Contig-U16406-1
Contig ID Contig-U16406-1
Contig update 2004. 6.11
Contig sequence
>Contig-U16406-1 (Contig-U16406-1Q) /CSM_Contig/Contig-U16406-1Q.Seq.d
GGAGCTAAATTGAGGGAAAAAGCTTAAATGACAAATTTAAGGTTTAAGGG
GAAAAGATAGGAGAAATAGAAGAGAGTAGTAAGAGAAAAATGTTTATAAC
GGATTCTCTATGCAAATAAGAAAAAGGACGTACGAATGAACGAAAGGTTA
TAGGGAAAATATAAAAAAGAGTTAGCAATAGCAATTGAAGATCTATAAAT
ATCCGAAGGGAGACCAAGAAAAAGAAGAAACGCAGTGAAGTGAAACATCT
TAGTAACTGTAGGAAAAAACAAAAGAGAGAAGAGAGAGAAGAGAGAGGAG
AGAGAGGAAATTAAAAATTTAAAAATAAAAAAATTAATAAAAAAAGCTAT
TATTTATGGTTTTATAATAGAAACATTTGGTTATTAATTTTTGTTATTAA
CAAAATTAATAAATTAATAATTAATATATAAATGTATCAACAACAACCAA
AAAATCAAAAACAATGTAAAAATATTGCACTACATGGTTATTGTCGAAAT
AGTGATAAATGCGAATTTAGTCACGAATTAACACCTCAGCAACAACAACA
ACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAAC
AACAACAACAACAACAACAACAACAGCAACAACAACAAAATTCACCAACA
TCACAAAATAATCAACAGACAAAGAGTTAATAAACAAAATATACCAGCAT
TAGAGATAATATATTCAAGTTTAACATTTGGATGGTATAAAAGTTTTAAA
TTATCAAAAATGAATAGAT

Gap no gap
Contig length 769
Chromosome number (1..6, M) 3
Chromosome length 6358359
Start point 1553193
End point 1552622
Strand (PLUS/MINUS) MINUS
Number of clones 62
Number of EST 86
Link to clone list U16406
List of clone(s)

est1=SLG289F,1,165
est2=VSA268E,9,214
est3=VSB752E,22,415
est4=VSK340F,22,293
est5=VSD842F,29,254
est6=VSD842Z,30,230
est7=VSF886Z,78,552
est8=SHC457F,81,687
est9=SHH465F,88,686
est10=VFF664F,90,544
est11=VSF886F,90,578
est12=VSD419F,91,430
est13=VSD419Z,91,413
est14=VFL285F,97,553
est15=VFL285Z,97,542
est16=VSF778F,98,224
est17=VSI205F,98,544
est18=VSB175E,99,263
est19=VSJ811F,100,282
est20=VSK217F,100,544
est21=VFF664Z,101,503
est22=VSG303F,101,544
est23=VSG303Z,101,513
est24=SLA839F,105,769
est25=VSB755E,105,546
est26=VSE227E,105,541
est27=VSH155F,105,544
est28=VSH155Z,105,518
est29=VSH777Z,105,519
est30=VSK228F,105,544
est31=VSK228Z,105,520
est32=VSB649E,107,542
est33=VSJ273F,107,544
est34=VSJ273Z,107,528
est35=VSK217Z,108,518
est36=VSA445E,109,561
est37=VSF468F,109,544
est38=VSF468Z,109,519
est39=VSH777F,109,535
est40=VSI459F,109,544
est41=VSI459Z,109,518
est42=VSB269E,110,557
est43=VSC484E,110,436
est44=VSG460F,110,531
est45=VSG460Z,110,523
est46=VSG806F,110,544
est47=VSK401F,111,544
est48=VSK401Z,111,518
est49=SLB654F,113,704
est50=VSA349E,113,543
est51=VSA573E,113,576
est52=VSB259E,113,543
est53=VSD387F,113,544
est54=VSD387Z,113,527
est55=VSI274F,113,544
est56=VSI274Z,113,520
est57=VSD391F,117,544
est58=VSD391Z,117,517
est59=VSI419Z,117,519
est60=VSI419F,118,544
est61=VSD306F,120,544
est62=VSD306Z,120,524
est63=VSG896F,121,544
est64=SHG307F,129,642
est65=FC-IC0278E,132,463
est66=FC-IC0279E,132,463
est67=SFG252F,132,523
est68=VSF859F,135,679
est69=VSK266F,141,544
est70=VSK266Z,141,519
est71=VSF783F,149,725
est72=SSL666F,152,733
est73=VHM244F,162,499
est74=VHM244Z,162,465
est75=VSA683Z,166,759
est76=VSF783Z,169,569
est77=VSI205Z,170,519
est78=VHA141F,173,609
est79=VHA141Z,173,598
est80=VSG190Z,186,502
est81=VSI695F,195,544
est82=VSI695Z,195,518
est83=FC-IC1661Z,209,621
est84=SLE578Z,216,509
est85=VSB616Z,238,563
est86=VSF859Z,287,647
Translated Amino Acid sequence
s*iegkslndkfkv*gekigeieesskrkmfitdslck*ekgrtnerkvigki*krvsns
n*rsinirretkkkkkrsevkhlsncrkkqkreereergergn*kfknkkinkksyylwf
ynrniwllifvinkinkliini*MYQQQPKNQKQCKNIALHGYCRNSDKCEFSHELTPQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQNSPTSQNNQQTKS**tkytsirdnifkf
niwmv*kf*iikne*


Translated Amino Acid sequence (All Frames)
Frame A:
gaklreka*mtnlrfkgkr*ek*krvvrekcl*rilyankkkdvrmnerl*gkykkelai
aiedl*isegrprkrrnavk*nilvtvgknkrekrekreereeiknlkikklikkaiiyg
fiietfgy*fllltklin**liykcinnnqkiknnvkilhymviveivinanlvtn*hls
nnnnnnnnnnnnnnnnnnnnnnnnnnnnsnnnkihqhhkiinrqrvnkqnipaleiiyss
ltfgwyksfklskmnr


Frame B:
eln*gkklk*qi*glrgkdrrnrre**eknvyngfsmqirkrtye*tkgyrenikks*q*
qlkiykypkgdqekeetq*sets**l*ektkerrerrerrerklki*k*kn**kkllfmv
l**khlvinfcy*qn**inn*yinvstttkksktm*kycttwllsk***mri*srintsa
ttttttttttttttttttttttttttttatttkftnitk*stdkelinkiyqh*r*yiqv
*hldgikvlnyqk*id


Frame C:
s*iegkslndkfkv*gekigeieesskrkmfitdslck*ekgrtnerkvigki*krvsns
n*rsinirretkkkkkrsevkhlsncrkkqkreereergergn*kfknkkinkksyylwf
ynrniwllifvinkinkliini*MYQQQPKNQKQCKNIALHGYCRNSDKCEFSHELTPQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQNSPTSQNNQQTKS**tkytsirdnifkf
niwmv*kf*iikne*


own update 2004. 6.23
Homology vs CSM-cDNA
Query= Contig-U16406-1 (Contig-U16406-1Q)
/CSM_Contig/Contig-U16406-1Q.Seq.d
(769 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U16406-1 (Contig-U16406-1Q) /CSM_Contig/Conti... 541 e-154
Contig-U16407-1 (Contig-U16407-1Q) /CSM_Contig/Conti... 260 3e-69
Contig-U15357-1 (Contig-U15357-1Q) /CSM_Contig/Conti... 133 4e-31
Contig-U10043-1 (Contig-U10043-1Q) /CSM_Contig/Conti... 100 6e-21
Contig-U16510-1 (Contig-U16510-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U14875-1 (Contig-U14875-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U11225-1 (Contig-U11225-1Q) /CSM_Contig/Conti... 36 0.077
Contig-U15659-1 (Contig-U15659-1Q) /CSM_Contig/Conti... 34 0.30
Contig-U09287-1 (Contig-U09287-1Q) /CSM_Contig/Conti... 34 0.30

>Contig-U16406-1 (Contig-U16406-1Q) /CSM_Contig/Contig-U16406-1Q.Seq.d
Length = 769

Score = 541 bits (273), Expect = e-154
Identities = 273/273 (100%)
Strand = Plus / Plus


Query: 1 ggagctaaattgagggaaaaagcttaaatgacaaatttaaggtttaaggggaaaagatag 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ggagctaaattgagggaaaaagcttaaatgacaaatttaaggtttaaggggaaaagatag 60


Query: 61 gagaaatagaagagagtagtaagagaaaaatgtttataacggattctctatgcaaataag 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 gagaaatagaagagagtagtaagagaaaaatgtttataacggattctctatgcaaataag 120


Query: 121 aaaaaggacgtacgaatgaacgaaaggttatagggaaaatataaaaaagagttagcaata 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 aaaaaggacgtacgaatgaacgaaaggttatagggaaaatataaaaaagagttagcaata 180


Query: 181 gcaattgaagatctataaatatccgaagggagaccaagaaaaagaagaaacgcagtgaag 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 gcaattgaagatctataaatatccgaagggagaccaagaaaaagaagaaacgcagtgaag 240


Query: 241 tgaaacatcttagtaactgtaggaaaaaacaaa 273
|||||||||||||||||||||||||||||||||
Sbjct: 241 tgaaacatcttagtaactgtaggaaaaaacaaa 273


Score = 260 bits (131), Expect = 3e-69
Identities = 131/131 (100%)
Strand = Plus / Plus


Query: 639 aattcaccaacatcacaaaataatcaacagacaaagagttaataaacaaaatataccagc 698
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 639 aattcaccaacatcacaaaataatcaacagacaaagagttaataaacaaaatataccagc 698


Query: 699 attagagataatatattcaagtttaacatttggatggtataaaagttttaaattatcaaa 758
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 699 attagagataatatattcaagtttaacatttggatggtataaaagttttaaattatcaaa 758


Query: 759 aatgaatagat 769
|||||||||||
Sbjct: 759 aatgaatagat 769


Score = 133 bits (67), Expect = 4e-31
Identities = 67/67 (100%)
Strand = Plus / Plus


Query: 473 tattgcactacatggttattgtcgaaatagtgataaatgcgaatttagtcacgaattaac 532
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 473 tattgcactacatggttattgtcgaaatagtgataaatgcgaatttagtcacgaattaac 532


Query: 533 acctcag 539
|||||||
Sbjct: 533 acctcag 539


Score = 67.9 bits (34), Expect = 2e-11
Identities = 34/34 (100%)
Strand = Plus / Plus


Query: 346 gctattatttatggttttataatagaaacatttg 379
||||||||||||||||||||||||||||||||||
Sbjct: 346 gctattatttatggttttataatagaaacatttg 379


>Contig-U16407-1 (Contig-U16407-1Q) /CSM_Contig/Contig-U16407-1Q.Seq.d
Length = 1678

Score = 260 bits (131), Expect = 3e-69
Identities = 131/131 (100%)
Strand = Plus / Plus


Query: 639 aattcaccaacatcacaaaataatcaacagacaaagagttaataaacaaaatataccagc 698
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 370 aattcaccaacatcacaaaataatcaacagacaaagagttaataaacaaaatataccagc 429


Query: 699 attagagataatatattcaagtttaacatttggatggtataaaagttttaaattatcaaa 758
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 430 attagagataatatattcaagtttaacatttggatggtataaaagttttaaattatcaaa 489


Query: 759 aatgaatagat 769
|||||||||||
Sbjct: 490 aatgaatagat 500


Score = 133 bits (67), Expect = 4e-31
Identities = 67/67 (100%)
Strand = Plus / Plus


Query: 473 tattgcactacatggttattgtcgaaatagtgataaatgcgaatttagtcacgaattaac 532
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 204 tattgcactacatggttattgtcgaaatagtgataaatgcgaatttagtcacgaattaac 263


Query: 533 acctcag 539
|||||||
Sbjct: 264 acctcag 270


Score = 67.9 bits (34), Expect = 2e-11
Identities = 34/34 (100%)
Strand = Plus / Plus


Query: 346 gctattatttatggttttataatagaaacatttg 379
||||||||||||||||||||||||||||||||||
Sbjct: 77 gctattatttatggttttataatagaaacatttg 110


>Contig-U15357-1 (Contig-U15357-1Q) /CSM_Contig/Contig-U15357-1Q.Seq.d
Length = 1219

Score = 133 bits (67), Expect = 4e-31
Identities = 67/67 (100%)
Strand = Plus / Plus


Query: 473 tattgcactacatggttattgtcgaaatagtgataaatgcgaatttagtcacgaattaac 532
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 156 tattgcactacatggttattgtcgaaatagtgataaatgcgaatttagtcacgaattaac 215


Query: 533 acctcag 539
|||||||
Sbjct: 216 acctcag 222


Score = 67.9 bits (34), Expect = 2e-11
Identities = 34/34 (100%)
Strand = Plus / Plus


Query: 346 gctattatttatggttttataatagaaacatttg 379
||||||||||||||||||||||||||||||||||
Sbjct: 29 gctattatttatggttttataatagaaacatttg 62


Database: CSM
Posted date: Jun 21, 2004 1:35 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 9596
Number of Sequences: 8402
Number of extensions: 9596
Number of successful extensions: 1245
Number of sequences better than 10.0: 148
length of query: 769
length of database: 8,075,542
effective HSP length: 16
effective length of query: 753
effective length of database: 7,941,110
effective search space: 5979655830
effective search space used: 5979655830
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 3.30
Homology vs DNA
Query= Contig-U16406-1 (Contig-U16406-1Q) /CSM_Contig/Contig-U16406-1Q.Seq.d
(769 letters)

Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AB000109) Dictyostelium discoideum mitochondrial DNA, compl... 327 e-141 2
(D16466) Dictyostelium discoideum mitochondrial genes for la... 327 e-141 2
(AU262222) Dictyostelium discoideum vegetative cDNA clone:VS... 327 e-128 2
(AU271030) Dictyostelium discoideum vegetative cDNA clone:VS... 327 e-128 2
(AU264639) Dictyostelium discoideum vegetative cDNA clone:VS... 250 e-100 2
(AU264638) Dictyostelium discoideum vegetative cDNA clone:VS... 250 e-100 2
(AU266104) Dictyostelium discoideum vegetative cDNA clone:VS... 228 3e-99 2
(AU265906) Dictyostelium discoideum vegetative cDNA clone:VS... 149 5e-95 4
(AU265952) Dictyostelium discoideum vegetative cDNA clone:VS... 357 4e-94 1
(AU261387) Dictyostelium discoideum vegetative cDNA clone:VS... 220 7e-94 2
(BJ392668) Dictyostelium discoideum cDNA clone:dds28b16, 5' ... 327 3e-93 2
(BJ395337) Dictyostelium discoideum cDNA clone:dds38b18, 5' ... 327 4e-89 2
(AU265951) Dictyostelium discoideum vegetative cDNA clone:VS... 327 6e-88 2
(AU263997) Dictyostelium discoideum vegetative cDNA clone:VS... 327 2e-87 2
(AU263998) Dictyostelium discoideum vegetative cDNA clone:VS... 327 2e-87 2
(AU270509) Dictyostelium discoideum vegetative cDNA clone:VS... 327 4e-85 1
(AU060278) Dictyostelium discoideum slug cDNA, clone SLA839. 325 1e-84 1
(AU261870) Dictyostelium discoideum vegetative cDNA clone:VS... 317 3e-82 1
(AU060834) Dictyostelium discoideum slug cDNA, clone SLB654. 309 8e-80 1
(AU061840) Dictyostelium discoideum slug cDNA, clone SLG289. 206 8e-78 2
(BJ394700) Dictyostelium discoideum cDNA clone:dds36n01, 5' ... 278 3e-70 1
(AU271471) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 274 5e-69 1
(AU271470) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 274 5e-69 1
(AU271473) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 264 4e-66 1
(AJ512794) Dictyostelium discoideum mRNA for LIS1 protein. 254 4e-63 1
(AJ512336) Dictyostelium discoideum mRNA for LIS1 protein. 254 4e-63 1
(AU265785) Dictyostelium discoideum vegetative cDNA clone:VS... 232 2e-56 1
(DQ336395) Dictyostelium citrinum mitochondrion, complete ge... 92 5e-56 5
(AU265777) Dictyostelium discoideum vegetative cDNA clone:VS... 228 2e-55 1
(AU271472) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 226 1e-54 1
(AU261657) Dictyostelium discoideum vegetative cDNA clone:VS... 206 9e-49 1
(AU265786) Dictyostelium discoideum vegetative cDNA clone:VS... 198 2e-46 1
(AU265778) Dictyostelium discoideum vegetative cDNA clone:VS... 157 7e-34 1
(BJ332723) Dictyostelium discoideum cDNA clone:dda40i16, 5' ... 157 7e-34 1
(BJ332328) Dictyostelium discoideum cDNA clone:dda38a19, 5' ... 157 7e-34 1
(BJ330922) Dictyostelium discoideum cDNA clone:dda33b07, 5' ... 151 5e-32 1
(EU339291) Dictyostelium purpureum strain WS321 tRNA-Pro gen... 64 4e-29 4
(EL718010) CBSS2180.fwd NICHD_XGC_tropSp1 Xenopus (Silurana)... 68 2e-27 4
(EL718009) CBSS2180.rev NICHD_XGC_tropSp1 Xenopus (Silurana)... 68 2e-27 4
(BJ393680) Dictyostelium discoideum cDNA clone:dds32o06, 5' ... 133 1e-26 1
(BJ369818) Dictyostelium discoideum cDNA clone:ddc51k21, 5' ... 127 4e-26 2
(BJ394134) Dictyostelium discoideum cDNA clone:dds33m20, 5' ... 127 4e-26 2
(BJ397363) Dictyostelium discoideum cDNA clone:dds46d01, 5' ... 127 4e-26 2
(BJ334030) Dictyostelium discoideum cDNA clone:dda44j19, 5' ... 127 5e-26 2
(EL725126) CBSS6132.rev NICHD_XGC_tropSp1 Xenopus (Silurana)... 68 6e-23 3
(AU265907) Dictyostelium discoideum vegetative cDNA clone:VS... 113 6e-22 2
(EL725127) CBSS6132.fwd NICHD_XGC_tropSp1 Xenopus (Silurana)... 68 1e-17 3
(AU262882) Dictyostelium discoideum vegetative cDNA clone:VS... 100 1e-16 1
(AU266105) Dictyostelium discoideum vegetative cDNA clone:VS... 88 6e-13 1
(EU275727) Dictyostelium fasciculatum strain SH3 mitochondri... 44 1e-04 2
(AY700145) Polysphondylium pallidum mitochondrion DNA, compl... 44 1e-04 2
(DQ840500) Acholeplasma axanthum strain MSX 16S ribosomal RN... 60 1e-04 1
(DQ840499) Acholeplasma axanthum strain MSX 16S ribosomal RN... 60 1e-04 1
(DQ840498) Acholeplasma axanthum strain Panangala 58 16S rib... 60 1e-04 1
(DQ840497) Acholeplasma axanthum strain Panangala 58 16S rib... 60 1e-04 1
(CF922644) gmrhRww24-13-T7_F02_1_006 Soybean root hair subtr... 58 5e-04 1
(CF922581) gmrhRww24-12-T7_H07_1_049 Soybean root hair subtr... 58 5e-04 1
(CF712708) CCADY35TR C.neoformans strain JEC21 Cryptococcus ... 58 5e-04 1
(CF708961) CCAEF63TR C.neoformans strain JEC21 Cryptococcus ... 58 5e-04 1
(EU168786) Pepper Stolbur phytoplasma 16S ribosomal RNA gene... 58 5e-04 1
(EU168778) Catharanthus phyllody phytoplasma 16S ribosomal R... 58 5e-04 1
(DQ840496) Acholeplasma axanthum strain 1025G 16S ribosomal ... 58 5e-04 1
(DQ840495) Acholeplasma axanthum strain 1025G 16S ribosomal ... 58 5e-04 1
(DQ400426) Acholeplasma axanthum strain S743 operon 2 16S ri... 58 5e-04 1
(DQ400425) Acholeplasma axanthum strain S743 operon 1 16S ri... 58 5e-04 1
(DQ400424) Acholeplasma axanthum strain S410 operon 2 16S ri... 58 5e-04 1
(DQ400423) Acholeplasma axanthum strain 0626 operon 2 16S ri... 58 5e-04 1
(DQ400422) Acholeplasma axanthum strain 0626 operon 1 16S ri... 58 5e-04 1
(AY786573) Acholeplasma axanthum 16S ribosomal RNA gene, par... 58 5e-04 1
(AJ970675) Candidatus Phytoplasma solani 16S rRNA gene (part... 58 5e-04 1
(AF193903) Cafeteria roenbergensis mitochondrial DNA, comple... 56 0.002 1
(DQ398104) Helicosporidium sp. ex Simulium jonesii plastid, ... 54 0.005 3
(AJ294725) Astasia longa complete chloroplast genome. 54 0.008 1
(DI089722) DNA Probe Derived from 23S rRNA Gene for Detectio... 54 0.008 1
(DI062367) DNA Probe Derived from 23S rRNA Gene for Detectio... 54 0.008 1
(ET629122) bext_c_1 Bulleidia extructa W1219 genomic library... 54 0.008 1
(EU061360) Uncultured bacterium clone LM0ABA5ZA11RM1 genomic... 54 0.008 1
(EU061114) Uncultured bacterium clone LM0ABA40ZB08RM1 genomi... 54 0.008 1
(FJ410383) Bacteroides ovatus ATCC:8483 16S ribosomal RNA ge... 54 0.008 1
(EU168773) Tanzanian lethal decline phytoplasma 16S ribosoma... 54 0.008 1
(EU168771) Coconut lethal yellowing phytoplasma isolate HV 1... 54 0.008 1
(EU168770) Coconut lethal yellowing phytoplasma isolate AM 1... 54 0.008 1
(EU168761) Soybean phyllody phytoplasma 16S ribosomal RNA ge... 54 0.008 1
(EU168760) 'Crotalaria saltiana' phyllody phytoplasma 16S ri... 54 0.008 1
(EU168759) Faba bean phyllody phytoplasma 16S ribosomal RNA ... 54 0.008 1
(AF086621) Loofah witches'-broom phytoplasma tRNA-Ile gene, ... 54 0.008 1
(AE015928) Bacteroides thetaiotaomicron VPI-5482, complete g... 54 0.008 1
(AY101381) Cryptococcus neoformans var. grubii strain H99 mi... 52 0.031 1
(EG973345) THCK-2145 Tamarix hispida roots Tamarix hispida c... 52 0.031 1
(AU270985) Dictyostelium discoideum vegetative cDNA clone:VS... 52 0.031 1
(AU250208) Lolium multiflorum cDNA clone:SL007G02-5. 52 0.031 1
(CU470755) Theobroma cacao, mRNA sequence (KZ0ACI5YE16FM1). 52 0.031 1
(AJ917483) Trichoderma stromaticum EST, clone L56TSTP009R00796. 52 0.031 1
(AJ917292) Trichoderma stromaticum EST, clone L55TSTP007R00586. 52 0.031 1
(AJ917258) Trichoderma stromaticum EST, clone L55TSTP006R00551. 52 0.031 1
(AJ916908) Trichoderma stromaticum EST, clone L55TSTP002R00168. 52 0.031 1
(AJ916880) Trichoderma stromaticum EST, clone L55TSTP002R00136. 52 0.031 1
(AJ916866) Trichoderma stromaticum EST, clone L55TSTP002R00121. 52 0.031 1
(AJ915484) Trichoderma harzianum EST, clone L52T3KP019R01817. 52 0.031 1
(AJ915483) Trichoderma harzianum EST, clone L52T3KP019R01816. 52 0.031 1
(AJ915148) Trichoderma harzianum EST, clone L52T3KP016R01460. 52 0.031 1
(AJ915138) Trichoderma harzianum EST, clone L52T3KP016R01448. 52 0.031 1
(AJ914992) Trichoderma harzianum EST, clone L52T3KP014R01293. 52 0.031 1
(EU168783) Candidatus Phytoplasma prunorum 16S ribosomal RNA... 52 0.031 1
(EU168782) German stone fruit yellows phytoplasma 16S riboso... 52 0.031 1
(EG448549) AYANA93TF pooled cDNA populations Arabidopsis tha... 50 0.12 1
(EB309825) CNSN01-F-072101-501 Normalized CNS library (juven... 50 0.12 1
(EU063557) Uncultured bacterium clone LM0ACA28ZD06FM1 genomi... 50 0.12 1
(EU062210) Uncultured bacterium clone LM0ACA1ZC04FM1 genomic... 50 0.12 1
(EU058015) Uncultured bacterium clone LM0ABA1ZC10FM1 genomic... 50 0.12 1
(AY701492) Uncultured Bacteroidales bacterium SHDogd 23S rib... 50 0.12 1
(EU168787) Mexican periwinkle virescence phytoplasma 16S rib... 50 0.12 1
(EU168785) Cordyline phytoplasma 16S ribosomal RNA gene, par... 50 0.12 1
(EU168784) Napier grass stunt phytoplasma 16S ribosomal RNA ... 50 0.12 1
(EU168780) Pigeon pea witches'-broom phytoplasma 16S ribosom... 50 0.12 1
(EU168777) Brinjal little leaf phytoplasma 16S ribosomal RNA... 50 0.12 1
(EU168776) Potato witches'-broom phytoplasma 16S ribosomal R... 50 0.12 1
(EU168765) Lime witches'-broom phytoplasma 16S ribosomal RNA... 50 0.12 1
(EU168764) Ipomoea phytoplasma 16S ribosomal RNA gene, parti... 50 0.12 1
(DQ836329) Napier grass stunt phytoplasma 23S ribosomal RNA ... 50 0.12 1
(CP000828) Acaryochloris marina MBIC11017, complete genome. 50 0.12 1
(AY768383) Plectonema terebrans CCAP 1463/4 16S ribosomal RN... 50 0.12 1
(AM709631) Spirulina sp. PCC 6313 partial ribosomal RNA oper... 50 0.12 1
(AM422018) Candidatus Phytoplasma australiense complete genome. 50 0.12 1
(AY945289) Fusarium oxysporum strain F11 mitochondrion, comp... 48 0.21 2
(AF447590) Hypocrea jecorina mitochondrion, complete genome. 48 0.25 2
(EF506945) Leptosira terrestris UTEX 333 chloroplast, comple... 48 0.27 2
(CU928861) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 36 0.27 2
(CU856454) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 36 0.28 2
(EC745821) PSE00004551 rw_mgpallid Polysphondylium pallidum ... 44 0.38 2
(X06961) Aspergillus nidlans mitochondrial DNA for L-rRNA. 48 0.49 1
(L44126) Scherffelia dubia chloroplast large-subunit ribosom... 48 0.49 1
(L42860) Chlorogonium elongatum chloroplast large-subunit ri... 48 0.49 1
(J01390) Emericella nidulans mtDNA between h2/h5 and bh2/b2 ... 48 0.49 1
(DQ217399) Aspergillus tubingensis strain 0932 mitochondrion... 48 0.49 1
(DQ207726) Aspergillus niger strain N909 mitochondrion, comp... 48 0.49 1
(AY874423) Fusarium oxysporum voucher VPRI 19292 mitochondri... 48 0.49 1
(AY072697) Hypocrea pseudokoningii small subunit ribosomal R... 48 0.49 1
(AP007176) Aspergillus oryzae RIB40 mitochondrial DNA, compl... 48 0.49 1
(AF393609) Scherffelia dubia small subunit ribosomal RNA (rr... 48 0.49 1
(GC479828) Sequence 496 from patent US 7387875. 48 0.49 1
(CS066513) Sequence 496 from Patent WO2005030998. 48 0.49 1
(AL138958) Human DNA sequence from clone RP11-206I15 on chro... 48 0.49 1
(AC155856) Bos taurus clone CH240-41F7, WORKING DRAFT SEQUEN... 48 0.49 1
(AQ678528) HS_2130_B2_G01_T7C CIT Approved Human Genomic Spe... 48 0.49 1
(ER463175) 1092963907060 Global-Ocean-Sampling_GS-35-01-01-1... 48 0.49 1
(EK502725) 1095505927365 Global-Ocean-Sampling_GS-32-01-01-1... 48 0.49 1
(EK037556) 1092959478727 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.49 1
(EJ992248) 1093023059009 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.49 1
(EJ987255) 1093023019265 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.49 1
(EJ863108) 1093018224558 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.49 1
(EJ588887) 1092961036977 Global-Ocean-Sampling_GS-29-01-01-1... 48 0.49 1
(EJ525831) 1092955184409 Global-Ocean-Sampling_GS-29-01-01-1... 48 0.49 1
(EJ391307) 1092963934939 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.49 1
(EJ372109) 1092963728099 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.49 1
(EH057839) 16 YRP Non-Erumpent Sustractive Library Sclerotiu... 48 0.49 1
(EG993948) 031118NL19EMM00043C03 NL19EMM Neotyphodium lolii ... 48 0.49 1
(EG970404) TH48-1948 Tamarix hispida roots Tamarix hispida c... 48 0.49 1
(EG967533) TH24-2116 Tamarix hispida roots Tamarix hispida c... 48 0.49 1
(EG966426) TH24-1118 Tamarix hispida roots Tamarix hispida c... 48 0.49 1
(EG966390) TH24-106 Tamarix hispida roots Tamarix hispida cD... 48 0.49 1
(DR676711) EST1066828 FvO Gibberella moniliformis cDNA clone... 48 0.49 1
(DR674273) EST1064390 FvO Gibberella moniliformis cDNA clone... 48 0.49 1
(DR671475) EST1061592 FvO Gibberella moniliformis cDNA clone... 48 0.49 1
(DR667709) EST1057826 FvO Gibberella moniliformis cDNA clone... 48 0.49 1
(CU619708) Theobroma cacao, mRNA sequence (KZ0AAA1YA18FM1). 48 0.49 1
(CU614919) Theobroma cacao, mRNA sequence (KZ0AAN1YA07). 48 0.49 1
(CU523706) Theobroma cacao, mRNA sequence (KZ0ACS4YL08FM1). 48 0.49 1
(CU523640) Theobroma cacao, mRNA sequence (KZ0ACS4YC14FM1). 48 0.49 1
(CU523475) Theobroma cacao, mRNA sequence (KZ0ACS2YK20FM1). 48 0.49 1
(CU523398) Theobroma cacao, mRNA sequence (KZ0ACS1YO14FM1). 48 0.49 1
(CU523168) Theobroma cacao, mRNA sequence (KZ0ACS4YF16FM1). 48 0.49 1
(CU490189) Theobroma cacao, mRNA sequence (KZ0ACAE1YM02FM1). 48 0.49 1
(CO653860) CB8-G01a HlF HSS cDNA Humulus lupulus cDNA clone ... 48 0.49 1
(CO653843) CB8-E01a HlF HSS cDNA Humulus lupulus cDNA clone ... 48 0.49 1
(CO136921) EST831592 Aspergillus flavus Normalized cDNA Expr... 48 0.49 1
(CK911907) e3fmgq_000343 Normalized Magnaporthe grisea cDNA ... 48 0.49 1
(CI765662) Oryza sativa Japonica Group cDNA, clone: J10B0043... 48 0.49 1
(AJ918837) Trichoderma harzianum EST, clone L59T22P004R00354. 48 0.49 1
(AJ918444) Trichoderma stromaticum EST, clone L57TSTP020R01869. 48 0.49 1
(AJ918421) Trichoderma stromaticum EST, clone L57TSTP020R01846. 48 0.49 1
(AJ918222) Trichoderma stromaticum EST, clone L57TSTP017R01616. 48 0.49 1
(AJ918104) Trichoderma stromaticum EST, clone L56TSTP016R01495. 48 0.49 1
(AJ918098) Trichoderma stromaticum EST, clone L56TSTP016R01489. 48 0.49 1
(AJ918085) Trichoderma stromaticum EST, clone L56TSTP016R01476. 48 0.49 1
(AJ918004) Trichoderma stromaticum EST, clone L56TSTP015R01387. 48 0.49 1
(AJ917846) Trichoderma stromaticum EST, clone L56TSTP013R01211. 48 0.49 1
(AJ917825) Trichoderma stromaticum EST, clone L56TSTP013R01188. 48 0.49 1
(AJ917810) Trichoderma stromaticum EST, clone L56TSTP013R01169. 48 0.49 1
(AJ917444) Trichoderma stromaticum EST, clone L55TSTP008R00754. 48 0.49 1
(AJ917439) Trichoderma stromaticum EST, clone L55TSTP008R00749. 48 0.49 1
(AJ917393) Trichoderma stromaticum EST, clone L55TSTP008R00700. 48 0.49 1
(AJ917390) Trichoderma stromaticum EST, clone L55TSTP008R00697. 48 0.49 1
(AJ917159) Trichoderma stromaticum EST, clone L55TSTP005R00444. 48 0.49 1
(AJ917131) Trichoderma stromaticum EST, clone L55TSTP005R00413. 48 0.49 1
(AJ917076) Trichoderma stromaticum EST, clone L55TSTP004R00354. 48 0.49 1
(AJ917059) Trichoderma stromaticum EST, clone L55TSTP004R00336. 48 0.49 1
(AJ917006) Trichoderma stromaticum EST, clone L55TSTP003R00275. 48 0.49 1
(AJ916984) Trichoderma stromaticum EST, clone L55TSTP003R00249. 48 0.49 1
(AJ916976) Trichoderma stromaticum EST, clone L55TSTP003R00241. 48 0.49 1
(AJ916902) Trichoderma stromaticum EST, clone L55TSTP002R00161. 48 0.49 1
(AJ916799) Trichoderma stromaticum EST, clone L55TSTP001R00050. 48 0.49 1
(AJ916786) Trichoderma stromaticum EST, clone L55TSTP001R00032. 48 0.49 1
(AJ916607) Trichoderma atroviride EST, clone L54TP1P032R03026. 48 0.49 1
(AJ916541) Trichoderma atroviride EST, clone L54TP1P031R02957. 48 0.49 1
(AJ916499) Trichoderma atroviride EST, clone L54TP1P031R02910. 48 0.49 1
(AJ916464) Trichoderma atroviride EST, clone L54TP1P030R02870. 48 0.49 1
(AJ916459) Trichoderma atroviride EST, clone L54TP1P030R02865. 48 0.49 1
(AJ916426) Trichoderma atroviride EST, clone L54TP1P030R02831. 48 0.49 1
(AJ916403) Trichoderma atroviride EST, clone L54TP1P030R02808. 48 0.49 1
(AJ916396) Trichoderma atroviride EST, clone L54TP1P030R02801. 48 0.49 1
(AJ916383) Trichoderma atroviride EST, clone L54TP1P030R02786. 48 0.49 1
(AJ916381) Trichoderma atroviride EST, clone L54TP1P029R02782. 48 0.49 1
(AJ916362) Trichoderma atroviride EST, clone L54TP1P029R02760. 48 0.49 1
(AJ916266) Trichoderma atroviride EST, clone L53TP1P028R02645. 48 0.49 1
(AJ916255) Trichoderma atroviride EST, clone L53TP1P028R02634. 48 0.49 1
(AJ916249) Trichoderma atroviride EST, clone L53TP1P028R02628. 48 0.49 1
(AJ916228) Trichoderma atroviride EST, clone L53TP1P028R02606. 48 0.49 1
(AJ916210) Trichoderma atroviride EST, clone L53TP1P027R02588. 48 0.49 1
(AJ915972) Trichoderma atroviride EST, clone L53TP1P025R02336. 48 0.49 1
(AJ915864) Trichoderma atroviride EST, clone L53TP1P024R02227. 48 0.49 1
(AJ915768) Trichoderma atroviride EST, clone L53TP1P023R02126. 48 0.49 1
(AJ915759) Trichoderma atroviride EST, clone L53TP1P023R02117. 48 0.49 1
(AJ915676) Trichoderma atroviride EST, clone L53TP1P022R02033. 48 0.49 1
(AJ915649) Trichoderma atroviride EST, clone L53TP1P021R02006. 48 0.49 1
(AJ915640) Trichoderma atroviride EST, clone L53TP1P021R01997. 48 0.49 1
(AJ915632) Trichoderma atroviride EST, clone L53TP1P021R01988. 48 0.49 1
(AJ915481) Trichoderma harzianum EST, clone L52T3KP019R01814. 48 0.49 1
(AJ915431) Trichoderma harzianum EST, clone L52T3KP019R01760. 48 0.49 1
(AJ915356) Trichoderma harzianum EST, clone L52T3KP018R01681. 48 0.49 1
(AJ915350) Trichoderma harzianum EST, clone L52T3KP018R01675. 48 0.49 1
(AJ915307) Trichoderma harzianum EST, clone L52T3KP017R01631. 48 0.49 1
(AJ915295) Trichoderma harzianum EST, clone L52T3KP017R01619. 48 0.49 1
(AJ915277) Trichoderma harzianum EST, clone L52T3KP017R01599. 48 0.49 1
(AJ915220) Trichoderma harzianum EST, clone L52T3KP017R01541. 48 0.49 1
(AJ915189) Trichoderma harzianum EST, clone L52T3KP016R01509. 48 0.49 1
(AJ915188) Trichoderma harzianum EST, clone L52T3KP016R01508. 48 0.49 1
(AJ915179) Trichoderma harzianum EST, clone L52T3KP016R01497. 48 0.49 1
(AJ915153) Trichoderma harzianum EST, clone L52T3KP016R01465. 48 0.49 1
(AJ915118) Trichoderma harzianum EST, clone L52T3KP015R01426. 48 0.49 1
(AJ915117) Trichoderma harzianum EST, clone L52T3KP015R01425. 48 0.49 1
(AJ914978) Trichoderma harzianum EST, clone L52T3KP014R01278. 48 0.49 1
(AJ914866) Trichoderma harzianum EST, clone L52T3KP013R01160. 48 0.49 1
(AJ914783) Trichoderma harzianum EST, clone L52T3KP012R01073. 48 0.49 1
(AJ914657) Trichoderma harzianum EST, clone L52T3KP010R00937. 48 0.49 1
(AJ914625) Trichoderma harzianum EST, clone L52T3KP010R00903. 48 0.49 1
(AJ914621) Trichoderma harzianum EST, clone L52T3KP010R00898. 48 0.49 1
(AJ914607) Trichoderma harzianum EST, clone L52T3KP010R00882. 48 0.49 1
(AJ914574) Trichoderma harzianum EST, clone L52T3KP009R00846. 48 0.49 1
(AJ914551) Trichoderma harzianum EST, clone L52T3KP009R00821. 48 0.49 1
(AJ914518) Trichoderma harzianum EST, clone L52T3KP009R00788. 48 0.49 1
(AJ914487) Trichoderma harzianum EST, clone L52T3KP008R00749. 48 0.49 1
(AJ914459) Trichoderma harzianum EST, clone L52T3KP008R00714. 48 0.49 1
(AJ914445) Trichoderma harzianum EST, clone L52T3KP008R00700. 48 0.49 1
(AJ914443) Trichoderma harzianum EST, clone L52T3KP008R00698. 48 0.49 1
(AJ914418) Trichoderma harzianum EST, clone L52T3KP007R00665. 48 0.49 1
(AJ914362) Trichoderma harzianum EST, clone L52T3KP007R00593. 48 0.49 1
(AJ914289) Trichoderma harzianum EST, clone L52T3KP006R00506. 48 0.49 1
(AJ914229) Trichoderma harzianum EST, clone L52T3KP005R00437. 48 0.49 1
(AJ914214) Trichoderma harzianum EST, clone L52T3KP005R00421. 48 0.49 1
(AJ914097) Trichoderma harzianum EST, clone L52T3KP004R00298. 48 0.49 1
(AJ914020) Trichoderma harzianum EST, clone L52T3KP003R00216. 48 0.49 1
(AJ914019) Trichoderma harzianum EST, clone L52T3KP003R00215. 48 0.49 1
(AJ914001) Trichoderma harzianum EST, clone L52T3KP003R00194. 48 0.49 1
(AJ913996) Trichoderma harzianum EST, clone L52T3KP002R00188. 48 0.49 1
(AJ913983) Trichoderma harzianum EST, clone L52T3KP002R00173. 48 0.49 1
(AJ913967) Trichoderma harzianum EST, clone L52T3KP002R00155. 48 0.49 1
(AJ913958) Trichoderma harzianum EST, clone L52T3KP002R00146. 48 0.49 1
(AJ913954) Trichoderma harzianum EST, clone L52T3KP002R00142. 48 0.49 1
(AJ913933) Trichoderma harzianum EST, clone L52T3KP002R00121. 48 0.49 1
(AJ913829) Trichoderma harzianum EST, clone L52T3KP001R00010. 48 0.49 1
(AJ913775) Trichoderma atroviride EST, clone L51TP1P020R01874. 48 0.49 1
(AJ913647) Trichoderma atroviride EST, clone L51TP1P019R01742. 48 0.49 1
(AJ913536) Trichoderma atroviride EST, clone L51TP1P017R01629. 48 0.49 1
(AJ913220) Trichoderma atroviride EST, clone L51TP1P014R01291. 48 0.49 1
(AJ913109) Trichoderma atroviride EST, clone L51TP1P013R01174. 48 0.49 1
(AJ913040) Trichoderma atroviride EST, clone L51TP1P012R01103. 48 0.49 1
(AJ912961) Trichoderma atroviride EST, clone L51TP1P011R01023. 48 0.49 1
(AJ912713) Trichoderma atroviride EST, clone L51TP1P008R00767. 48 0.49 1
(AJ912683) Trichoderma atroviride EST, clone L51TP1P008R00737. 48 0.49 1
(AJ912682) Trichoderma atroviride EST, clone L51TP1P008R00736. 48 0.49 1
(AJ912650) Trichoderma atroviride EST, clone L51TP1P008R00703. 48 0.49 1
(AJ912636) Trichoderma atroviride EST, clone L51TP1P008R00688. 48 0.49 1
(AJ912434) Trichoderma atroviride EST, clone L51TP1P005R00475. 48 0.49 1
(AJ912312) Trichoderma atroviride EST, clone L51TP1P004R00351. 48 0.49 1
(AJ912260) Trichoderma atroviride EST, clone L51TP1P004R00296. 48 0.49 1
(AJ912238) Trichoderma atroviride EST, clone L51TP1P003R00273. 48 0.49 1
(AJ912217) Trichoderma atroviride EST, clone L51TP1P003R00252. 48 0.49 1
(AJ912156) Trichoderma atroviride EST, clone L51TP1P002R00189. 48 0.49 1
(AJ912065) Trichoderma atroviride EST, clone L51TP1P001R00095. 48 0.49 1
(AJ911953) Trichoderma aggressivum EST, clone L50TH2P020R01896. 48 0.49 1
(AJ911872) Trichoderma aggressivum EST, clone L50TH2P019R01808. 48 0.49 1
(AJ911748) Trichoderma aggressivum EST, clone L50TH2P018R01676. 48 0.49 1
(AJ911747) Trichoderma aggressivum EST, clone L50TH2P018R01675. 48 0.49 1
(AJ911730) Trichoderma aggressivum EST, clone L50TH2P018R01658. 48 0.49 1
(AJ911702) Trichoderma aggressivum EST, clone L50TH2P017R01628. 48 0.49 1
(AJ911670) Trichoderma aggressivum EST, clone L50TH2P017R01591. 48 0.49 1
(AJ911646) Trichoderma aggressivum EST, clone L50TH2P017R01564. 48 0.49 1
(AJ911511) Trichoderma aggressivum EST, clone L50TH2P015R01401. 48 0.49 1
(AJ911415) Trichoderma aggressivum EST, clone L50TH2P014R01276. 48 0.49 1
(AJ911413) Trichoderma aggressivum EST, clone L50TH2P014R01274. 48 0.49 1
(AJ911373) Trichoderma aggressivum EST, clone L50TH2P013R01226. 48 0.49 1
(AJ911266) Trichoderma aggressivum EST, clone L50TH2P012R01107. 48 0.49 1
(AJ911223) Trichoderma aggressivum EST, clone L50TH2P012R01059. 48 0.49 1
(AJ911215) Trichoderma aggressivum EST, clone L50TH2P011R01047. 48 0.49 1
(AJ911205) Trichoderma aggressivum EST, clone L50TH2P011R01036. 48 0.49 1
(AJ911200) Trichoderma aggressivum EST, clone L50TH2P011R01028. 48 0.49 1
(AJ911191) Trichoderma aggressivum EST, clone L50TH2P011R01017. 48 0.49 1
(AJ911165) Trichoderma aggressivum EST, clone L50TH2P011R00982. 48 0.49 1
(AJ911156) Trichoderma aggressivum EST, clone L50TH2P011R00969. 48 0.49 1
(AJ911141) Trichoderma aggressivum EST, clone L50TH2P010R00953. 48 0.49 1
(AJ911125) Trichoderma aggressivum EST, clone L50TH2P010R00934. 48 0.49 1
(AJ911122) Trichoderma aggressivum EST, clone L50TH2P010R00931. 48 0.49 1
(AJ911046) Trichoderma aggressivum EST, clone L50TH2P009R00849. 48 0.49 1
(AJ911037) Trichoderma aggressivum EST, clone L50TH2P009R00839. 48 0.49 1
(AJ911028) Trichoderma aggressivum EST, clone L50TH2P009R00828. 48 0.49 1
(AJ911018) Trichoderma aggressivum EST, clone L50TH2P009R00816. 48 0.49 1
(AJ910986) Trichoderma aggressivum EST, clone L50TH2P009R00780. 48 0.49 1
(AJ910927) Trichoderma aggressivum EST, clone L50TH2P008R00704. 48 0.49 1
(AJ910876) Trichoderma aggressivum EST, clone L50TH2P007R00649. 48 0.49 1
(AJ910831) Trichoderma aggressivum EST, clone L50TH2P007R00600. 48 0.49 1
(AJ910660) Trichoderma aggressivum EST, clone L50TH2P005R00408. 48 0.49 1
(AJ910613) Trichoderma aggressivum EST, clone L50TH2P004R00357. 48 0.49 1
(AJ910471) Trichoderma aggressivum EST, clone L50TH2P003R00205. 48 0.49 1
(AJ910426) Trichoderma aggressivum EST, clone L50TH2P002R00158. 48 0.49 1
(AJ910395) Trichoderma aggressivum EST, clone L50TH2P002R00124. 48 0.49 1
(AJ910386) Trichoderma aggressivum EST, clone L50TH2P002R00115. 48 0.49 1
(AJ910335) Trichoderma aggressivum EST, clone L50TH2P001R00062. 48 0.49 1
(AJ910298) Trichoderma aggressivum EST, clone L50TH2P001R00022. 48 0.49 1
(CF944647) TrEST-A1118 TrEST-A Hypocrea jecorina cDNA clone ... 48 0.49 1
(CF882043) tric029xl18.b11 T.reesei mycelial culture, Versio... 48 0.49 1
(CF881392) tric027xe20.b11 T.reesei mycelial culture, Versio... 48 0.49 1
(CF872058) tric029xl18.b1 T.reesei mycelial culture, Version... 48 0.49 1
(CF869622) tric019xo23.b1 T.reesei mycelial culture, Version... 48 0.49 1
(CF868969) tric017xd02.b1 T.reesei mycelial culture, Version... 48 0.49 1
(CB925347) ABA1_32_H04.g1_A012 Abscisic acid-treated seedlin... 48 0.49 1
(CB902286) tric029xl18 T.reesei mycelial culture, Version 3 ... 48 0.49 1
(CB899769) tric019xo23 T.reesei mycelial culture, Version 3 ... 48 0.49 1
(CB899078) tric017xd02 T.reesei mycelial culture, Version 3 ... 48 0.49 1
(BQ752242) EST632805 DSCT Colletotrichum trifolii cDNA clone... 48 0.49 1
(BQ283802) 156 Bgh mycelium lambda TriplEx2 Blumeria gramini... 48 0.49 1
(AI211489) p0e10a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(AI210121) g9f07a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(AI210095) g9d03a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(AA965608) k5e07a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(BM076903) TrEST-A3031 TrEST-A Hypocrea jecorina cDNA clone ... 48 0.49 1
(BI850072) FS1B20 Fusarium solani f. sp. glycines EST Librar... 48 0.49 1
(AA785553) g8f01a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(AA785535) g8d01a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(AA784778) g2c07a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(AA783833) c8d01a1.r1 Aspergillus nidulans 24hr asexual deve... 48 0.49 1
(GE239006) CAUA1921.fwd CAUA Nectria haematococca mpVI Pisat... 48 0.49 1
(GE216621) CATN11461.fwd CATN Nectria haematococca mpVI Spor... 48 0.49 1
(AW791542) D00651-R Lambda Zap, Stratagene Blumeria graminis... 48 0.49 1
(AW791382) D00506-R Lambda Zap, Stratagene Blumeria graminis... 48 0.49 1
(EW970944) DW1E01061 DW1E (Nitrogen nutrient patch - microco... 48 0.49 1
(EU559167) Candidatus Nitrospira defluvii Contig5882, partia... 48 0.49 1
(EU161602) Lactobacillus fermentum strain CNRZ209 16S-23S ri... 48 0.49 1
(EU161601) Lactobacillus brevis strain ANIE 215 16S-23S ribo... 48 0.49 1
(EU161600) Lactobacillus fermentum strain LMG 9846 16S-23S r... 48 0.49 1
(EU161597) Lactobacillus reuteri strain DSM 20016 16S-23S ri... 48 0.49 1
(CP000705) Lactobacillus reuteri DSM 20016, complete genome. 48 0.49 1
(AP008937) Lactobacillus fermentum IFO 3956 DNA, complete ge... 48 0.49 1
(AP007281) Lactobacillus reuteri JCM 1112 DNA, complete genome. 48 0.49 1
(AJ295318) Tetragenococcus halophilus 23S rRNA gene, strain ... 48 0.49 1
(AF182723) Lactobacillus reuteri 16S ribosomal RNA, partial ... 48 0.49 1
(AF182720) Lactobacillus fermentum 16S ribosomal RNA, partia... 48 0.49 1
(EC761539) PSE00008325 rw_mgpallid Polysphondylium pallidum ... 44 1.0 2
(AJ927897) Theileria annulata EST, clone tam022c05_p1k. 36 1.4 3
(Z17234) Chloroplast Chlamydomonas eugametos rrnL gene. 46 1.9 1
(Z15152) Chloroplast Chlamydomonas pitschmannii rrnL gene. 46 1.9 1
(X68921) Chloroplast Chlamydomonas humicola rrnL gene, exon 1. 46 1.9 1
(X68913) Chloroplast C.moewusii rrnL gene, exon 1. 46 1.9 1
(X68893) Chloroplast Chlamydomonas indica rrnL gene, exon 1. 46 1.9 1
(L44123) Chlorococcum echinozygotum chloroplast large-subuni... 46 1.9 1
(L43540) Dunaliella parva. 46 1.9 1
(L43357) Chlorella vulgaris chloroplast large subunit riboso... 46 1.9 1
(L43355) Chlamydomonas pseudopertusa chloroplast large subun... 46 1.9 1
(L43351) Chlamydomonas agloeformis chloroplast large subunit... 46 1.9 1
(L42989) Chlamydomonas humicola chloroplast large-subunit ri... 46 1.9 1
(L42988) Chlamydomonas applanata large subunit ribosomal RNA... 46 1.9 1
(DQ287690) Blastocladiella emersonii mitochondrion, complete... 46 1.9 1
(CR954199) Ostreococcus tauri chloroplast, complete genome. 46 1.9 1
(AB001684) Chlorella vulgaris C-27 chloroplast DNA, complete... 46 1.9 1
(DI081176) DNA Probe Derived from 23S rRNA Gene for Detectio... 46 1.9 1
(DI005971) DNA chip for detection of infectious bacteria. 46 1.9 1
(AR924220) Sequence 4857 from patent US 7090973. 46 1.9 1
(AR923641) Sequence 4278 from patent US 7090973. 46 1.9 1
(AR922163) Sequence 2800 from patent US 7090973. 46 1.9 1
(AC090559) Homo sapiens chromosome 11, clone RP11-750H9, com... 46 1.9 1
(AC019059) Homo sapiens chromosome 11 clone RP11-125F14, WOR... 46 1.9 1
(ET067007) U_CU-aaa08f06.g1 Human diarrhea D01 human gut met... 46 1.9 1
(EK409259) 1095505151384 Global-Ocean-Sampling_GS-31-01-01-1... 46 1.9 1
(EK090246) 1092961212045 Global-Ocean-Sampling_GS-31-01-01-1... 46 1.9 1
(EK070212) 1092960185089 Global-Ocean-Sampling_GS-31-01-01-1... 46 1.9 1
(EJ161825) 1092344050871 Global-Ocean-Sampling_GS-27-01-01-1... 46 1.9 1
(EJ090988) 1095460182179 Global-Ocean-Sampling_GS-26-01-01-1... 46 1.9 1
(EJ082443) 1095460056268 Global-Ocean-Sampling_GS-26-01-01-1... 46 1.9 1
(EI744104) CHORI520R112C20TR BAC library from the breast cel... 46 1.9 1
(EF993814) Uncultured bacterium clone BYUO1812.g1, genomic s... 46 1.9 1
(EF993605) Uncultured bacterium clone BYUO1665.g1, genomic s... 46 1.9 1
(ED787476) GM_WBb0169G05.f GM_WBb Glycine max genomic clone ... 46 1.9 1
(ED729470) GM_WBb0085O21.f GM_WBb Glycine max genomic clone ... 46 1.9 1
(DU785786) APKH1295.b2 HF770_12-21-03 uncultured marine micr... 46 1.9 1
(AJ863995) Ralstonia solanacearum GSS, clone V1555R. 46 1.9 1
(EE734904) BeE60H11B12 BeE60H Blastocladiella emersonii cDNA... 46 1.9 1
(EE733117) BeE60H21E10 BeE60H Blastocladiella emersonii cDNA... 46 1.9 1
(EE732968) BeE60H02H07 BeE60H Blastocladiella emersonii cDNA... 46 1.9 1
(EE732247) BeE60C18A05 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE732059) BeE60C15E03 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE731608) BeE60C09F04 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE731159) BeE60C33H10 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE731063) BeE60C31E10 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE730997) BeE60C30G11 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE730952) BeE60C29E03 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EE730396) BeE60C19B11 BeE60C Blastocladiella emersonii cDNA... 46 1.9 1
(EC637121) AME00003292 Allomyces macrogynus Company Allomyce... 46 1.9 1
(CU523445) Theobroma cacao, mRNA sequence (KZ0ACS2YF21FM1). 46 1.9 1
(CU523352) Theobroma cacao, mRNA sequence (KZ0ACS1YG13FM1). 46 1.9 1
(CO971095) BeG30N02G12 BeG30N Blastocladiella emersonii cDNA... 46 1.9 1
(BQ889636) AGENCOURT_8137896 Lupski_dorsal_root_ganglion Hom... 46 1.9 1
(BQ883623) AGENCOURT_8119263 Lupski_dorsal_root_ganglion Hom... 46 1.9 1
(BF335783) RC4-CT0477-140800-011-b12 CT0477 Homo sapiens cDN... 46 1.9 1
(AW841109) RC0-CN0010-030100-011-g03 CN0010 Homo sapiens cDN... 46 1.9 1
(AW841103) RC0-CN0010-030100-011-d02 CN0010 Homo sapiens cDN... 46 1.9 1
(EV816964) BGBV-aae85h02.g1 Snail_EST_pSMART Biomphalaria gl... 46 1.9 1
(EU795230) Uncultured bacterium AD248-D7-1A genomic sequence. 46 1.9 1
(EU686608) Uncultured bacterium KM3-205-D9 genomic sequence. 46 1.9 1
(EU067790) Uncultured bacterium clone HA0AAA20ZC05RM1 genomi... 46 1.9 1
(EU067031) Uncultured bacterium clone LM0ACA9ZH07RM1 genomic... 46 1.9 1
(EU065224) Uncultured bacterium clone LM0ACA1ZH04RM1 genomic... 46 1.9 1
(EU063903) Uncultured bacterium clone LM0ACA6ZE05FM1 genomic... 46 1.9 1
(EU063135) Uncultured bacterium clone LM0ACA22ZF08FM1 genomi... 46 1.9 1
(EU061514) Uncultured bacterium clone LM0ABA7ZA08RM1 genomic... 46 1.9 1
(EU061089) Uncultured bacterium clone LM0ABA4ZH01RM1 genomic... 46 1.9 1
(EU061049) Uncultured bacterium clone LM0ABA4ZC09RM1 genomic... 46 1.9 1
(EU061018) Uncultured bacterium clone LM0ABA39ZG05RM1 genomi... 46 1.9 1
(EU060158) Uncultured bacterium clone LM0ABA1ZF09RM1 genomic... 46 1.9 1
(EU060003) Uncultured bacterium clone HA0AAA7ZF01FM1 genomic... 46 1.9 1
(AY701491) Uncultured Bacteroidales bacterium SHDogc 23S rib... 46 1.9 1
(AJ937761) Uncultured beta proteobacterium fosmid clone b1bf... 46 1.9 1
(FJ410382) Bacteroides vulgatus KCCM:11423 16S ribosomal RNA... 46 1.9 1
(FJ410381) Bacteroides fragilis ATCC:25285 16S ribosomal RNA... 46 1.9 1
(EU168779) Candidatus Phytoplasma fraxini 16S ribosomal RNA ... 46 1.9 1
(EU168775) Elm witches'-broom phytoplasma 16S ribosomal RNA ... 46 1.9 1
(EU168772) Coconut lethal yellowing phytoplasma isolate PR 1... 46 1.9 1
(CU914168) Ralstonia solanacearum strain 1609 Genome Draft. 46 1.9 1
(CU695238) Ralstonia solanacearum strain MolK2 Genome Draft. 46 1.9 1
(CR626927) Bacteroides fragilis NCTC 9343, complete genome. 46 1.9 1
(CP000139) Bacteroides vulgatus ATCC 8482, complete genome. 46 1.9 1
(CP000116) Thiobacillus denitrificans ATCC 25259, complete g... 46 1.9 1
(AY650901) Bacteroides fragilis strain ATCC 25285 23S riboso... 46 1.9 1
(AP009179) Sulfurovum sp. NBC37-1 genomic DNA, complete genome. 46 1.9 1
(AP006841) Bacteroides fragilis YCH46 DNA, complete genome. 46 1.9 1
(AM709637) Scytonema hofmanni PCC 7110 partial ribosomal RNA... 46 1.9 1
(AL646052) Ralstonia solanacearum GMI1000 chromosome complet... 46 1.9 1
(AF375995) Candidatus Kuenenia stuttgartiensis 16S ribosomal... 46 1.9 1
(AF012420) Ralstonia solanacearum strain PD2762 23S ribosoma... 46 1.9 1
(AF012419) Ralstonia solanacearum strain PD1450 23S ribosoma... 46 1.9 1
(AF012418) Ralstonia solanacearum strain PD1449 23S ribosoma... 46 1.9 1
(AF012417) Ralstonia solanacearum strain PD1445 23S ribosoma... 46 1.9 1
(AF012416) Ralstonia solanacearum strain PD278 23S ribosomal... 46 1.9 1
(AC016532) Homo sapiens chromosome 6 clone RP11-343I16 map 6... 40 3.1 2
(AU060616) Dictyostelium discoideum slug cDNA, clone SLK643. 34 3.1 3
(BV250639) S234P6535RC11.T0 EnglishShepherd Canis familiaris... 38 3.6 2
(CG816910) SOYEB08TH LargeInsertSoybeanGenLib Glycine max ge... 36 4.4 2
(EI883541) CAH1-62F13TR CAA1Ba Cicer arietinum genomic clone... 34 4.9 2
(AP005556) Oryza sativa Japonica Group genomic DNA, chromoso... 40 5.0 3
(AY686611) Helicobacter mesocricetorum strain ATCC 700932 23... 44 5.0 2
(AG280091) Mus musculus molossinus DNA, clone:MSMg01-051E08.... 38 7.5 2
(CU686653) Synthetic construct Homo sapiens gateway clone IM... 44 7.6 1
(BC167255) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC167253) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC167180) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC167173) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC166697) Synthetic construct Homo sapiens clone IMAGE:1000... 44 7.6 1
(BC160380) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC160198) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC156893) Synthetic construct Homo sapiens clone IMAGE:1000... 44 7.6 1
(BC156820) Synthetic construct Homo sapiens clone IMAGE:1000... 44 7.6 1
(BC156386) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC156384) Synthetic construct Mus musculus clone IMAGE:1000... 44 7.6 1
(BC148656) Synthetic construct Homo sapiens clone IMAGE:1000... 44 7.6 1
(AM392971) Synthetic construct Homo sapiens clone IMAGE:1000... 44 7.6 1
(AB384894) Synthetic construct DNA, clone: pF1KB4085, Homo s... 44 7.6 1
(AB384789) Synthetic construct DNA, clone: pF1KB3329, Homo s... 44 7.6 1
(AB384778) Synthetic construct DNA, clone: pF1KB3294, Homo s... 44 7.6 1
(AB384773) Synthetic construct DNA, clone: pF1KB3279, Homo s... 44 7.6 1
(BV353553) S230P6569RG6.T0 Rottweiler Canis familiaris STS g... 44 7.6 1
(EU854475) Mus musculus protocadherin alpha 2 mRNA, partial ... 44 7.6 1
(D86917) Mus musculus mRNA for CNR2, complete cds. 44 7.6 1
(D86916) Mus musculus mRNA for CNR1, complete cds. 44 7.6 1
(BC139424) Mus musculus protocadherin alpha 8, mRNA (cDNA cl... 44 7.6 1
(BC085793) Rattus norvegicus protocadherin alpha 4, mRNA (cD... 44 7.6 1
(BC080863) Mus musculus protocadherin alpha 7, mRNA (cDNA cl... 44 7.6 1
(AY573985) Rattus norvegicus protocadherin alpha c2 (Pcdhac2... 44 7.6 1
(AY573984) Rattus norvegicus protocadherin alpha c1 (Pcdhac1... 44 7.6 1
(AY573983) Rattus norvegicus protocadherin alpha 9 (Pcdha9) ... 44 7.6 1
(AY573982) Rattus norvegicus protocadherin alpha 8 (Pcdha8) ... 44 7.6 1
(AY573981) Rattus norvegicus protocadherin alpha 7 (Pcdha7) ... 44 7.6 1

>(AB000109) Dictyostelium discoideum mitochondrial DNA, complete genome.
Length = 55564

Score = 327 bits (165), Expect(2) = e-141
Identities = 165/165 (100%)
Strand = Plus / Plus


Query: 105 tctctatgcaaataagaaaaaggacgtacgaatgaacgaaaggttatagggaaaatataa 164
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 18606 tctctatgcaaataagaaaaaggacgtacgaatgaacgaaaggttatagggaaaatataa 18665


Query: 165 aaaagagttagcaatagcaattgaagatctataaatatccgaagggagaccaagaaaaag 224
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 18666 aaaagagttagcaatagcaattgaagatctataaatatccgaagggagaccaagaaaaag 18725


Query: 225 aagaaacgcagtgaagtgaaacatcttagtaactgtaggaaaaaa 269
|||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 18726 aagaaacgcagtgaagtgaaacatcttagtaactgtaggaaaaaa 18770

Score = 206 bits (104), Expect(2) = e-141
Identities = 104/104 (100%)
Strand = Plus / Plus


Query: 1 ggagctaaattgagggaaaaagcttaaatgacaaatttaaggtttaaggggaaaagatag 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 18503 ggagctaaattgagggaaaaagcttaaatgacaaatttaaggtttaaggggaaaagatag 18562


Query: 61 gagaaatagaagagagtagtaagagaaaaatgtttataacggat 104
||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 18563 gagaaatagaagagagtagtaagagaaaaatgtttataacggat 18606

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 566,071,802
Number of extensions: 37429082
Number of successful extensions: 3322864
Number of sequences better than 10.0: 1038
Length of query: 769
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 745
Effective length of database: 96,409,374,237
Effective search space: 71824983806565
Effective search space used: 71824983806565
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.28
Homology vs Protein
Query= Contig-U16406-1 (Contig-U16406-1Q) /CSM_Contig/Contig-U16406-1Q.Seq.d
(769 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

***** No hits found ******

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 676,675,786
Number of extensions: 8581494
Number of successful extensions: 15013
Number of sequences better than 10.0: 0
Number of HSP's gapped: 15008
Number of HSP's successfully gapped: 0
Length of query: 256
Length of database: 1,061,185,681
Length adjustment: 126
Effective length of query: 130
Effective length of database: 649,361,233
Effective search space: 84416960290
Effective search space used: 84416960290
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)

PSORT

psg: 0.64 gvh: 0.25 alm: 0.70 top: 0.53 tms: 0.00 mit: 0.32 mip: 0.05
nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: nuclear
24.0 %: mitochondrial
20.0 %: cytoplasmic
16.0 %: cytoskeletal

>> prediction for Contig-U16406-1 is nuc

VS (DIR, S) 43
VH (FL, L) 2
VF (FL, S) 2
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 4
SS (DIR, S) 1
SH (FL, L) 3
SF (FL, S) 1
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 3
FC-IC (SUB) 3