| Contig-U16431-1 |
| Contig ID |
Contig-U16431-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1225 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
5809571 |
| End point |
5810796 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
8 |
| Number of EST |
8 |
| Link to clone list |
U16431 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 4. 1 |
| Homology vs DNA |
Query= Contig-U16431-1 (Contig-U16431-1Q) /CSM_Contig/Contig-U16431-1Q.Seq.d
(1225 letters)
Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC115598) Dictyostelium discoideum chromosome 2 map 581427-... 2030 0.0 2
(BJ438488) Dictyostelium discoideum cDNA clone:ddv37g05, 3' ... 1471 0.0 1
(BJ443970) Dictyostelium discoideum cDNA clone:ddv54d22, 3' ... 1463 0.0 2
(BJ356249) Dictyostelium discoideum cDNA clone:dda59a23, 3' ... 1096 0.0 2
(BJ408317) Dictyostelium discoideum cDNA clone:dds45m11, 3' ... 942 0.0 2
(BJ437396) Dictyostelium discoideum cDNA clone:ddv34k03, 3' ... 898 0.0 3
(BJ385168) Dictyostelium discoideum cDNA clone:ddc54f05, 3' ... 920 0.0 2
(BJ446123) Dictyostelium discoideum cDNA clone:ddv61a20, 3' ... 918 0.0 2
(BJ439609) Dictyostelium discoideum cDNA clone:ddv41c04, 3' ... 924 0.0 3
(BJ441177) Dictyostelium discoideum cDNA clone:ddv45l24, 3' ... 860 0.0 2
(BJ440577) Dictyostelium discoideum cDNA clone:ddv44j05, 3' ... 783 0.0 2
(EX276333) 1457467_5_L01_005 PY06 Carica papaya cDNA, mRNA s... 50 4e-06 2
(BQ969153) QHB37A18.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 5e-05 3
(EY878708) LT33-C1-003-003-G02-CT.F Tahiti lime leaf, greenh... 42 8e-04 2
(EY825072) PT11-C1-901-072-B07-CT.F Poncirus trifoliata leaf... 42 8e-04 2
(EY786496) CR05-C3-700-085-A06-CT.F Mandarin fruit, developm... 42 8e-04 2
(BQ971944) QHB9D02.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 48 8e-04 2
(BQ966273) QHB25D22.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 9e-04 2
(BQ967322) QHB29K02.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 9e-04 2
(BQ968773) QHB35B20.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 0.001 2
(BU027877) QHG8G24.yg.ab1 QH_EFGHJ sunflower RHA280 Helianth... 48 0.001 2
(BU025550) QHF9P17.yg.ab1 QH_EFGHJ sunflower RHA280 Helianth... 48 0.001 2
(BQ971249) QHB6F13.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 48 0.001 2
(BU025399) QHF9D22.yg.ab1 QH_EFGHJ sunflower RHA280 Helianth... 48 0.001 2
(BQ971153) QHB6A14.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 48 0.001 2
(BQ970866) QHB5B09.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 48 0.001 2
(BQ970034) QHB3h11.yg.ab1 QH_ABCDI sunflower RHA801 Helianth... 48 0.001 2
(BQ965198) QHB20P16.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 0.001 2
(BU027616) QHG6L05.yg.ab1 QH_EFGHJ sunflower RHA280 Helianth... 48 0.001 2
(BU027439) QHG5K11.yg.ab1 QH_EFGHJ sunflower RHA280 Helianth... 48 0.001 2
(BQ965621) QHB22H04.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 0.001 2
(BQ969557) QHB38N09.yg.ab1 QH_ABCDI sunflower RHA801 Heliant... 48 0.001 2
(BU026022) QHG12M19.yg.ab1 QH_EFGHJ sunflower RHA280 Heliant... 48 0.001 2
(EE620050) CHWM7258.b1_D16.ab1 CHW(LMS) silverleaf sunflower... 48 0.001 2
(CP000716) Thermosipho melanesiensis BI429, complete genome. 56 0.003 1
(DN499741) T083C04.5pR Populus shoot meristem cDNA library P... 42 0.011 2
(BU836150) T083C04 Populus apical shoot cDNA library Populus... 42 0.011 2
(BG524503) 43-3 Stevia field grown leaf cDNA Stevia rebaudia... 38 0.011 2
(EL455596) CHTM8245.b1_J21.ab1 CHT(LMS) Jerusalem artichoke ... 44 0.016 2
(EL453849) CHTM6568.b1_O09.ab1 CHT(LMS) Jerusalem artichoke ... 44 0.019 2
(AE017197) Rickettsia typhi str. Wilmington complete genome. 42 0.030 2
(AM285302) Spiroplasma citri GII3-3X chromosome, contig Cont... 36 0.042 7
(BU026474) QHG16M09.yg.ab1 QH_EFGHJ sunflower RHA280 Heliant... 48 0.054 2
(BX537453) Rattus norvegicus chromosome 1 BAC RP32-86L3. 40 0.064 3
(BX485160) Homo sapiens mRNA; EST DKFZp686A06246_r1 (from c... 42 0.18 2
(BU026508) QHG17B02.yg.ab1 QH_EFGHJ sunflower RHA280 Heliant... 40 0.19 2
(AL671215) Mouse DNA sequence from clone RP23-277C18 on chro... 50 0.20 1
(CP000393) Trichodesmium erythraeum IMS101, complete genome. 50 0.20 1
(BV613117) S217P60023RF12.T0 Noemie Pan troglodytes troglody... 42 0.24 2
(CU655849) M.truncatula DNA sequence *** SEQUENCING IN PROGR... 38 0.46 2
(CU571155) M.truncatula DNA sequence from clone MTH2-78H8 on... 38 0.46 2
(CU896651) M.truncatula DNA sequence from clone MTE1-27C22 o... 38 0.47 2
(CR339969) mte1-71L15FM1 BAC end, cultivar Jemalong A17 of M... 38 0.58 2
(CR334807) mte1-65O13FM1 BAC end, cultivar Jemalong A17 of M... 38 0.59 2
(CX529381) s13dNF90C03MJ018_244816 Methyl Jasmonate-Elicited... 38 0.59 2
(AC181510) Strongylocentrotus purpuratus clone R3-60L17, WOR... 48 0.81 1
(AC181060) Strongylocentrotus purpuratus clone R3-3050B14, W... 48 0.81 1
(AC176560) Strongylocentrotus purpuratus clone R3-3076I12, W... 48 0.81 1
(BU021122) QHE29F18.yg.ab1 QH_EFGHJ sunflower RHA280 Heliant... 48 0.81 1
(CP000847) Rickettsia akari str. Hartford, complete genome. 48 0.81 1
(EJ153693) 1092343792028 Global-Ocean-Sampling_GS-27-01-01-1... 42 0.86 2
(FH643783) CHO_OF4977xj14r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 0.86 2
(CL026761) CH216-23O2_RM1.1 CH216 Xenopus (Silurana) tropica... 42 1.3 2
(EU124736) Solanum lycopersicum chromosome 3 clone C03HBa014... 32 1.6 2
(AP009516) Solanum lycopersicum DNA, chromosome 8, clone: C0... 32 1.7 2
(AM481515) Vitis vinifera contig VV78X123911.4, whole genome... 46 2.1 2
(EJ453439) 1093015467043 Global-Ocean-Sampling_GS-28-01-01-1... 36 2.2 2
(FM992693) Candida dubliniensis CD36 chromosome 6, complete ... 34 2.4 15
(AC232407) Lama pacos clone CH246-221E13, WORKING DRAFT SEQU... 38 2.4 6
(CN876744) 020814AARA010320HT (AARA) Royal Gala partially se... 44 2.7 2
(CP000397) Borrelia afzelii PKo plasmid lp60-2, complete seq... 34 2.9 5
(BS000088) Pan troglodytes chromosome 22 clone:RP43-078B15, ... 46 3.2 1
(AC121676) Rattus norvegicus clone CH230-509I18, *** SEQUENC... 46 3.2 1
(AC121197) Rattus norvegicus clone CH230-24F15, *** SEQUENCI... 46 3.2 1
(FP102167) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 46 3.2 1
(FP085553) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.2 1
(CU468504) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.2 1
(AC230898) Bos taurus clone CH240-496J7, WORKING DRAFT SEQUE... 46 3.2 1
(AC225274) Neofelis nebulosa clone CH87-38E9, WORKING DRAFT ... 46 3.2 1
(AC164140) Bos taurus clone CH240-146A13, *** SEQUENCING IN ... 46 3.2 1
(AC162965) Bos taurus clone CH240-128B13, WORKING DRAFT SEQU... 46 3.2 1
(ER477692) 1093015246459 Global-Ocean-Sampling_GS-35-01-01-1... 46 3.2 1
(EK293411) 1095462338035 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.2 1
(EK291025) 1095462330738 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.2 1
(EK072770) 1092961006688 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.2 1
(EJ870949) 1093018347146 Global-Ocean-Sampling_GS-30-02-01-1... 46 3.2 1
(EJ834517) 1093017609382 Global-Ocean-Sampling_GS-30-02-01-1... 46 3.2 1
(DU246484) 1098574268662 CHORI-243 Ovis aries genomic clone ... 46 3.2 1
(BZ937899) CH240_62J5.TJ CHORI-240 Bos taurus genomic clone ... 46 3.2 1
(EL905221) G5To4_3_B07.g1_A006 G5 tomites: 3 to 8 kb fractio... 46 3.2 1
(EH372227) LB004129.CR_P24 GC_BGC-04 Bos taurus cDNA clone I... 46 3.2 1
(EE382061) LB03068.CR_B09 GC_BGC-30 Bos taurus cDNA clone IM... 46 3.2 1
(EB680232) KL4B.106I15F.051125T7 KL4B Nicotiana tabacum cDNA... 46 3.2 1
(FL507697) vfase1ng_UP_061_G02_02DEC2005_004 Vicia faba cv. ... 46 3.2 1
(FL507684) vfase1ng_UP_061_F01_02DEC2005_005 Vicia faba cv. ... 46 3.2 1
(FL507561) vfase1ng_UP_060_A04_02DEC2005_032 Vicia faba cv. ... 46 3.2 1
(FL507404) vfase1ng_UP_057_G10_01DEC2005_068 Vicia faba cv. ... 46 3.2 1
(FL506159) vfase1ng_UP_040_E10_07NOV2005_072 Vicia faba cv. ... 46 3.2 1
(FL505118) vfase1ng_UP_026_F10_09AUG2005_070 Vicia faba cv. ... 46 3.2 1
(FL504909) vfase1ng_UP_024_B08_09AUG2005_062 Vicia faba cv. ... 46 3.2 1
(FL503270) vfase1ng_UP_004_F11_06MAY2004_085 Vicia faba cv. ... 46 3.2 1
(FL503221) vfase1ng_UP_004_B09_06MAY2004_077 Vicia faba cv. ... 46 3.2 1
(FG163431) AGN_RNC014xg05f1.ab1 AGN_RNC Nicotiana tabacum cD... 46 3.2 1
(FF712694) XABT32631.rev Gateway compatible cien cDNA librar... 46 3.2 1
(EY385270) CAXA5603.fwd CAXA Helobdella robusta Subtracted L... 46 3.2 1
(EY385269) CAXA5603.rev CAXA Helobdella robusta Subtracted L... 46 3.2 1
(EX825740) CcLXMa70h22n1 Montse common carp adult head and k... 46 3.2 1
(EJ380338) 1092963759959 Global-Ocean-Sampling_GS-28-01-01-1... 40 3.4 2
(AC136681) Homo sapiens chromosome 11 clone RP11-124L4 map 1... 38 4.8 7
(AC163480) Bos taurus clone CH240-96D5, WORKING DRAFT SEQUEN... 44 4.9 5
(AP006716) Staphylococcus haemolyticus JCSC1435 DNA, complet... 34 5.2 21
(BJ386157) Dictyostelium discoideum cDNA clone:ddc57g11, 3' ... 32 5.4 3
(BF015252) kq61d08.y1 TBN95TM-SSR Strongyloides stercoralis ... 40 5.7 2
(AC168625) Strongylocentrotus purpuratus clone R3-3046C3, WO... 36 6.7 4
(CZ388031) ZMMBF0164H01f ZMMBF Zea mays genomic clone ZMMBF0... 32 6.8 3
(BJ368451) Dictyostelium discoideum cDNA clone:ddc46e20, 5' ... 36 7.4 2
(AW893660) RC4-NN0024-120500-012-c07 NN0024 Homo sapiens cDN... 34 7.4 2
(AC053535) Homo sapiens chromosome 8 clone RP11-745D6, WORKI... 34 7.5 7
(FC787065) CBGC17148.rev CBGC Lottia gigantea 15h 18h embryo... 38 8.2 2
(FC787066) CBGC17148.fwd CBGC Lottia gigantea 15h 18h embryo... 38 8.3 2
(BE037375) MP20C09 MP Mesembryanthemum crystallinum cDNA 5' ... 42 8.9 2
(DA939731) Homo sapiens cDNA clone SPLEN2013394, 5' end, mRN... 34 8.9 2
(DB196718) Homo sapiens cDNA clone TRACH2003423, 5' end, mRN... 34 8.9 2
(FC655980) CAXW14539.rev CAXW Lottia gigantea from female go... 38 9.6 2
(AC012669) Homo sapiens BAC clone RP11-512G4 from 2, complet... 44 9.8 6
(FC641592) CAXU5486.rev CAXU Lottia gigantea from female gon... 38 10.0 2
(FC679378) CAXX13147.rev CAXX Lottia gigantea from male gona... 38 10.0 2
>(AC115598) Dictyostelium discoideum chromosome 2 map 581427-735498
strain AX4, complete sequence.
Length = 154071
Score = 2030 bits (1024), Expect(2) = 0.0
Identities = 1024/1024 (100%)
Strand = Plus / Minus
Query: 1 tagatgaaactccattctatggtacttcaggtggtcaagttggtgatgttggtgaattaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 92044 tagatgaaactccattctatggtacttcaggtggtcaagttggtgatgttggtgaattaa 91985
Query: 61 tcaatgtttcaagtggtaaaaatgtttatcgtgtaattaatacaattaaaccatatgaag 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91984 tcaatgtttcaagtggtaaaaatgtttatcgtgtaattaatacaattaaaccatatgaag 91925
Query: 121 gtggtttagttttagtagttgaatgggatccttcacaacaattggcttcacaggtttatc 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91924 gtggtttagttttagtagttgaatgggatccttcacaacaattggcttcacaggtttatc 91865
Query: 181 aagatttaaaacaagattcattattgaattgtagagtggatcgttcaattagaaatcaag 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91864 aagatttaaaacaagattcattattgaattgtagagtggatcgttcaattagaaatcaag 91805
Query: 241 ttgctgttcatcatagtgctactcatttgctacatgcagcattaagaaatgtaattggca 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91804 ttgctgttcatcatagtgctactcatttgctacatgcagcattaagaaatgtaattggca 91745
Query: 301 aaagtgtagttcaagctggttcattggttggtagtgaatcattacgtttcgatttcacac 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91744 aaagtgtagttcaagctggttcattggttggtagtgaatcattacgtttcgatttcacac 91685
Query: 361 atggtcaaaaattaacaccaaatcaaattgaacaaattgaacaatgggtaaatgatgcaa 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91684 atggtcaaaaattaacaccaaatcaaattgaacaaattgaacaatgggtaaatgatgcaa 91625
Query: 421 ttgccaaagatatagctttgaataccgatgaaattccatatgaacaagcatctaaaaata 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91624 ttgccaaagatatagctttgaataccgatgaaattccatatgaacaagcatctaaaaata 91565
Query: 481 gtgatacccttcaattatttagtgaaaagtatagtgaattggtacgtgttgttagtatac 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91564 gtgatacccttcaattatttagtgaaaagtatagtgaattggtacgtgttgttagtatac 91505
Query: 541 ctggattctctaaggagctctgtggtggtacacatgttgaacgttcatcttcaattcatc 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91504 ctggattctctaaggagctctgtggtggtacacatgttgaacgttcatcttcaattcatc 91445
Query: 601 aatttaaaattataagtgaaagtagtgtagcagcaggaactcgtagaattgaagcagtgg 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91444 aatttaaaattataagtgaaagtagtgtagcagcaggaactcgtagaattgaagcagtgg 91385
Query: 661 caggtttagcagcaacaaactttttcaaaaatcattatcaattagttcatcaattatcaa 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91384 caggtttagcagcaacaaactttttcaaaaatcattatcaattagttcatcaattatcaa 91325
Query: 721 atagtataaattcgccaatagttaatttccaacaatcatttgaacgtttggtaaatacaa 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91324 atagtataaattcgccaatagttaatttccaacaatcatttgaacgtttggtaaatacaa 91265
Query: 781 attcaaaacaagaaaaagaaattttcgatctaaaattaaagattgctcaactttcatctg 840
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91264 attcaaaacaagaaaaagaaattttcgatctaaaattaaagattgctcaactttcatctg 91205
Query: 841 taaattataatggtcaatacaaatctgataatggtggtgaaatgatacctttatcattac 900
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91204 taaattataatggtcaatacaaatctgataatggtggtgaaatgatacctttatcattac 91145
Query: 901 atattatcgattgtgaagataaaaaagcatttacaaaagtaactgaaaactttgcaaaag 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91144 atattatcgattgtgaagataaaaaagcatttacaaaagtaactgaaaactttgcaaaag 91085
Query: 961 aattctcttcatcaccaattcaattaacaattagtaaaggtggaaaagttttatgtcaat 1020
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 91084 aattctcttcatcaccaattcaattaacaattagtaaaggtggaaaagttttatgtcaat 91025
Query: 1021 tatt 1024
||||
Sbjct: 91024 tatt 91021
Score = 178 bits (90), Expect(2) = 0.0
Identities = 90/90 (100%)
Strand = Plus / Minus
Query: 1059 gctgatacagttttaaaacaattatttaaatcaattggtatgggaaaaggtggtggaaat 1118
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 90986 gctgatacagttttaaaacaattatttaaatcaattggtatgggaaaaggtggtggaaat 90927
Query: 1119 aaattaatggcaaatgcttcaattcaacca 1148
||||||||||||||||||||||||||||||
Sbjct: 90926 aaattaatggcaaatgcttcaattcaacca 90897
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 1,490,688,784
Number of extensions: 91251482
Number of successful extensions: 7684997
Number of sequences better than 10.0: 127
Length of query: 1225
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 1201
Effective length of database: 99,340,224,878
Effective search space: 119307610078478
Effective search space used: 119307610078478
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.28 |
| Homology vs Protein |
Query= Contig-U16431-1 (Contig-U16431-1Q) /CSM_Contig/Contig-U16431-1Q.Seq.d
(1225 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC115598_31(AC115598|pid:none) Dictyostelium discoideum chromoso... 707 0.0
CP001322_2924(CP001322|pid:none) Desulfatibacillum alkenivorans ... 192 2e-47
(A0LLA3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 176 2e-42
(Q0TPH4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 171 5e-41
CP000934_1326(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 170 1e-40
(B2V709) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 170 1e-40
(B2V3W2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 170 1e-40
CT573072_132(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 168 3e-40
(Q01XA0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 167 7e-40
(A6Q576) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 167 7e-40
(A7MJ41) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 167 9e-40
(A9KMW7) RecName: Full=Alanyl-tRNA synthetase 1; EC=6.1... 166 1e-39
(A8F866) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 166 1e-39
(Q2LPL7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 166 2e-39
CP001655_962(CP001655|pid:none) Dickeya zeae Ech1591, complete g... 166 2e-39
(Q82TF8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 165 3e-39
(A4IR80) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 165 3e-39
CP000557_2447(CP000557|pid:none) Geobacillus thermodenitrificans... 165 3e-39
CP001229_855(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 165 4e-39
(O67323) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 165 4e-39
(Q5KWU5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 164 5e-39
CP001279_122(CP001279|pid:none) Nautilia profundicola AmH, compl... 164 6e-39
(Q2NVL2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 164 6e-39
(Q896F2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 163 1e-38
(Q30YS5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 163 1e-38
(Q487H5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 163 1e-38
CP001600_3118(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 163 1e-38
(Q1D084) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 163 1e-38
(A8MGI3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 162 2e-38
(A9AC16) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 162 3e-38
CP001098_569(CP001098|pid:none) Halothermothrix orenii H 168, co... 161 4e-38
(Q9JYG6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 161 4e-38
(A8ZY67) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 161 5e-38
(A1JK09) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 161 5e-38
(A4TQ52) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 7e-38
(B1JJA0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 7e-38
(A7FLR7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 7e-38
(Q3ILF3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 7e-38
CP000926_3953(CP000926|pid:none) Pseudomonas putida GB-1, comple... 160 9e-38
(A9NCN7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 9e-38
(A9BJE0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 9e-38
(B0K0Q1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 9e-38
(A9KG28) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 9e-38
(B0KR43) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 9e-38
(B1MXP8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 1e-37
(A1KV20) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 1e-37
(Q39Z77) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 160 1e-37
(A5ICV6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 159 1e-37
CP000949_3739(CP000949|pid:none) Pseudomonas putida W619, comple... 159 2e-37
(B1JCG9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 159 2e-37
(Q15RG5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 159 2e-37
(A6VKD6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 159 3e-37
(Q129G8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 158 3e-37
CP001050_251(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 158 3e-37
(Q6D1T0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 158 3e-37
AE005174_3567(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 158 3e-37
(Q65VQ5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 158 3e-37
EF106972_77(EF106972|pid:none) Uncultured marine Nitrospinaceae ... 158 3e-37
(A1TZ92) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 158 3e-37
EF531339_152(EF531339|pid:none) Candidatus Chloracidobacterium t... 158 3e-37
CP001275_699(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 158 4e-37
CP000381_1438(CP000381|pid:none) Neisseria meningitidis 053442, ... 157 6e-37
(Q32CN1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 6e-37
(Q5X4B7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 6e-37
(B1K026) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 7e-37
(Q9JTG4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 7e-37
(A5W0D9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(Q3JCK8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(B0S104) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(A8GA09) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
CP000712_1422(CP000712|pid:none) Pseudomonas putida F1, complete... 157 1e-36
(B1YNJ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(A7ZQC5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(B1I370) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(Q0TEI3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 157 1e-36
(A7GZA4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 1e-36
(B0TK15) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 1e-36
(B2U049) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 1e-36
(Q5WVQ2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 1e-36
(B1XCM5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 2e-36
CP001616_2692(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 156 2e-36
CU928158_352(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 156 2e-36
CP001654_985(CP001654|pid:none) Dickeya dadantii Ech703, complet... 156 2e-36
(A1AEN7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 2e-36
CP000680_2883(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 156 2e-36
(A4XWE2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 2e-36
(B1IUY2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 2e-36
(Q8CWY0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 156 2e-36
CP001107_1769(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 155 2e-36
CU928163_2962(CU928163|pid:none) Escherichia coli UMN026 chromos... 155 2e-36
(A4WDQ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 155 2e-36
CU651637_2560(CU651637|pid:none) Escherichia coli LF82 chromosom... 155 2e-36
(A4SGJ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 155 2e-36
(A9MFZ1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 155 2e-36
CU466930_1614(CU466930|pid:none) Candidatus Cloacamonas acidamin... 155 2e-36
(Q0VNK2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 155 3e-36
(A6VA71) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 155 3e-36
AM286690_1798(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 155 3e-36
CP000151_1366(CP000151|pid:none) Burkholderia sp. 383 chromosome... 155 3e-36
CP001634_1567(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 155 3e-36
(A6W1F1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 155 4e-36
AM933172_2657(AM933172|pid:none) Salmonella enterica subsp. ente... 154 5e-36
(Q8EPS9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 5e-36
(Q57KU6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 5e-36
(Q4L6W5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 5e-36
(Q8Z4D5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 5e-36
(Q8EBS1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 5e-36
(A0K6N4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 6e-36
CP001130_1527(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 154 6e-36
J01581_1(J01581|pid:none) E. coli alaS gene coding for alanyl-tR... 154 6e-36
(A8FSV6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 6e-36
(A1S4E9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 6e-36
CP000378_920(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 154 6e-36
(B1ICI3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 6e-36
(Q1I6Z8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 6e-36
CP001138_2744(CP001138|pid:none) Salmonella enterica subsp. ente... 154 6e-36
CP000922_739(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 154 8e-36
(B0CFX4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 8e-36
(A6TCV9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 8e-36
(Q04JW5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 8e-36
(A9N0C1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 154 8e-36
CP001321_427(CP001321|pid:none) Haemophilus parasuis SH0165, com... 154 8e-36
(Q2RHZ3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
(Q97IG3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
CP000964_1082(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 153 1e-35
(Q18BE7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
AF297520_1(AF297520|pid:none) Haemophilus ducreyi alanyl-tRNA sy... 153 1e-35
CP001147_525(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 153 1e-35
(P61701) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
(A4SS99) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
FM204883_658(FM204883|pid:none) Streptococcus equi subsp. equi 4... 153 1e-35
(A4SZL8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
(A5N7T5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
CU928164_2865(CU928164|pid:none) Escherichia coli IAI39 chromoso... 153 1e-35
(Q10VG8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
(B1LBS9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 153 1e-35
CP001158_369(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 152 2e-35
(Q2SBT9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 2e-35
(A0KU94) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 2e-35
CP001161_371(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy... 152 2e-35
(A8ANQ1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 2e-35
(Q9X1B6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 2e-35
CP001087_2702(CP001087|pid:none) Desulfobacterium autotrophicum ... 152 2e-35
FM204884_1340(FM204884|pid:none) Streptococcus equi subsp. zooep... 152 2e-35
(Q6GG85) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(B1Y1G9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(P57483) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(A3D783) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(A1VQK2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(Q0HXF8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(B1YJE5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(Q9A5C1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 151 4e-35
(B2JK72) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 151 5e-35
(A6WR16) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 151 5e-35
CP000587_214(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 151 5e-35
(A1VYL8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 151 5e-35
CP000724_2369(CP000724|pid:none) Alkaliphilus metalliredigens QY... 150 7e-35
CP001089_3121(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 150 7e-35
(A6TQZ4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 7e-35
FM954972_2448(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 150 7e-35
CP001252_1218(CP001252|pid:none) Shewanella baltica OS223, compl... 150 7e-35
(A1RHG5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 7e-35
(Q6G8V1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 7e-35
(B1KXB7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(A5ITE3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(Q4K843) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(B2SZN0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(A4VJB3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(Q65GS5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(Q31DD9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(A5UDR0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(Q885J0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(A6QHF9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(Q62KZ3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
CP000472_1305(CP000472|pid:none) Shewanella piezotolerans WP3, c... 150 1e-34
(Q7NXM2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(Q0HL60) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 150 1e-34
CP001108_293(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 150 1e-34
(P43815) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(Q1LQ59) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(A7GGF1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(A1V3F2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(A2BNH2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(A3QC89) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(Q8P9X0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(B1IJG7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(B2IQK0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
(Q2SV73) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
CP001129_645(CP001129|pid:none) Streptococcus equi subsp. zooepi... 149 2e-34
CP001083_2682(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 149 2e-34
CP001100_593(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 149 2e-34
(A0RJ00) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
CP001176_4343(CP001176|pid:none) Bacillus cereus B4264, complete... 149 2e-34
(P59420) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 149 2e-34
CP000919_1219(CP000919|pid:none) Streptococcus pneumoniae JJA, c... 149 3e-34
AY142830_1(AY142830|pid:none) Heliobacillus mobilis Alanyl-tRNA ... 149 3e-34
CP001635_3131(CP001635|pid:none) Variovorax paradoxus S110 chrom... 148 3e-34
(A3PA95) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 3e-34
CP000916_1195(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 148 3e-34
(A3N8K7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 3e-34
(A5IMH8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 3e-34
(Q817Z0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 3e-34
CP001101_310(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 148 3e-34
(Q8F0T4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 4e-34
CP001408_1666(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 148 4e-34
(A5I4Z5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 4e-34
(A1W7D0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 4e-34
(P61703) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 4e-34
(Q7V419) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 4e-34
(Q11V49) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 148 4e-34
(A9VI09) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 6e-34
CP001015_1309(CP001015|pid:none) Streptococcus pneumoniae G54, c... 147 6e-34
AM942759_369(AM942759|pid:none) Proteus mirabilis strain HI4320,... 147 6e-34
CP000918_1340(CP000918|pid:none) Streptococcus pneumoniae 70585,... 147 6e-34
(Q634F6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 6e-34
(A8EWI6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 6e-34
(B1ZZ40) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 6e-34
(A4XKP4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 6e-34
(P61697) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 6e-34
(Q13W97) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 8e-34
CP001277_11(CP001277|pid:none) Candidatus Hamiltonella defensa 5... 147 8e-34
(B0RTY1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 8e-34
(Q04QG6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 8e-34
(Q054G6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 8e-34
(Q56273) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 8e-34
CP001104_921(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 147 1e-33
CP000705_525(CP000705|pid:none) Lactobacillus reuteri DSM 20016,... 147 1e-33
(A4G2S9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 147 1e-33
(B0UTE1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 1e-33
(Q8DC49) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 1e-33
(Q8RFJ8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 1e-33
CP001010_1204(CP001010|pid:none) Polynucleobacter necessarius su... 146 1e-33
(B3CST3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 1e-33
CP000920_1283(CP000920|pid:none) Streptococcus pneumoniae P1031,... 146 1e-33
(P70865) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(Q2KY72) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
AM946015_1202(AM946015|pid:none) Streptococcus uberis 0140J comp... 146 2e-33
(A2CDK7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(B1VDL4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(Q835J8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(Q4ZQI4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(Q81LK0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(A1USS4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
CP000554_2811(CP000554|pid:none) Prochlorococcus marinus str. MI... 146 2e-33
(A7H4N3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(P61700) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 2e-33
(A1VEQ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 2e-33
(Q8PLQ0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 2e-33
(Q2YT60) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 2e-33
(Q6HDD7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 2e-33
(Q9KDE6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 2e-33
(Q48SS4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
(Q3K1P7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
(Q8E0C4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
(Q1J5Z4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
CP000829_1039(CP000829|pid:none) Streptococcus pyogenes NZ131, c... 145 3e-33
(Q99Z57) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
(A2RDY3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
(Q5XBH1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
CP001068_728(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 145 3e-33
(Q0K823) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 3e-33
CU633749_2204(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 145 3e-33
(B1WYQ5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(Q8P0E6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(Q6G2Z4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(Q92BK9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(A3CLY3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(Q5HNT2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(Q7MHR6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(Q1QZX1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 145 4e-33
(A8GU16) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 5e-33
(Q2IG40) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 6e-33
(Q0I6G6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 6e-33
(Q7N7A5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 6e-33
(Q8E600) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 6e-33
AE003849_124(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 144 6e-33
AP010872_524(AP010872|pid:none) Candidatus Ishikawaella capsulat... 144 6e-33
CP001393_1265(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 144 8e-33
CP001644_802(CP001644|pid:none) Ralstonia pickettii 12D chromoso... 144 8e-33
(Q71ZG6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 8e-33
(Q4FRQ0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 144 8e-33
(A3M3W2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
CP000863_1154(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 143 1e-32
AP010904_4329(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 143 1e-32
(B2SH99) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
CP001391_693(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 143 1e-32
(Q1H3U9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
(A5EW88) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
(A1AXE0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
(A8F323) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
(A6Q747) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
CP000683_960(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 143 1e-32
CP001607_1667(CP001607|pid:none) Aggregatibacter aphrophilus NJ8... 143 1e-32
AB005243_3(AB005243|pid:none) Arabidopsis thaliana genomic DNA, ... 143 1e-32
(A0AIV3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
(Q3ZAE4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 143 1e-32
AX366209_1(AX366209|pid:none) Sequence 3 from Patent WO0200696. ... 143 1e-32
(B3H177) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
(A7MYT5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
CP001131_3807(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 142 2e-32
CP001139_521(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 142 2e-32
(Q7U3R9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
(Q8Y722) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
(Q3MGN4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
(Q92G00) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
(Q4JVF5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
CP001612_994(CP001612|pid:none) Rickettsia africae ESF-5, comple... 142 2e-32
(A5GWM4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
(B0U1K9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 2e-32
CT978603_2380(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 142 2e-32
(Q3ATN3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 3e-32
CP000774_2565(CP000774|pid:none) Parvibaculum lavamentivorans DS... 142 3e-32
(P74423) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 3e-32
BA000039_2102(BA000039|pid:none) Thermosynechococcus elongatus B... 142 3e-32
(A1WIG8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 3e-32
AP009484_1260(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 142 3e-32
(A5CVU0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 142 3e-32
(B2SUD0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 141 4e-32
(Q8YUD4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 141 4e-32
(Q04EQ9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 141 4e-32
(Q31F91) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 141 5e-32
CP001357_1447(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 141 5e-32
(Q5E7G5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 141 5e-32
CP001016_2357(CP001016|pid:none) Beijerinckia indica subsp. indi... 140 7e-32
CP001196_1415(CP001196|pid:none) Oligotropha carboxidovorans OM5... 140 7e-32
(B2IHX3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 7e-32
(Q7NI36) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 7e-32
(A4VVR3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 7e-32
Y08363_1(Y08363|pid:none) T.thermophilus alaS gene. 140 9e-32
CP001287_1373(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 140 9e-32
(B2FL33) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 9e-32
(A1ATU9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 9e-32
(B1XP68) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 9e-32
CP001197_871(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 140 9e-32
(A8GQ73) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 1e-31
(A0Q604) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 1e-31
(A7HH87) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 140 1e-31
(Q8FT23) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 2e-31
CP001227_897(CP001227|pid:none) Rickettsia peacockii str. Rustic... 139 2e-31
CP001472_1874(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 139 2e-31
(A4QEK7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 2e-31
BA000035_1746(BA000035|pid:none) Corynebacterium efficiens YS-31... 139 2e-31
FM178379_635(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 139 2e-31
(Q14HB9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 2e-31
E71476(E71476)alanine-tRNA ligase (EC 6.1.1.7) - Chlamydia trach... 139 2e-31
CP001111_1478(CP001111|pid:none) Stenotrophomonas maltophilia R5... 139 2e-31
(O84754) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 2e-31
(Q3AGN4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 2e-31
CP001562_1136(CP001562|pid:none) Bartonella grahamii as4aup, com... 139 3e-31
(B0TZY8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 3e-31
AM999887_666(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 139 3e-31
(A5CD03) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 139 3e-31
CU861906_798(CU861906|pid:none) Ralstonia solanacearum strain Mo... 138 4e-31
(Q2JLC4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 138 4e-31
(A0RPR0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 138 5e-31
(Q3B1I7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 138 5e-31
(A9IVY8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 138 5e-31
CP000153_1890(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 137 6e-31
(Q6FCT2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 6e-31
(Q7WHL6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 8e-31
(Q7W6N4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 8e-31
(Q6FZF1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 8e-31
(A9B9E5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 1e-30
(Q67MV8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 1e-30
(A3N018) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 137 1e-30
(Q5FQ21) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 136 1e-30
(Q5N4B5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 136 1e-30
AP009153_1915(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 136 1e-30
CP000100_874(CP000100|pid:none) Synechococcus elongatus PCC 7942... 136 1e-30
AM778956_70(AM778956|pid:none) Microcystis aeruginosa PCC 7806 g... 136 2e-30
CU914168_2218(CU914168|pid:none) Ralstonia solanacearum strain I... 136 2e-30
CP001344_453(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 136 2e-30
(Q47N66) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 136 2e-30
(B0B8X5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 2e-30
CP000319_1538(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 135 2e-30
(Q1QMV7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 2e-30
(Q2ITM9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 2e-30
(A6H0Y3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 3e-30
(A1BD33) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 3e-30
(Q7V3N0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 3e-30
(B0JI84) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 3e-30
(A0L3J9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 4e-30
(Q6AQ16) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 4e-30
(Q0AQY6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 135 4e-30
(Q493M6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 5e-30
(Q821R2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 5e-30
AP010656_517(AP010656|pid:none) Candidatus Azobacteroides pseudo... 134 5e-30
(A9W5Y4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 7e-30
(Q3ST43) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 7e-30
(Q1WT32) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 7e-30
(Q7VHV4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 7e-30
(P61702) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 7e-30
CP001510_2510(CP001510|pid:none) Methylobacterium extorquens AM1... 134 9e-30
(Q24UT2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 134 9e-30
AB038354_1(AB038354|pid:none) Methylobacillus glycogenes genes f... 134 9e-30
(Q89I89) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 133 1e-29
(A8F078) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 133 1e-29
(A5VQX4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 133 1e-29
CP001649_3101(CP001649|pid:none) Desulfovibrio salexigens DSM 26... 133 1e-29
CP001291_880(CP001291|pid:none) Cyanothece sp. PCC 7424, complet... 133 1e-29
(Q2K7T4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 133 1e-29
(B0SGD3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 132 2e-29
(A5FIP9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 132 2e-29
(Q048Z3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 132 3e-29
CP001114_2128(CP001114|pid:none) Deinococcus deserti VCD115, com... 132 3e-29
CR954253_1550(CR954253|pid:none) Lactobacillus delbrueckii subsp... 132 3e-29
(B1GZ43) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 132 3e-29
(A0LXX3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 131 4e-29
CP000377_1232(CP000377|pid:none) Silicibacter sp. TM1040, comple... 131 4e-29
(Q1GHA1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 131 4e-29
CP000613_878(CP000613|pid:none) Rhodospirillum centenum SW, comp... 130 7e-29
CP001364_4065(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 130 7e-29
(A9WCR2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 130 7e-29
(Q28QV8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 130 1e-28
(Q8D2W8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 130 1e-28
(Q2N9K5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 130 1e-28
(Q7MV54) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 130 1e-28
CP001079_147(CP001079|pid:none) Anaplasma marginale str. Florida... 130 1e-28
AP009380_1381(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 130 1e-28
(B2GIA1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 129 2e-28
(Q5FLW6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 129 2e-28
(B2UV04) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 128 4e-28
CP001217_1200(CP001217|pid:none) Helicobacter pylori P12, comple... 128 4e-28
(A4YXQ6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 128 5e-28
(A7ZE62) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 128 5e-28
(Q4FMX6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 6e-28
(A2RME6) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 6e-28
(Q17ZF3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 8e-28
(P61699) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 1e-27
(A5EML9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 1e-27
(A6L1L8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 1e-27
(A6X0E9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 1e-27
CP000628_1968(CP000628|pid:none) Agrobacterium radiobacter K84 c... 127 1e-27
(A8YTJ0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 127 1e-27
(Q8UE87) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 126 1e-27
(Q2RQI0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 126 1e-27
(Q7VQG3) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 126 1e-27
F97585(F97585)alanyl-tRNA synthetase RNA ligase) (ALars) (ALani... 126 1e-27
(Q1IW89) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 126 2e-27
(Q98NQ5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 126 2e-27
(A8ICW8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 125 2e-27
(A6LEZ8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 125 2e-27
CP000390_1257(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 125 2e-27
(Q1CS22) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 125 3e-27
FM177140_837(FM177140|pid:none) Lactobacillus casei BL23 complet... 125 3e-27
CP001389_1607(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 124 5e-27
(Q827S4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 124 5e-27
(A5V3L0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 124 5e-27
(A9FRF5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 124 7e-27
(Q03B02) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 124 7e-27
(Q9KXP9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 124 9e-27
AP008957_2985(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 123 2e-26
(A3PZ44) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 123 2e-26
(B2HNC1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 122 2e-26
(Q9RS27) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 122 3e-26
(A0QWQ4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 121 4e-26
(A7IMR0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 121 4e-26
CP001601_1387(CP001601|pid:none) Corynebacterium aurimucosum ATC... 120 8e-26
(Q5LRU1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 120 1e-25
CP001515_902(CP001515|pid:none) Bifidobacterium animalis subsp. ... 120 1e-25
(Q1C420) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 120 1e-25
(A1T8E8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 120 1e-25
CU458896_2827(CU458896|pid:none) Mycobacterium abscessus chromos... 119 2e-25
(Q2G8V0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 119 2e-25
CP001349_5297(CP001349|pid:none) Methylobacterium nodulans ORS 2... 119 3e-25
(Q2GEP2) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 119 3e-25
(Q0RF65) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 119 3e-25
CP000820_1663(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 119 3e-25
CT573213_5130(CT573213|pid:none) Frankia alni str. ACN14A chromo... 119 3e-25
(A8LCW4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 119 3e-25
AP009389_1061(AP009389|pid:none) Pelotomaculum thermopropionicum... 118 4e-25
(Q0BSD5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 118 5e-25
CP000394_1369(CP000394|pid:none) Granulibacter bethesdensis CGDN... 118 5e-25
(B1W3I1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 117 8e-25
(A1SJC7) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 117 1e-24
(Q2J821) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 116 1e-24
AF179611_8(AF179611|pid:none) Zymomonas mobilis ZM4 fosmid clone... 116 1e-24
BT063460_1(BT063460|pid:none) Zea mays full-length cDNA clone ZM... 116 2e-24
(A5U5Q5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 115 2e-24
AM422018_508(AM422018|pid:none) Candidatus Phytoplasma australie... 115 2e-24
(Q5YTJ9) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 115 4e-24
CP001330_129(CP001330|pid:none) Micromonas sp. RCC299 chromosome... 114 7e-24
(A8LL20) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 114 7e-24
(Q6YQR8) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 114 9e-24
(Q165U5) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 113 1e-23
CP001628_1202(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 113 2e-23
(Q6AFA1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 113 2e-23
(Q2SSW4) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 113 2e-23
(A1R709) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 113 2e-23
(Q3J0R1) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 112 2e-23
BA000045_2349(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 112 2e-23
(Q9CCT0) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 112 3e-23
CP001618_2003(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 111 5e-23
(A9KLZ5) RecName: Full=Alanyl-tRNA synthetase 2; EC=6.1... 110 1e-22
(Q2NJ60) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 109 2e-22
(P21894) RecName: Full=Alanyl-tRNA synthetase, cytoplasmic; ... 108 3e-22
(Q54Y20) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 108 5e-22
(A0JX88) RecName: Full=Alanyl-tRNA synthetase; EC=6.1.1... 107 1e-21
AL590442_147(AL590442|pid:none) chromosome II of strain GB-M1 of... 106 1e-21
CP000497_274(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 105 3e-21
>AC115598_31(AC115598|pid:none) Dictyostelium discoideum chromosome 2
map 581427-735498 strain AX4, complete sequence.
Length = 932
Score = 707 bits (1826), Expect = 0.0
Identities = 366/393 (93%), Positives = 366/393 (93%)
Frame = +3
Query: 3 DETPFYGTSGGQVGDVGELINVSSGKNVYRVINTIKPYEGGLVLVVEWDPSQQLASQVYQ 182
DETPFYGTSGGQVGDVGELINVSSGKNVYRVINTIKPYEGGLVLVVEWDPSQQLASQVYQ
Sbjct: 527 DETPFYGTSGGQVGDVGELINVSSGKNVYRVINTIKPYEGGLVLVVEWDPSQQLASQVYQ 586
Query: 183 DLKQDSLLNCRVDRSIRNQVXXXXXXXXXXXXXXRNVIGKSVVQAGSLVGSESLRFDFTH 362
DLKQDSLLNCRVDRSIRNQV RNVIGKSVVQAGSLVGSESLRFDFTH
Sbjct: 587 DLKQDSLLNCRVDRSIRNQVAVHHSATHLLHAALRNVIGKSVVQAGSLVGSESLRFDFTH 646
Query: 363 GQKLTPNQIEQIEQWVNDAIAKDIALNTDEIPYEQASKNSDTLQLFSEKYSELVRVVSIP 542
GQKLTPNQIEQIEQWVNDAIAKDIALNTDEIPYEQASKNSDTLQLFSEKYSELVRVVSIP
Sbjct: 647 GQKLTPNQIEQIEQWVNDAIAKDIALNTDEIPYEQASKNSDTLQLFSEKYSELVRVVSIP 706
Query: 543 GFSKELCGGTHVERSSSIHQFKIISESSVAAGTRRIEAVAGLAATNFFKNHYQLVHQLSN 722
GFSKELCGGTHVERSSSIHQFKIISESSVAAGTRRIEAVAGLAATNFFKNHYQLVHQLSN
Sbjct: 707 GFSKELCGGTHVERSSSIHQFKIISESSVAAGTRRIEAVAGLAATNFFKNHYQLVHQLSN 766
Query: 723 SINSPIVNFQQSFERLVNTNSKQEKEIFDLKLKIAQLSSVNYNGQYKSDNGGEMIPLSLH 902
SINSPIVNFQQSFERLVNTNSKQEKEIFDLKLKIAQLSSVNYNGQYKSDNGGEMIPLSLH
Sbjct: 767 SINSPIVNFQQSFERLVNTNSKQEKEIFDLKLKIAQLSSVNYNGQYKSDNGGEMIPLSLH 826
Query: 903 IIDCEDKKAFTKVTENFAKEFSSSPIQLTISKGGKVLCQXXXXXXXXXXXXXADTVLKQL 1082
IIDCEDKKAFTKVTENFAKEFSSSPIQLTISKGGKVLCQ ADTVLKQL
Sbjct: 827 IIDCEDKKAFTKVTENFAKEFSSSPIQLTISKGGKVLCQLLSSSSSSSSSLSADTVLKQL 886
Query: 1083 FKSIGMGKGGGNKLMANASIQPLNNEILNSILN 1181
FKSIGMGKGGGNKLMANASIQPLNNEILNSILN
Sbjct: 887 FKSIGMGKGGGNKLMANASIQPLNNEILNSILN 919
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,690,732,988
Number of extensions: 30226486
Number of successful extensions: 70090
Number of sequences better than 10.0: 817
Number of HSP's gapped: 68626
Number of HSP's successfully gapped: 825
Length of query: 408
Length of database: 1,061,185,681
Length adjustment: 131
Effective length of query: 277
Effective length of database: 633,018,993
Effective search space: 175346261061
Effective search space used: 175346261061
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
6 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
1 |
| SF (FL, S) |
0 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |