073) BR010717 callus cDNA library KBCG Brassica rapa s... 50 0.31 1 (EV216960) 0132068 Brassica napus Root - drought Brassica na... 50 0.31 1 (EV185972) 0200128 Brassica napus Undamaged cotyledons Brass... 50 0.31 1 (EV178517) 0148311 Brassica napus Etiolated seedlings (pSPOR... 50 0.31 1 (EV116744) 0122056 Brassica napus Root library Brassica napu... 50 0.31 1 (EV114152) 0119464 Brassica napus Root library Brassica napu... 50 0.31 1 (EV114075) 0119387 Brassica napus Root library Brassica napu... 50 0.31 1 (CR543861) Acinetobacter sp. ADP1 complete genome. 50 0.31 1 (BP506190) Hydra magnipapillata cDNA, clone:hm_04308. 42 0.42 2 (FF141233) OFAA-aaa60b08.b1 O.flexuosa_EST_pSMART Onchocerca... 48 0.44 2 (BQ120661) EST606237 mixed potato tissues Solanum tuberosum ... 44 0.50 2 (CK272664) EST718742 potato abiotic stress cDNA library Sola... 44 0.51 2 (DY024923) 53COT2_T3_010_C11_03SEP2004_091 Brassica napus 36... 40 0.52 2 (EK191356) 1095460020185 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.58 2 (X57142) Flaveria trinervia mRNA for NADP-dependent malic en... 48 1.2 1 (EU007697) Flaveria trinervia NADP-malic enzyme mRNA, partia... 48 1.2 1 (EK315488) 1095462411686 Global-Ocean-Sampling_GS-31-01-01-1... 48 1.2 1 (EH715757) CNML2079.b1_N15.ab1 CNM(LMS) spotted knapweed Cen... 48 1.2 1 (BG526396) 61-50 Stevia field grown leaf cDNA Stevia rebaudi... 48 1.2 1 (BG525849) 54-57 Stevia field grown leaf cDNA Stevia rebaudi... 48 1.2 1 (FF294242) 279298058 Pea aphid whole body normalized full le... 38 1.9 2 (DY858583) ApulSEQ9535 Aureobasidium pullulans pBluescript (... 40 1.9 2 (DV308783) NABP778TR Aedes aegypti infected with Brugia Mala... 32 3.3 2 (DB729325) Apis mellifera head cDNA, RIKEN full-length enric... 36 3.3 2 (EA385027) Sequence 33851 from patent US 7314974. 40 3.5 2 (AR318133) Sequence 683 from patent US 6562958. 42 3.9 2 (AC152797) Bos taurus clone CH240-15D10, WORKING DRAFT SEQUE... 40 4.4 7 (AC179155) Strongylocentrotus purpuratus clone R3-4012L9, WO... 42 4.7 7 (AC204908) Macaca mulatta BAC CH250-62F7 (Children's Hospit... 46 4.9 1 (DD010736) Diagnosis of known genetic Parameters within the ... 46 4.9 1 (AX770903) Sequence 34 from Patent WO02094867. 46 4.9 1 (AX344570) Sequence 21 from Patent WO0200932. 46 4.9 1 (FP102448) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.9 1 (CU929480) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.9 1 (CU861606) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.9 1 (CU693403) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.9 1 (CT737419) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.9 1 (CT737406) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.9 1 (EF091955) Maconellicoccus hirsutus clone WHMH3233 putative ... 46 4.9 1 (ER791873) POTLX66TR Solanum tuberosum RHPOTKEY BAC ends Sol... 46 4.9 1 (EH215512) USDA-FP_178304 WHMH (pink hibiscus mealybug) Maco... 46 4.9 1 (EH213494) USDA-FP_176361 WHMH (pink hibiscus mealybug) Maco... 46 4.9 1 (EH212520) USDA-FP_175323 WHMH (pink hibiscus mealybug) Maco... 46 4.9 1 (CT944015) Phaeodactylum tricornutum 5-PRIME EST from clone ... 46 4.9 1 (CN794466) JA001P37P104 MYCELIUM Monacrosporium haptotylum c... 46 4.9 1 (CN762629) ID0AAA4CH07RM1 ApMS Acyrthosiphon pisum cDNA clon... 46 4.9 1 (CN583682) USDA-FP_126747 Acyrthosiphon pisum, Pea Aphid Acy... 46 4.9 1 (CN582525) USDA-FP_125588 Acyrthosiphon pisum, Pea Aphid Acy... 46 4.9 1 (FG772765) G1147P354RO16.T0 Anolis carolinensis pooled norma... 46 4.9 1 (FG772717) G1147P354FO16.T0 Anolis carolinensis pooled norma... 46 4.9 1 (FG611518) stem_S073_G10.SEQ Opium poppy stem cDNA library P... 46 4.9 1 (FG601252) PF_T3_22R_E10_31JUL2003_072 Opium poppy root cDNA... 46 4.9 1 (FG090984) s13dLA25B03RT015_524739 Lupinus albus L. (white l... 46 4.9 1 (FG090250) s13dLA10B04RT041_523095 Lupinus albus L. (white l... 46 4.9 1 (FF319811) 280405043 Pea aphid whole body normalized full le... 46 4.9 1 (FD464178) LARW412TR Haematobia irritans 1st Instar Larvae H... 46 4.9 1 (EX547049) AIAC-aaa77g03.b1 Ancylostoma_caninum_EST_Male_pSM... 46 4.9 1 (CP000789) Vibrio harveyi ATCC BAA-1116 chromosome I, comple... 46 4.9 1 (BX571864) Photorhabdus luminescens subsp. laumondii TTO1 co... 46 4.9 1 (BA000037) Vibrio vulnificus YJ016 DNA, chromosome I, comple... 46 4.9 1 (AM942759) Proteus mirabilis strain HI4320, complete genome. 46 4.9 1 (CT930480) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 4.9 2 (AF177535) Arabidopsis thaliana BAC F26C17. 40 5.6 6 (CU712727) Phaeodactylum tricornutum mRNA 5-prime sequence f... 36 5.8 2 (CT930025) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 6.1 2 (DY875354) AresSEQ2532 Amorphotheca resinae pBluescript (Eco... 34 6.2 3 (CU698499) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 6.2 2 (FC433871) CBAW548.fwd CBAW Physcomitrella patens subsp. pat... 36 6.8 2 (CT882331) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 6.9 2 (CU703228) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 7.4 2 (CT948094) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 7.4 2 (BY991511) Physcomitrella patens subsp. patens cDNA clone: P... 36 7.7 2 (DQ173437) Pichia jadinii malic enzyme mRNA, complete cds. 36 7.7 3 (EE264153) F02_F02gf2o4_pDNRf_505121 Myzus persicae, line G0... 36 7.8 2 (CT919485) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 7.8 2 (EH086097) PMEB562TO Perkinsus marinus large insert cDNA lib... 44 7.9 2 (CT932224) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 7.9 2 (DQ516813) Methanocaldococcus jannaschii spike-in control MJ... 32 8.3 3 (AM427012) Vitis vinifera contig VV78X232521.4, whole genome... 40 8.3 3 (CT935657) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 8.3 2 (CT911620) Phaeodactylum tricornutum 5-PRIME EST from clone ... 36 8.3 2 (CU732760) Phaeodactylum tricornutum mRNA 5-prime sequence f... 42 8.4 2 (CT936509) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 8.4 2 (EK374967) 1095469434697 Global-Ocean-Sampling_GS-31-01-01-1... 38 8.4 2 (AC154949) Bos taurus clone CH240-42J19, WORKING DRAFT SEQUE... 34 8.4 2 (CT928800) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 8.6 2 (CT921505) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 8.7 2 (AC170124) Bos taurus clone CH240-219G6, WORKING DRAFT SEQUE... 34 8.8 2 (CT892587) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 9.1 2 (CT923452) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 9.2 2 (CT944828) Phaeodactylum tricornutum 5-PRIME EST from clone ... 42 9.3 2 (CT938123) Phaeodactylum tricornutum 5-PRIME EST from clone ... 36 9.3 2
>(AY387644) Dictyostelium discoideum malic enzyme gene, complete cds. Length = 3984
Score = 1830 bits (923), Expect(2) = 0.0 Identities = 923/923 (100%) Strand = Plus / Plus
Query: 185 aggtactggttttaataatgaagaaagagaaaaattaggattaaaaggtttattaccacc 244 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2263 aggtactggttttaataatgaagaaagagaaaaattaggattaaaaggtttattaccacc 2322
Query: 245 aaaggttgaatcattacaagaacaatcagatagagcattatcacaatttacatcatttaa 304 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2323 aaaggttgaatcattacaagaacaatcagatagagcattatcacaatttacatcatttaa 2382
Query: 305 tacaaacttggaaagatatattttcttaaattgtttacgtgatcgtaatgaaactttatt 364 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2383 tacaaacttggaaagatatattttcttaaattgtttacgtgatcgtaatgaaactttatt 2442
Query: 365 ctattatttattaagtaataatttagaattaatgatgccaatcatttatacaccaaccgt 424 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2443 ctattatttattaagtaataatttagaattaatgatgccaatcatttatacaccaaccgt 2502
Query: 425 aggtgaagcatgtcaaaagtttggtaatgaattccgtttcgcccaaggtatgtattttgc 484 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2503 aggtgaagcatgtcaaaagtttggtaatgaattccgtttcgcccaaggtatgtattttgc 2562
Query: 485 atcccaagataaaggtaacattcgtgccatgatggacaattggccagccgaaggtgtcga 544 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2563 atcccaagataaaggtaacattcgtgccatgatggacaattggccagccgaaggtgtcga 2622
Query: 545 tattatcgttgtttccgatggttcacgtattttgggtttaggtgatctcggtaccaacgg 604 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2623 tattatcgttgtttccgatggttcacgtattttgggtttaggtgatctcggtaccaacgg 2682
Query: 605 tatgggtatcccagttggtaagttacaattgtacgtcgccggtgctggtttctgtccaac 664 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2683 tatgggtatcccagttggtaagttacaattgtacgtcgccggtgctggtttctgtccaac 2742
Query: 665 ccgtacactcccagtcattatcgatagtggtacaaacaccaagaaatacctcgaagataa 724 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2743 ccgtacactcccagtcattatcgatagtggtacaaacaccaagaaatacctcgaagataa 2802
Query: 725 atattatttaggtgaacgtcatccacgtatcccagactctgaatattacccattggttga 784 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2803 atattatttaggtgaacgtcatccacgtatcccagactctgaatattacccattggttga 2862
Query: 785 tgagttccttgccgccgccttcaacaaatggccaaaggttatcgtccaattcgaagatat 844 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2863 tgagttccttgccgccgccttcaacaaatggccaaaggttatcgtccaattcgaagatat 2922
Query: 845 ctccaacgaccattgcttcaacctcctcgacgaataccgtaacaagtatttatgtttcaa 904 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2923 ctccaacgaccattgcttcaacctcctcgacgaataccgtaacaagtatttatgtttcaa 2982
Query: 905 cgacgatattcaaggtactggtagtgtcatcttgtcaggtttcatcaatgccgtccgttc 964 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2983 cgacgatattcaaggtactggtagtgtcatcttgtcaggtttcatcaatgccgtccgttc 3042
Query: 965 cgttcaaaaaccaatcaaagaacatcgtatggtattcttgggtgctggttccgctggtat 1024 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3043 cgttcaaaaaccaatcaaagaacatcgtatggtattcttgggtgctggttccgctggtat 3102
Query: 1025 tggtgttgccgattgcattatgtccctctttgatgaagctggcgttagcaaagaagaagc 1084 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3103 tggtgttgccgattgcattatgtccctctttgatgaagctggcgttagcaaagaagaagc 3162
Query: 1085 cagaaagagtttctggttcgtcg 1107 ||||||||||||||||||||||| Sbjct: 3163 cagaaagagtttctggttcgtcg 3185
Score = 1441 bits (727), Expect(2) = 0.0 Identities = 727/727 (100%) Strand = Plus / Plus
Query: 1113 taaaggtttaattactaccacccgtggtgacgaattaacctcacaaaagaaacaatacgc 1172 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3190 taaaggtttaattactaccacccgtggtgacgaattaacctcacaaaagaaacaatacgc 3249
Query: 1173 tcgtgaggattacacctaccaattgaaatcattattagaggttgtccgtgacgttaagcc 1232 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3250 tcgtgaggattacacctaccaattgaaatcattattagaggttgtccgtgacgttaagcc 3309
Query: 1233 aaccgctatcattggtttatcaggtatcggtggttcattctctcaagaagtaattgaaga 1292 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3310 aaccgctatcattggtttatcaggtatcggtggttcattctctcaagaagtaattgaaga 3369
Query: 1293 aatggccaaacacgtcgagaaaccaatcgttttcgctctctcaaatccaaccaccaacgc 1352 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3370 aatggccaaacacgtcgagaaaccaatcgttttcgctctctcaaatccaaccaccaacgc 3429
Query: 1353 tgaatgtaccgcagaacaagcttaccaatggaccgatggtcgttgtatctttgcctctgg 1412 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3430 tgaatgtaccgcagaacaagcttaccaatggaccgatggtcgttgtatctttgcctctgg 3489
Query: 1413 ttcaccattcaaaccagtcgaatacaaaggtaaaacctttgttccaggtcaaggtaacaa 1472 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3490 ttcaccattcaaaccagtcgaatacaaaggtaaaacctttgttccaggtcaaggtaacaa 3549
Query: 1473 tatgtacatcttcccaggtcttggtttagccgctagcgtttgtgaagctaaacatgtcac 1532 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3550 tatgtacatcttcccaggtcttggtttagccgctagcgtttgtgaagctaaacatgtcac 3609
Query: 1533 tgatgctatgatcattactgccgctaaaactcttgcctcctttgtagaagactctgaagt 1592 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3610 tgatgctatgatcattactgccgctaaaactcttgcctcctttgtagaagactctgaagt 3669
Query: 1593 tctcactggtaaaatctatccaggtctccaacatattcgtgaaatctcaacaagaatcgc 1652 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3670 tctcactggtaaaatctatccaggtctccaacatattcgtgaaatctcaacaagaatcgc 3729
Query: 1653 cgttaaagtcattgaaaaagcttatgaagaaggtatggctcaattaccacgtccagataa 1712 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3730 cgttaaagtcattgaaaaagcttatgaagaaggtatggctcaattaccacgtccagataa 3789
Query: 1713 tattgaagctttagtcaaatctcgtcaatatgttccatcttatgataaatcaaaaaattg 1772 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3790 tattgaagctttagtcaaatctcgtcaatatgttccatcttatgataaatcaaaaaattg 3849
Query: 1773 actatcttgcccaatttcaccaaatacaaatagattaagtccaaagttataaacttaaat 1832 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3850 actatcttgcccaatttcaccaaatacaaatagattaagtccaaagttataaacttaaat 3909
Query: 1833 aaaattt 1839 ||||||| Sbjct: 3910 aaaattt 3916
Score = 79.8 bits (40), Expect = 3e-10 Identities = 40/40 (100%) Strand = Plus / Plus
Query: 150 ccatcattcattttaagaaacccatcagctaataaaggta 189 |||||||||||||||||||||||||||||||||||||||| Sbjct: 1684 ccatcattcattttaagaaacccatcagctaataaaggta 1723
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 102105510 Number of Hits to DB: 1,815,921,937 Number of extensions: 101629321 Number of successful extensions: 7775971 Number of sequences better than 10.0: 252 Length of query: 1850 Length of database: 101,790,757,118 Length adjustment: 24 Effective length of query: 1826 Effective length of database: 99,340,224,878 Effective search space: 181395250627228 Effective search space used: 181395250627228 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.28 |
Homology vs Protein |
Query= Contig-U16451-1 (Contig-U16451-1Q) /CSM_Contig/Contig-U16451-1Q.Seq.d (1850 letters)
Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AY149910_1(AY149910|pid:none) Mastigamoeba balamuthi malic enzym... 321 e-136 CP001322_605(CP001322|pid:none) Desulfatibacillum alkenivorans A... 304 e-133 CP000581_12(CP000581|pid:none) Ostreococcus lucimarinus CCE9901 ... 299 e-128 AY594688_1(AY594688|pid:none) Hydrilla verticillata NADP-depende... 282 e-127 CR954201_4(CR954201|pid:none) Ostreococcus tauri strain OTTH0595... 287 e-127 AB078329_1(AB078329|pid:none) Lithospermum erythrorhizon LeME mR... 284 e-126 CP001032_3280(CP001032|pid:none) Opitutus terrae PB90-1, complet... 283 e-126 AF288920_1(AF288920|pid:none) Flaveria pringlei putative cytosol... 290 e-125 AB016804_1(AB016804|pid:none) Aloe arborescens mRNA for NADP-mal... 281 e-125 AF288921_1(AF288921|pid:none) Flaveria pringlei putative cytosol... 287 e-125 X80051_1(X80051|pid:none) P.vulgaris PvME1 gene. 285 e-125 AK073858_1(AK073858|pid:none) Oryza sativa Japonica Group cDNA c... 288 e-125 (P36444) RecName: Full=NADP-dependent malic enzyme, chloroplasti... 286 e-125 U67426_1(U67426|pid:none) Vitis vinifera malate dehydrogenase (V... 282 e-125 EU082065_1(EU082065|pid:none) Triticum aestivum NADP-dependent m... 278 e-125 AP009153_2389(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 288 e-125 AF262997_1(AF262997|pid:none) Ricinus communis NADP-dependent ma... 282 e-124 (P34105) RecName: Full=NADP-dependent malic enzyme; Sho... 271 e-124 AF149413_24(AF149413|pid:none) Arabidopsis thaliana BAC T1N24. 285 e-123 (P43279) RecName: Full=NADP-dependent malic enzyme, chloroplasti... 281 e-123 (P12628) RecName: Full=NADP-dependent malic enzyme; Sho... 280 e-123 AF428407_1(AF428407|pid:none) Arabidopsis thaliana AT5g11670/T22... 285 e-123 EF678593_1(EF678593|pid:none) Picea sitchensis clone WS02928_P18... 287 e-123 BA000040_6469(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 285 e-123 D16499_1(D16499|pid:none) Oryza sativa ME6 mRNA for NADP-depende... 281 e-123 S18826(S18826;S26809)malate dehydrogenase (oxaloacetate-decarbox... 271 e-123 BX950216_1(BX950216|pid:none) Zebrafish DNA sequence from clone ... 287 e-123 EF146807_1(EF146807|pid:none) Populus trichocarpa clone WS01214_... 276 e-122 EU007696_1(EU007696|pid:none) Flaveria floridana NADP-malic enzy... 280 e-122 (P37223) RecName: Full=NADP-dependent malic enzyme; Sho... 282 e-122 CP000494_5450(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 290 e-122 BT058893_1(BT058893|pid:none) Salmo salar clone ssal-rgf-511-307... 280 e-122 AB005808_1(AB005808|pid:none) Aloe arborescens mRNA for NADP-mal... 277 e-122 BC171259_1(BC171259|pid:none) Xenopus tropicalis mitochondrial m... 280 e-121 DQ449709_1(DQ449709|pid:none) Leishmania donovani strain MHOM/IN... 306 e-121 DQ449712_1(DQ449712|pid:none) Leishmania donovani strain MHOM/SD... 306 e-121 EU545253_1(EU545253|pid:none) Leishmania infantum strain ITOB/TR... 306 e-121 AY225508_1(AY225508|pid:none) Xenopus laevis mitochondrial malic... 279 e-121 BC123669_1(BC123669|pid:none) Bos taurus malic enzyme 2, NAD(+)-... 288 e-120 AY863144_1(AY863144|pid:none) Flaveria bidentis chloroplast NADP... 275 e-120 AL451013_11(AL451013|pid:none) Neurospora crassa DNA linkage gro... 293 e-120 BT033484_1(BT033484|pid:none) Zea mays full-length cDNA clone ZM... 273 e-120 BC084250_1(BC084250|pid:none) Xenopus laevis malic enzyme 2, mRN... 279 e-120 BC099935_1(BC099935|pid:none) Mus musculus malic enzyme 3, NADP(... 279 e-120 DQ901691_1(DQ901691|pid:none) Tigriopus californicus haplotype S... 296 e-120 AL954747_438(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 293 e-120 DQ449735_1(DQ449735|pid:none) Leishmania gerbilli strain MRHO/CN... 304 e-120 DQ901669_1(DQ901669|pid:none) Tigriopus californicus haplotype S... 295 e-120 FJ495084_1(FJ495084|pid:none) Bos taurus malic enzyme 1 (ME1) mR... 267 e-120 DQ440412_1(DQ440412|pid:none) Aedes aegypti clone AET-5492 malic... 278 e-120 CP001614_1213(CP001614|pid:none) Teredinibacter turnerae T7901, ... 283 e-119 DQ901690_1(DQ901690|pid:none) Tigriopus californicus haplotype S... 296 e-119 DQ901666_1(DQ901666|pid:none) Tigriopus californicus haplotype S... 295 e-119 (P22178) RecName: Full=NADP-dependent malic enzyme, chloroplasti... 273 e-119 EU118588_1(EU118588|pid:none) Ovis aries cytosolic NADP+-depende... 263 e-119 (P16243) RecName: Full=NADP-dependent malic enzyme, chloroplasti... 270 e-119 DQ901654_1(DQ901654|pid:none) Tigriopus californicus haplotype A... 295 e-119 DQ901657_1(DQ901657|pid:none) Tigriopus californicus haplotype A... 295 e-119 (P37222) RecName: Full=NADP-dependent malic enzyme, chloroplasti... 281 e-119 AP008207_2375(AP008207|pid:none) Oryza sativa (japonica cultivar... 274 e-119 (Q29558) RecName: Full=NADP-dependent malic enzyme; Sho... 265 e-119 DQ449736_1(DQ449736|pid:none) Leishmania tropica strain MHOM/SD/... 303 e-119 AB372258_1(AB372258|pid:none) Capsicum chinense mRNA for putativ... 280 e-119 CP000282_659(CP000282|pid:none) Saccharophagus degradans 2-40, c... 291 e-119 DQ901663_1(DQ901663|pid:none) Tigriopus californicus haplotype A... 295 e-119 DQ923118_1(DQ923118|pid:none) Nicotiana tabacum cytosolic NADP-m... 277 e-118 CU640366_1184(CU640366|pid:none) Podospora anserina genomic DNA ... 292 e-118 (Q8BMF3) RecName: Full=NADP-dependent malic enzyme, mitochondria... 274 e-118 AF408406_1(AF408406|pid:none) Meleagris gallopavo malic enzyme m... 276 e-118 EU286807_1(EU286807|pid:none) Umbelopsis isabellina strain CBS 1... 284 e-118 (P23368) RecName: Full=NAD-dependent malic enzyme, mitochondrial... 281 e-118 FJ603315_1(FJ603315|pid:none) Echinochloa crus-galli NADP-malic ... 271 e-118 EU975279_1(EU975279|pid:none) Zea mays clone 486294 NADP-depende... 271 e-117 CP000450_575(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 285 e-116 FJ515745_1(FJ515745|pid:none) Bos taurus cytosolic NADP+-depende... 258 e-116 (P27443) RecName: Full=NAD-dependent malic enzyme, mitochondrial... 264 e-113 (A6T9K7) RecName: Full=NAD-dependent malic enzyme; Shor... 298 e-113 CP000964_2454(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 299 e-113 AP007171_750(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 279 e-113 (Q7N6K4) RecName: Full=NAD-dependent malic enzyme; Shor... 292 e-113 AJ251546_1(AJ251546|pid:none) Drosophila melanogaster mRNA for m... 263 e-113 AK099646_1(AK099646|pid:none) Oryza sativa Japonica Group cDNA c... 253 e-113 CP000783_2895(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 305 e-113 AM942759_635(AM942759|pid:none) Proteus mirabilis strain HI4320,... 293 e-112 AM440750_1(AM440750|pid:none) Vitis vinifera contig VV78X189935.... 241 e-112 (Q6D3B3) RecName: Full=NAD-dependent malic enzyme; Shor... 295 e-112 DQ443377_1(DQ443377|pid:none) Bombyx mori malate dehydrogenase m... 273 e-111 FN357310_7(FN357310|pid:none) Schistosoma mansoni genome sequenc... 260 e-111 AM920428_451(AM920428|pid:none) Penicillium chrysogenum Wisconsi... 281 e-111 FP236842_1357(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 298 e-111 AP009384_119(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 265 e-111 DQ148978_1(DQ148978|pid:none) Drosophila melanogaster isolate dp... 261 e-110 AF187999_1(AF187999|pid:none) Drosophila melanogaster malic enzy... 261 e-110 AF188000_1(AF188000|pid:none) Drosophila melanogaster malic enzy... 261 e-110 CU468135_1295(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 298 e-110 DQ149010_1(DQ149010|pid:none) Drosophila simulans isolate HFL97_... 260 e-110 (A8AGN6) RecName: Full=NAD-dependent malic enzyme; Shor... 297 e-110 (A9MYU8) RecName: Full=NAD-dependent malic enzyme; Shor... 296 e-110 (A4WAJ3) RecName: Full=NAD-dependent malic enzyme; Shor... 291 e-110 AE017220_1567(AE017220|pid:none) Salmonella enterica subsp. ente... 296 e-110 B64901(B64901;S38951) malate dehydrogenase (oxaloacetate-decarbo... 298 e-110 (P26616) RecName: Full=NAD-dependent malic enzyme; Shor... 298 e-110 (Q8XAS9) RecName: Full=NAD-dependent malic enzyme; Shor... 297 e-110 AM933172_1478(AM933172|pid:none) Salmonella enterica subsp. ente... 296 e-110 CP001113_1586(CP001113|pid:none) Salmonella enterica subsp. ente... 296 e-110 (A9MR05) RecName: Full=NAD-dependent malic enzyme; Shor... 296 e-110 CP001654_2414(CP001654|pid:none) Dickeya dadantii Ech703, comple... 288 e-109 AY128396_1(AY128396|pid:none) Arabidopsis thaliana putative mala... 295 e-109 AF058919_11(AF058919|pid:none) Arabidopsis thaliana BAC F6N23. 295 e-109 CP000243_1665(CP000243|pid:none) Escherichia coli UTI89, complet... 297 e-109 CP000804_3440(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 276 e-109 CP000970_1632(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 297 e-109 (Q0T457) RecName: Full=NAD-dependent malic enzyme; Shor... 297 e-109 (A1AB75) RecName: Full=NAD-dependent malic enzyme; Shor... 297 e-109 (A1JTY5) RecName: Full=NAD-dependent malic enzyme; Shor... 291 e-109 CP000038_1543(CP000038|pid:none) Shigella sonnei Ss046, complete... 296 e-109 (Q3Z1M2) RecName: Full=NAD-dependent malic enzyme; Shor... 296 e-109 CP000036_1458(CP000036|pid:none) Shigella boydii Sb227, complete... 296 e-109 (A0KHR8) RecName: Full=NAD-dependent malic enzyme; Shor... 292 e-109 AP008216_992(AP008216|pid:none) Oryza sativa (japonica cultivar-... 288 e-109 (Q6LQM6) RecName: Full=NAD-dependent malic enzyme 1; Sh... 289 e-109 CP000001_1590(CP000001|pid:none) Bacillus cereus E33L, complete ... 274 e-109 CP000686_3615(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 273 e-109 BA000037_1464(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 281 e-109 AE014075_1852(AE014075|pid:none) Escherichia coli CFT073, comple... 297 e-109 (Q8FHH1) RecName: Full=NAD-dependent malic enzyme; Shor... 297 e-109 (Q7MLG3) RecName: Full=NAD-dependent malic enzyme 1; Sh... 281 e-109 DQ973624_1(DQ973624|pid:none) Mortierella alpina malic enzyme pr... 279 e-109 CP001283_1759(CP001283|pid:none) Bacillus cereus AH820, complete... 274 e-109 CP001407_1649(CP001407|pid:none) Bacillus cereus 03BB102, comple... 273 e-108 CP001176_1676(CP001176|pid:none) Bacillus cereus B4264, complete... 272 e-108 CP000485_1494(CP000485|pid:none) Bacillus thuringiensis str. Al ... 273 e-108 AE017194_1861(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 273 e-108 AE016879_1653(AE016879|pid:none) Bacillus anthracis str. Ames, c... 273 e-108 AE017225_1643(AE017225|pid:none) Bacillus anthracis str. Sterne,... 273 e-108 (A4TKN8) RecName: Full=NAD-dependent malic enzyme; Shor... 287 e-108 AK065801_1(AK065801|pid:none) Oryza sativa Japonica Group cDNA c... 285 e-107 AL161472_13(AL161472|pid:none) Arabidopsis thaliana DNA chromoso... 288 e-107 (A8GC31) RecName: Full=NAD-dependent malic enzyme; Shor... 291 e-107 (A7N025) RecName: Full=NAD-dependent malic enzyme; Shor... 283 e-107 AE016877_1607(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 273 e-107 (Q6LHK5) RecName: Full=NAD-dependent malic enzyme 2; Sh... 295 e-107 AM746676_9132(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 258 e-107 CP001172_3310(CP001172|pid:none) Acinetobacter baumannii AB307-0... 291 e-107 CP000521_136(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 291 e-107 FM954972_1109(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 279 e-107 AE008692_1955(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 290 e-107 (Q0HFA9) RecName: Full=NAD-dependent malic enzyme; Shor... 285 e-106 BT064127_1(BT064127|pid:none) Zea mays full-length cDNA clone ZM... 284 e-106 AC010793_18(AC010793|pid:none) Genomic sequence for Arabidopsis ... 217 e-106 BT085419_1(BT085419|pid:none) Zea mays full-length cDNA clone ZM... 276 e-106 (Q12RA0) RecName: Full=NAD-dependent malic enzyme; Shor... 283 e-105 (P78715) RecName: Full=Malic enzyme, hydrogenosomal; Sh... 276 e-105 (A1S8W7) RecName: Full=NAD-dependent malic enzyme; Shor... 287 e-105 (Q8EAP2) RecName: Full=NAD-dependent malic enzyme; Shor... 285 e-105 CR378669_184(CR378669|pid:none) Photobacterium profundum SS9; se... 276 e-105 CP001574_363(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 275 e-105 DQ674276_1(DQ674276|pid:none) Acetobacter aceti strain 1023 mali... 251 e-105 AC148817_10(AC148817|pid:none) Medicago truncatula chromosome 7 ... 282 e-105 (Q02QW0) RecName: Full=NAD-dependent malic enzyme; Shor... 274 e-104 (Q9HYD5) RecName: Full=NAD-dependent malic enzyme; Shor... 274 e-104 (Q086X9) RecName: Full=NAD-dependent malic enzyme; Shor... 277 e-104 FM209186_1542(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 274 e-104 (A6V1V5) RecName: Full=NAD-dependent malic enzyme; Shor... 271 e-104 (A8FZ49) RecName: Full=NAD-dependent malic enzyme; Shor... 283 e-104 (B0TRQ2) RecName: Full=NAD-dependent malic enzyme; Shor... 282 e-104 (Q1QC40) RecName: Full=NAD-dependent malic enzyme; Shor... 281 e-104 CR954246_1524(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 280 e-103 (Q7MJC0) RecName: Full=NAD-dependent malic enzyme 2; Sh... 286 e-103 (Q4FRX3) RecName: Full=NAD-dependent malic enzyme; Shor... 280 e-103 (Q87Y79) RecName: Full=NAD-dependent malic enzyme; Shor... 267 e-103 CP000075_1560(CP000075|pid:none) Pseudomonas syringae pv. syring... 267 e-102 CP000058_1485(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 267 e-102 (Q4ZW63) RecName: Full=NAD-dependent malic enzyme; Shor... 267 e-102 (Q6MJE4) RecName: Full=NAD-dependent malic enzyme; Shor... 272 e-102 CP000394_2016(CP000394|pid:none) Granulibacter bethesdensis CGDN... 265 e-102 CR628337_2915(CR628337|pid:none) Legionella pneumophila str. Len... 276 e-102 AE017354_2909(AE017354|pid:none) Legionella pneumophila subsp. p... 275 e-102 AE017333_3009(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 256 e-101 CP000002_3010(CP000002|pid:none) Bacillus licheniformis ATCC 145... 256 e-101 CP000285_2943(CP000285|pid:none) Chromohalobacter salexigens DSM... 278 e-101 EF677094_1(EF677094|pid:none) Picea sitchensis clone WS02761_K05... 270 e-100 AE016828_714(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 255 e-100 CP001019_1053(CP001019|pid:none) Coxiella burnetii CbuG_Q212, co... 253 3e-99 AC078840_14(AC078840|pid:none) Oryza sativa chromosome 10 BAC OS... 288 4e-99 AK317669_1(AK317669|pid:none) Arabidopsis thaliana AT5G11670 mRN... 206 4e-99 CP001020_617(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 252 8e-99 (O34389) RecName: Full=Probable NAD-dependent malic enzyme 3; ... 246 8e-99 CP000560_2609(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 253 1e-98 BC000147_1(BC000147|pid:none) Homo sapiens malic enzyme 2, NAD(+... 281 1e-98 CP000733_814(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1... 251 1e-98 CP000675_1365(CP000675|pid:none) Legionella pneumophila str. Cor... 269 3e-98 AE017354_1255(AE017354|pid:none) Legionella pneumophila subsp. p... 269 3e-98 AE013599_2403(AE013599|pid:none) Drosophila melanogaster chromos... 241 7e-98 EF591885_3(EF591885|pid:none) Uncultured planctomycete 6N14 clon... 258 9e-98 AE017356_102(AE017356|pid:none) Cryptococcus neoformans var. neo... 239 2e-97 CR628336_1246(CR628336|pid:none) Legionella pneumophila str. Par... 269 3e-97 CR628337_1252(CR628337|pid:none) Legionella pneumophila str. Len... 265 7e-97 AE001825_268(AE001825|pid:none) Deinococcus radiodurans R1 chrom... 251 4e-96 CP000462_2979(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 248 1e-95 AE013599_2405(AE013599|pid:none) Drosophila melanogaster chromos... 241 2e-95 CP000359_2139(CP000359|pid:none) Deinococcus geothermalis DSM 11... 245 5e-95 AE017282_1733(AE017282|pid:none) Methylococcus capsulatus str. B... 254 1e-94 CU633438_44(CU633438|pid:none) Podospora anserina genomic DNA ch... 232 3e-93 AE013599_2400(AE013599|pid:none) Drosophila melanogaster chromos... 240 2e-92 U59300_2(U59300|pid:none) Giardia intestinalis centrin and malic... 238 9e-92 FN317253_1(FN317253|pid:none) Schistosoma japonicum isolate Anhu... 221 1e-91 AM263198_1934(AM263198|pid:none) Listeria welshimeri serovar 6b ... 230 3e-91 A97096(A97096) malic enzyme [imported] - Clostridium acetobutyli... 224 3e-91 AE001437_1576(AE001437|pid:none) Clostridium acetobutylicum ATCC... 224 4e-91 CR954204_376(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 217 7e-91 AE013599_2401(AE013599|pid:none) Drosophila melanogaster chromos... 240 1e-90 CP000586_370(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 217 1e-90 AY089254_1(AY089254|pid:none) Drosophila melanogaster AT04275 fu... 234 2e-90 AE013599_2402(AE013599|pid:none) Drosophila melanogaster chromos... 240 5e-90 CP001330_213(CP001330|pid:none) Micromonas sp. RCC299 chromosome... 206 1e-89 CP000233_1297(CP000233|pid:none) Lactobacillus salivarius UCC118... 247 5e-89 CP000416_2076(CP000416|pid:none) Lactobacillus brevis ATCC 367, ... 236 9e-89 AP007169_519(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 209 3e-88 X55956_2(X55956|pid:none) E.coli sbcA8, a translational fusion (... 298 1e-87 X55956_3(X55956|pid:none) E.coli sbcA8, a translational fusion (... 298 1e-87 CP000033_1010(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 221 1e-87 AC1314(AC1314) malolactic enzyme (malate dehydrogenase) homolog ... 223 2e-87 FN357335_42(FN357335|pid:none) Schistosoma mansoni genome sequen... 204 2e-87 AB235206_2(AB235206|pid:none) Oenococcus oeni mleR, mleA, mleP g... 225 4e-87 CP000725_368(CP000725|pid:none) Streptococcus gordonii str. Chal... 212 6e-87 FM177140_797(FM177140|pid:none) Lactobacillus casei BL23 complet... 221 8e-87 AY450551_1(AY450551|pid:none) Pediococcus damnosus strain NCFB18... 233 1e-86 AC1686(AC1686) malolactic enzyme (malate dehydrogenase) homolog ... 226 1e-86 DQ667004_1(DQ667004|pid:none) Oenococcus oeni strain 6057 malola... 222 1e-86 AM406671_1603(AM406671|pid:none) Lactococcus lactis subsp. cremo... 212 1e-86 L36647_1(L36647|pid:none) Lycopersicon esculentum malic enzyme m... 173 2e-86 CP000584_347(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 205 2e-86 AY786176_1(AY786176|pid:none) Oenococcus oeni malolactic enzyme ... 222 3e-86 CP000423_711(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 219 4e-86 AB235205_2(AB235205|pid:none) Oenococcus oeni mleR, mleA, mleP g... 222 4e-86 (Q48796) RecName: Full=Malolactic enzyme; EC=1.-.-.-; ... 222 4e-86 BX571856_805(BX571856|pid:none) Staphylococcus aureus subsp. aur... 224 5e-86 (Q48662) RecName: Full=Malolactic enzyme; EC=1.-.-.-; ... 212 5e-86 CP000387_284(CP000387|pid:none) Streptococcus sanguinis SK36, co... 209 2e-85 AB235203_2(AB235203|pid:none) Oenococcus oeni mleR, mleA, mleP g... 220 4e-85 DQ667005_1(DQ667005|pid:none) Lactococcus lactis subsp. lactis s... 207 6e-85 CP000414_934(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 226 2e-84 AP007281_1441(AP007281|pid:none) Lactobacillus reuteri JCM 1112 ... 214 2e-84 A58266_1(A58266|pid:none) Sequence 5 from Patent WO9636715. &S3... 208 2e-84 CR954206_400(CR954206|pid:none) Ostreococcus tauri strain OTTH05... 206 3e-84 AB235202_2(AB235202|pid:none) Oenococcus oeni mleR, mleA, mleP g... 217 3e-84 X55956_4(X55956|pid:none) E.coli sbcA8, a translational fusion (... 286 3e-84 DQ233703_1(DQ233703|pid:none) Lactobacillus reuteri malic enzyme... 219 4e-84 S69778(S69778;S69777) adhesin AP65-1 precursor - Trichomonas vag... 230 5e-84 CR936503_442(CR936503|pid:none) Lactobacillus sakei strain 23K c... 212 2e-83 CU928174_75(CU928174|pid:none) Zygosaccharomyces rouxii strain C... 218 4e-83 CP000937_389(CP000937|pid:none) Francisella philomiragia subsp. ... 238 4e-83 A41469_1(A41469|pid:none) Sequence 1 from Patent WO9426879. 204 4e-83 AE017346_374(AE017346|pid:none) Cryptococcus neoformans var. neo... 212 5e-83 U16837_1(U16837|pid:none) Trichomonas vaginalis hydrogenosomal m... 228 9e-83 AK301875_1(AK301875|pid:none) Homo sapiens cDNA FLJ57648 complet... 181 2e-82 AJ749949_917(AJ749949|pid:none) Francisella tularensis subsp. tu... 234 2e-82 AM233362_438(AM233362|pid:none) Francisella tularensis subsp. ho... 234 3e-82 CP000608_1024(CP000608|pid:none) Francisella tularensis subsp. t... 234 3e-82 (P36013) RecName: Full=NAD-dependent malic enzyme, mitochondrial... 218 3e-82 CR382131_762(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 216 4e-82 EU598457_1(EU598457|pid:none) Cairina moschata NADP-dependent ma... 233 7e-82 E70705(E70705)probable malate oxidoreductase - Mycobacterium tub... 219 1e-81 (P71880) RecName: Full=Putative malate oxidoreductase [NAD]; ... 219 1e-81 CP000915_403(CP000915|pid:none) Francisella tularensis subsp. me... 232 2e-81 CP000854_3588(CP000854|pid:none) Mycobacterium marinum M, comple... 223 2e-81 CP000325_1212(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 223 3e-81 S69779(S69779;S69776) adhesin AP65-2 precursor - Trichomonas vag... 224 5e-81 A58264_1(A58264|pid:none) Sequence 3 from Patent WO9636715. &X7... 195 6e-81 (P40375) RecName: Full=NAD-dependent malic enzyme; Shor... 208 8e-81 CP000499_158(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 218 4e-80 CR382138_523(CR382138|pid:none) Debaryomyces hansenii strain CBS... 208 4e-80 AP003229_12(AP003229|pid:none) Oryza sativa Japonica Group genom... 180 4e-80 CP001087_1359(CP001087|pid:none) Desulfobacterium autotrophicum ... 212 3e-79 FN357335_43(FN357335|pid:none) Schistosoma mansoni genome sequen... 176 3e-79 CP000462_1202(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 214 3e-78 CP001575_122(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 198 1e-77 CU234118_5030(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 287 8e-76 (A6WSH0) RecName: Full=NAD-dependent malic enzyme; Shor... 287 1e-75 (A1RNF8) RecName: Full=NAD-dependent malic enzyme; Shor... 286 2e-75 BC011081_1(BC011081|pid:none) Mus musculus malic enzyme 1, NADP(... 280 1e-73 (P06801) RecName: Full=NADP-dependent malic enzyme; Sho... 280 1e-73 M26594_1(M26594|pid:none) Rattus norvegicus malic enzyme (MAL) g... 280 1e-73 (P13697) RecName: Full=NADP-dependent malic enzyme; Sho... 280 1e-73 (Q99KE1) RecName: Full=NAD-dependent malic enzyme, mitochondrial... 279 3e-73 BC119945_1(BC119945|pid:none) Bos taurus malic enzyme 3, NADP(+)... 276 1e-72 (A1SSC6) RecName: Full=NAD-dependent malic enzyme; Shor... 276 1e-72 AY056819_1(AY056819|pid:none) Flaveria brownii NADP-dependent ma... 183 3e-72 JC4160(JC4160)malate dehydrogenase (oxaloacetate-decarboxylating... 274 9e-72 (P48163) RecName: Full=NADP-dependent malic enzyme; Sho... 274 9e-72 L34035_1(L34035|pid:none) Homo sapiens NADP-dependent malic enzy... 274 9e-72 AB170878_1(AB170878|pid:none) Macaca fascicularis brain cDNA clo... 273 1e-71 AK163403_1(AK163403|pid:none) Mus musculus 2 cells egg cDNA, RIK... 272 3e-71 BT084809_1(BT084809|pid:none) Zea mays full-length cDNA clone ZM... 271 5e-71 BC003287_1(BC003287|pid:none) Mus musculus malic enzyme 1, NADP(... 271 6e-71 CP000002_3768(CP000002|pid:none) Bacillus licheniformis ATCC 145... 268 7e-70 AE017333_3776(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 268 7e-70 CP000560_3302(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 266 3e-69 CP001472_2603(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 253 1e-65 AB220529_1(AB220529|pid:none) Macaca fascicularis mRNA, clone Qn... 246 2e-63 CP000510_1657(CP000510|pid:none) Psychromonas ingrahamii 37, com... 246 2e-63 BT034201_1(BT034201|pid:none) Zea mays full-length cDNA clone ZM... 244 8e-63 CP000813_2593(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 241 9e-62 DQ901653_1(DQ901653|pid:none) Tigriopus californicus ME1 mRNA, p... 240 1e-61 AE013599_2407(AE013599|pid:none) Drosophila melanogaster chromos... 146 4e-61 AK300974_1(AK300974|pid:none) Homo sapiens cDNA FLJ58694 complet... 233 2e-59 AF054868_6(AF054868|pid:none) Pseudomonas aeruginosa autoinducer... 221 5e-56 CR380958_76(CR380958|pid:none) Candida glabrata strain CBS138 ch... 217 1e-54 AK092181_1(AK092181|pid:none) Homo sapiens cDNA FLJ34862 fis, cl... 216 2e-54 CP000644_1123(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 213 1e-53 AK163278_1(AK163278|pid:none) Mus musculus 2 cells egg cDNA, RIK... 211 6e-53 CP000587_104(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 203 2e-50 CP000473_2922(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 199 4e-49 AF260732_1(AF260732|pid:none) Cucurbita pepo NAD-dependent malic... 191 1e-46 EF146002_1(EF146002|pid:none) Populus trichocarpa clone WS0114_N... 189 2e-46 AF097666_1(AF097666|pid:none) Mesembryanthemum crystallinum mala... 184 1e-44 EF523435_1(EF523435|pid:none) Eriobotrya japonica NADP-malic enz... 152 1e-44 FJ411290_1(FJ411290|pid:none) Camellia sinensis NADP-dependent m... 151 3e-43 BC017403_1(BC017403|pid:none) Homo sapiens, clone IMAGE:4290619,... 179 4e-43 BC091911_1(BC091911|pid:none) Danio rerio im:7151680, mRNA (cDNA... 176 3e-42 AK006146_1(AK006146|pid:none) Mus musculus adult male testis cDN... 175 6e-42 M59416_1(M59416|pid:none) Flaveria trinervia NADP-malic enzyme m... 174 1e-41 AK317577_1(AK317577|pid:none) Arabidopsis thaliana AT5G11670 mRN... 174 1e-41 DQ889593_1(DQ889593|pid:none) Arachis hypogaea clone 1W15 NADP-d... 172 3e-41 AM484013_1(AM484013|pid:none) Vitis vinifera contig VV78X063016.... 171 8e-41 EF576359_1(EF576359|pid:none) Oryza sativa (indica cultivar-grou... 170 2e-40 BT037275_1(BT037275|pid:none) Zea mays full-length cDNA clone ZM... 164 1e-38 EF576520_1(EF576520|pid:none) Oryza sativa (indica cultivar-grou... 160 1e-37 U16838_1(U16838|pid:none) Trichomonas vaginalis hydrogenosomal m... 160 2e-37 DQ901649_1(DQ901649|pid:none) Tigriopus californicus haplotype S... 158 7e-37 DQ901647_1(DQ901647|pid:none) Tigriopus californicus haplotype S... 154 1e-35 AY179511_1(AY179511|pid:none) Aloe vera NADP-malic enzyme mRNA, ... 153 2e-35 EF576449_1(EF576449|pid:none) Oryza sativa (indica cultivar-grou... 153 2e-35 DQ901635_1(DQ901635|pid:none) Tigriopus californicus haplotype S... 152 3e-35 AB061256_1(AB061256|pid:none) Solanum tuberosum mRNA for NADP-de... 152 3e-35 DQ901633_1(DQ901633|pid:none) Tigriopus californicus haplotype S... 152 4e-35 DQ901651_1(DQ901651|pid:none) Tigriopus californicus haplotype S... 149 4e-34 AY812176_1(AY812176|pid:none) Schistosoma japonicum SJCHGC04602 ... 148 8e-34 I55278(I55278) hypothetical malate dehydrogenase (oxaloacetate-... 147 2e-33 AJ404642_1(AJ404642|pid:none) Cicer arietinum partial ORF for NA... 129 7e-33 AF098783_1(AF098783|pid:none) Lactobacillus plantarum malolactic... 144 1e-32 AF098781_1(AF098781|pid:none) Lactobacillus hilgardii malolactic... 142 3e-32 DQ901639_1(DQ901639|pid:none) Tigriopus californicus haplotype A... 141 7e-32 AF098779_1(AF098779|pid:none) Lactobacillus fructivorans malolac... 140 2e-31 L35306_1(L35306|pid:none) Lycopersicon esculentum malate dehydro... 135 5e-30 AF098782_1(AF098782|pid:none) Leuconostoc mesenteroides subsp. m... 134 9e-30 AK068078_1(AK068078|pid:none) Oryza sativa Japonica Group cDNA c... 133 3e-29 AP008208_2085(AP008208|pid:none) Oryza sativa (japonica cultivar... 132 4e-29 DQ399705_1(DQ399705|pid:none) Hydrilla verticillata NADP-depende... 129 4e-28 AC084023_1(AC084023|pid:none) Oryza sativa (japonica cultivar-gr... 125 4e-27 AF098784_1(AF098784|pid:none) Pediococcus parvulus malolactic en... 122 6e-26 EU331268_1(EU331268|pid:none) Pediococcus parvulus strain CBS203... 120 2e-25 EU331325_1(EU331325|pid:none) Pediococcus damnosus strain CBS203... 119 5e-25 AF098785_1(AF098785|pid:none) Pediococcus acidilactici malolacti... 113 2e-23 AF098461_1(AF098461|pid:none) Lactobacillus salivarius subsp. sa... 109 3e-22 AY185353_1(AY185353|pid:none) Brassica rapa subsp. pekinensis ma... 106 3e-21 CP001287_2784(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 65 3e-19 CP000117_2447(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 60 6e-19 AJ619675_1(AJ619675|pid:none) Oenococcus oeni partial mleA gene ... 98 9e-19 AJ619674_1(AJ619674|pid:none) Oenococcus oeni partial mleA gene ... 96 4e-18 CP000029_1238(CP000029|pid:none) Staphylococcus epidermidis RP62... 65 6e-18 CP000557_1368(CP000557|pid:none) Geobacillus thermodenitrificans... 70 2e-17 CP001638_1705(CP001638|pid:none) Geobacillus sp. WCH70, complete... 69 7e-17 CP000141_1329(CP000141|pid:none) Carboxydothermus hydrogenoforma... 58 1e-16 CP000951_438(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 59 9e-16 AF117715_1(AF117715|pid:none) Legionella pneumophila NAD-malate ... 87 2e-15 CP000924_333(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 57 2e-15 CP000312_1138(CP000312|pid:none) Clostridium perfringens SM101, ... 55 4e-15 AM422018_768(AM422018|pid:none) Candidatus Phytoplasma australie... 61 2e-14 BA000001_1313(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 81 1e-13 CP000509_1690(CP000509|pid:none) Nocardioides sp. JS614, complet... 59 2e-13 AM260479_992(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 52 3e-13 CP001100_2637(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 54 5e-13 CP000854_4134(CP000854|pid:none) Mycobacterium marinum M, comple... 56 9e-13 CR555306_2491(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 54 1e-12 (P43837) RecName: Full=NADP-dependent malic enzyme; Sho... 54 4e-12 CP000671_706(CP000671|pid:none) Haemophilus influenzae PittEE, c... 54 4e-12 CP000713_1256(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 52 7e-12 CP000544_1010(CP000544|pid:none) Halorhodospira halophila SL1, c... 56 7e-12 CP000057_1674(CP000057|pid:none) Haemophilus influenzae 86-028NP... 54 7e-12 CP000031_12(CP000031|pid:none) Ruegeria pomeroyi DSS-3, complete... 54 9e-12 AM412317_208(AM412317|pid:none) Clostridium botulinum A str. ATC... 75 1e-11 CP000099_2942(CP000099|pid:none) Methanosarcina barkeri str. Fus... 59 2e-11 CP000083_315(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 51 2e-11 AY714849_23(AY714849|pid:none) Uncultured archaeon GZfos28B8 clo... 74 2e-11 CP000453_242(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 57 2e-11 CP000792_1633(CP000792|pid:none) Campylobacter concisus 13826, c... 50 3e-11 AJ248285_220(AJ248285|pid:none) Pyrococcus abyssi complete genom... 73 3e-11 CU695239_218(CU695239|pid:none) Ralstonia solanacearum strain Mo... 49 3e-11 CP001124_1310(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 61 4e-11 AM489271_1(AM489271|pid:none) Vitis vinifera contig VV78X162364.... 72 5e-11 CP000382_1151(CP000382|pid:none) Clostridium novyi NT, complete ... 72 5e-11 AE004439_2(AE004439|pid:none) Pasteurella multocida subsp. multo... 52 7e-11 AF234166_1(AF234166|pid:none) Entamoeba histolytica malic enzyme... 71 1e-10 AM181328_1(AM181328|pid:none) Oenococcus oeni mae gene for putat... 71 1e-10 CP000323_994(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 50 1e-10 AB195292_1(AB195292|pid:none) Thermococcus kodakarensis KOD1 Tk-... 71 2e-10 CP001083_209(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 71 2e-10 AM295250_1297(AM295250|pid:none) Staphylococcus carnosus subsp. ... 71 2e-10 CP000082_1367(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 50 2e-10 AM490488_1(AM490488|pid:none) Herbaspirillum seropedicae maeB ge... 54 2e-10 CP001644_1908(CP001644|pid:none) Ralstonia pickettii 12D chromos... 47 2e-10 CP000521_2583(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 57 2e-10 CU468230_1114(CU468230|pid:none) Acinetobacter baumannii str. SD... 57 2e-10 CP001103_3494(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 48 2e-10 CP000939_262(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 70 3e-10 CP000962_203(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 70 3e-10 CP000728_246(CP000728|pid:none) Clostridium botulinum F str. Lan... 70 3e-10 CR936257_883(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 46 3e-10 CP000569_482(CP000569|pid:none) Actinobacillus pleuropneumoniae ... 49 3e-10 AP009493_2236(AP009493|pid:none) Streptomyces griseus subsp. gri... 48 3e-10 AE008923_3421(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 47 4e-10 CP000478_2751(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 56 4e-10 CP001091_564(CP001091|pid:none) Actinobacillus pleuropneumoniae ... 48 5e-10 AP008229_1015(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 47 6e-10 CP000789_50(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chro... 49 6e-10 AE017143_1058(AE017143|pid:none) Haemophilus ducreyi strain 3500... 49 6e-10 CP000947_747(CP000947|pid:none) Haemophilus somnus 2336, complet... 54 7e-10 CP001056_3446(CP001056|pid:none) Clostridium botulinum B str. Ek... 69 8e-10 CP000087_869(CP000087|pid:none) Rickettsia bellii RML369-C, comp... 49 1e-09 AP006840_1319(AP006840|pid:none) Symbiobacterium thermophilum IA... 68 1e-09 CP000487_1483(CP000487|pid:none) Campylobacter fetus subsp. fetu... 50 1e-09 CP000721_4991(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 68 1e-09 BA000031_2767(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 47 2e-09 CP001078_3231(CP001078|pid:none) Clostridium botulinum E3 str. A... 67 2e-09 CP001025_550(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 47 2e-09 AE008922_3296(AE008922|pid:none) Xanthomonas campestris pv. camp... 46 2e-09 AM490512_1(AM490512|pid:none) Herbaspirillum seropedicae HS256.0... 45 2e-09 BA000011_781(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 67 2e-09 AP007255_720(AP007255|pid:none) Magnetospirillum magneticum AMB-... 47 3e-09 AM167904_1195(AM167904|pid:none) Bordetella avium 197N complete ... 49 3e-09 CP000089_663(CP000089|pid:none) Dechloromonas aromatica RCB, com... 48 3e-09 CP001638_1270(CP001638|pid:none) Geobacillus sp. WCH70, complete... 67 3e-09 CP000557_1284(CP000557|pid:none) Geobacillus thermodenitrificans... 66 4e-09 CP000151_531(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 48 5e-09 CP000884_6011(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 49 5e-09 CP001392_3402(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 44 5e-09 CP000386_1095(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 66 5e-09 AE017226_2428(AE017226|pid:none) Treponema denticola ATCC 35405,... 66 5e-09 BX571965_2986(BX571965|pid:none) Burkholderia pseudomallei strai... 49 6e-09 CP000539_3952(CP000539|pid:none) Acidovorax sp. JS42, complete g... 44 6e-09 AP006725_3669(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 51 6e-09 CP000139_237(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 47 6e-09 (P16468) RecName: Full=NAD-dependent malic enzyme; Shor... 65 6e-09 AP006841_3599(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 47 8e-09 CP001503_219(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 54 8e-09 CP000112_3629(CP000112|pid:none) Desulfovibrio desulfuricans G20... 45 8e-09 CP000746_660(CP000746|pid:none) Actinobacillus succinogenes 130Z... 48 8e-09 CP001230_1652(CP001230|pid:none) Persephonella marina EX-H1, com... 46 8e-09 CP001399_2407(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 65 8e-09 CP001400_2272(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 65 8e-09 CP001402_2404(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 65 8e-09 A90465(A90465) hypothetical protein SSO2869 [imported] - Sulfolo... 65 8e-09 CP000061_51(CP000061|pid:none) Aster yellows witches'-broom phyt... 65 8e-09 CP000943_1179(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 45 1e-08 CP000140_1685(CP000140|pid:none) Parabacteroides distasonis ATCC... 47 1e-08 CP000879_922(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 64 1e-08 CP000771_463(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 64 1e-08 AE017261_957(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 64 1e-08 CP000614_589(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 47 2e-08 AP009385_474(AP009385|pid:none) Burkholderia multivorans ATCC 17... 47 2e-08 AE017196_436(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 50 2e-08 CP000025_1436(CP000025|pid:none) Campylobacter jejuni RM1221, co... 45 2e-08 AL111168_1220(AL111168|pid:none) Campylobacter jejuni subsp. jej... 45 2e-08 CP000829_811(CP000829|pid:none) Streptococcus pyogenes NZ131, co... 64 2e-08 CP000003_831(CP000003|pid:none) Streptococcus pyogenes MGAS10394... 64 2e-08 CP000922_2020(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 64 2e-08 AE014074_771(AE014074|pid:none) Streptococcus pyogenes MGAS315, ... 64 2e-08 AM902716_1836(AM902716|pid:none) Bordetella petrii strain DSM 12... 45 2e-08 AP008955_1378(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 64 2e-08 AE016830_1119(AE016830|pid:none) Enterococcus faecalis V583, com... 64 2e-08 CP000010_2162(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 47 3e-08 CP001600_1179(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 51 3e-08 AE017321_670(AE017321|pid:none) Wolbachia endosymbiont strain TR... 49 3e-08 CR954246_2659(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 42 3e-08 AP009351_1602(AP009351|pid:none) Staphylococcus aureus subsp. au... 63 3e-08 AE002098_643(AE002098|pid:none) Neisseria meningitidis MC58, com... 51 4e-08 AP010935_819(AP010935|pid:none) Streptococcus dysgalactiae subsp... 63 4e-08 CU466930_1632(CU466930|pid:none) Candidatus Cloacamonas acidamin... 63 4e-08 AP008230_1923(AP008230|pid:none) Desulfitobacterium hafniense Y5... 63 4e-08 AP009049_2124(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 63 4e-08 CP000964_1315(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 51 5e-08 CP001391_208(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 49 5e-08 CP000768_353(CP000768|pid:none) Campylobacter jejuni subsp. doyl... 45 5e-08 U35659_1(U35659|pid:none) Streptococcus bovis malic enzyme gene,... 62 5e-08 AJ938182_1560(AJ938182|pid:none) Staphylococcus aureus RF122 com... 62 5e-08 AP008231_256(AP008231|pid:none) Synechococcus elongatus PCC 6301... 62 5e-08 AF545470_1(AF545470|pid:none) Trichomonas vaginalis malic enzyme... 62 5e-08 CP000922_495(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 62 5e-08 AM421808_587(AM421808|pid:none) Neisseria meningitidis serogroup... 51 6e-08 CP000381_591(CP000381|pid:none) Neisseria meningitidis 053442, c... 51 6e-08 AM884392_1(AM884392|pid:none) Thermoproteus tenax mae gene for m... 62 7e-08 CP000086_1176(CP000086|pid:none) Burkholderia thailandensis E264... 49 8e-08 CP000053_584(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 50 8e-08 AE004969_220(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, c... 50 8e-08 CP001186_493(CP001186|pid:none) Bacillus cereus G9842, complete ... 62 9e-08 CP000473_4482(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 47 1e-07 CP001654_3157(CP001654|pid:none) Dickeya dadantii Ech703, comple... 52 1e-07 CP000932_1242(CP000932|pid:none) Campylobacter lari RM2100, comp... 46 1e-07
>AY149910_1(AY149910|pid:none) Mastigamoeba balamuthi malic enzyme gene, complete cds. Length = 568
Score = 321 bits (822), Expect(2) = e-136 Identities = 161/316 (50%), Positives = 220/316 (69%), Gaps = 1/316 (0%) Frame = +3
Query: 150 PSFILRNPSANKGTGFNNEEREXXXXXXXXXXXVESLQEQSDRALSQFTSFNTNLERYIF 329 PS++ P+ GT F EER+ VE+++ Q+ RA +Q TS T L +Y++ Sbjct: 38 PSWLTLAPT---GTAFTTEERKALRIRGLLPHAVETIEAQAARAYAQLTSQPTPLLKYLY 94
Query: 330 LNCLRDRNETLFYYLLSNNLELMMPIIYTPTVGEACQKFGNEFRFAQGMYFASQDKGNIR 509 L+ L RN+TLF+YL+ +++E +P++YTPTVGE C KF EFR G+Y +DKG++ Sbjct: 95 LSQLSQRNQTLFFYLVQHHVEECVPLVYTPTVGEGCTKFSAEFRNPTGLYITPEDKGHVA 154
Query: 510 AMMDNWPAEGVDIIVVSDGSRILGLGDLGTNGMGIPVGKLQLYVAGAGFCPTRTLPVIID 689 +++NWP E V+IIVV+DG RILGLGDLG+NGMGIP+GKL LY+A AGF P RTLPV+ID Sbjct: 155 EILENWPHE-VEIIVVTDGGRILGLGDLGSNGMGIPIGKLHLYIACAGFRPDRTLPVMID 213
Query: 690 SGTNTKKYLEDKYYLGERHPRIPDSEYYPLVDEFLAAAFNKWPKVIVQFEDISNDHCFNL 869 GTN ++ L+D YLG R R+ D+EY+ L++EF+ A KWP+ +VQFED N CF L Sbjct: 214 VGTNRQELLDDPMYLGVRKARLGDAEYFALLEEFMTAVRAKWPRCLVQFEDFPNPRCFQL 273
Query: 870 LDEYRNKYLCFNDDIQGTGSVILSGFINAVRSVQKPIKEHRMVFLGAGSAGIGVADCIMS 1049 LD + + CFNDDIQGTG+VIL+G INAVR+ P+ +HR +FLGAGSA GVA I Sbjct: 274 LDTWFGRQFCFNDDIQGTGAVILAGVINAVRATGVPVADHRFMFLGAGSAATGVAGMIAK 333
Query: 1050 -LFDEAGVSKEEARKS 1094 + E V+ E+AR++ Sbjct: 334 WIATETHVAIEQARRA 349
Score = 190 bits (483), Expect(2) = e-136 Identities = 99/215 (46%), Positives = 140/215 (65%), Gaps = 1/215 (0%) Frame = +1
Query: 1114 KGLITTTRGDELTSQKKQYAREDYTYQLKSLLEVVRDVKPTAXXXXXXXXXXXXQEVIEE 1293 +G + +R +L + YA + + + L+ +R VKPTA + V+EE Sbjct: 356 EGFVVKSRVAKLPAHLVPYAAD--APECPTFLDAIRHVKPTAIIGLSGAGRLFTKPVVEE 413
Query: 1294 MAKHVEKPIVFALSNPTTNAECTAEQAYQWTDGRCIFASGSPFKPVEYKGKTFVPGQGNN 1473 +A ++PIVFALSNPT+ AEC AE AY W+DGR IFASGSPF VEYKG+T+ PGQGNN Sbjct: 414 VAALNKRPIVFALSNPTSKAECVAEDAYTWSDGRAIFASGSPFPNVEYKGRTYTPGQGNN 473
Query: 1474 MYIFPGLGLAASVCEAKHVTDAMIITAAKTLASFVEDSEVLTGKIYPGLQHIREISTRIA 1653 M+IFPGLG A +AK VTD MI+ +A LA+ V +++ G I+P + I EI+ R++ Sbjct: 474 MFIFPGLGFGAVAAQAKLVTDQMIMRSALELANTVSQADIDAGLIFPAIARIHEITQRVS 533
Query: 1654 VKVIEKAYEEGMAQL-PRPDNIEALVKSRQYVPSY 1755 V+E+A+E+G+AQL PRP + VK+ Q+ P+Y Sbjct: 534 AAVMEQAFEDGVAQLHPRPASCLEYVKAHQWHPAY 568
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 3,119,186,201 Number of extensions: 69529385 Number of successful extensions: 208967 Number of sequences better than 10.0: 829 Number of HSP's gapped: 207702 Number of HSP's successfully gapped: 1549 Length of query: 616 Length of database: 1,061,185,681 Length adjustment: 135 Effective length of query: 481 Effective length of database: 619,945,201 Effective search space: 298193641681 Effective search space used: 298193641681 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
4 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
2 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
2 |
CH (FL, L) |
4 |
CF (FL, S) |
3 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |