Contig-U16369-1
Contig ID Contig-U16369-1
Contig update 2004. 6.11
Contig sequence
>Contig-U16369-1 (Contig-U16369-1Q) /CSM_Contig/Contig-U16369-1Q.Seq.d
AAATTAATTTTGTTTTGAATTTCACCCTTCAACAAACAATAATTATAAAT
ACATATATATATATATAAATAACAATGAGTGAAGAACGTAAAGTAGCATT
AATTACTGGTATTACTGGTCAAGATGGTTCATATTTAACAGAGTTCCTTA
TTAGTAAGGGCTATTATGTTCATGGTATTATTAGAAGATCTTCATCATTT
AATACCAGTCGTATTGAACATTTATATCAAGATCAACATGTTGAAGGAAA
AAAATCACTTACTTTACATTATGGTGATTTAACAGATGCTAGTAATTTAC
ATAGTATTGTTTCAAAAGTTAATCCAACTGAAATTTATAATTTAGGTGCA
CAAAGTCATGTTAAAGTTTCATTTGATATGTCAGAATATACAGGTGATGT
TGATGGTTTAGGTTGTCTTCGTTTATTGGATGCAATTCGTAGTTGTGGTA
TGGAGAAAAAGGTTAAATATTATCAAGCTTCAACCTCTGAATTATATGGT
AAAGTTCAAGAGATTCCACAATCAGAGACCACACCATTCTATCCACGTTC
ACCATACGCTGTCGCAAAGCAATATGCCTATTGGATCGTTGTAAACTATC
GTGAGGCTTACGATATGTATGCATGTAATGGTATCTTATTCAATCATGAA
TCACCACGTAGAGGTCCAACTTTTGTAACTAGAAAGATCACTCGTTTCGT
TGCTGGTATTGCATGTGGTAGAGATGAAATTCTCTACTTGGGTAATATCA
ACGCTAAACGTGATTGGGGTCACGCTAGAGATTACGTTGAAGCAATGTGG
TTAATGTTACAACAAGAGAAGCCAGAAGATTTCGTTATTGCCACTGGTGA
AACTCATTCAGTTCGTGAATTTGTTGAAAAATCATTCAAAGAAATTGATA
TCATCATCAAATGGAGAGGTGAAGCAGAAAAAGAAGAAGGTTACTGTGAA
AAGACTGGTAAAGTTTACGTTAAAATTGATGAGAAATATTACAGACCAAC
TGAAGTTGATCTTTTACTTGGTAATCCAAATAAAGCAAAGAAATTATTAC
AATGGCAAATTAAAACTTCTTTTGGTGAACTCGTTAAAGAAATGGTTGCT
AAAGATATTGAATATATTAAAAATGGTGATAAATATAATTAAATTTTTCT
AAAAAAAAAAAAAAAAAAAATTAAAAAAAAAAAAAAAATAATAAAGTAAA
ATTTTAAATA

Gap no gap
Contig length 1210
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 2067040
End point 2065828
Strand (PLUS/MINUS) MINUS
Number of clones 14
Number of EST 15
Link to clone list U16369
List of clone(s)

est1=AFG305E,1,1063
est2=AFJ373E,12,1052
est3=CFJ244E,12,1104
est4=SFC693E,12,1054
est5=VFA337E,12,1106
est6=CFB282F,15,592
est7=SFK341F,18,645
est8=SSK622E,34,1153
est9=SSI286Z,419,1154
est10=SFD446Z,428,1125
est11=SFA305Z,455,1070
est12=VSA872Z,501,1151
est13=VSB677Z,540,1150
est14=CFB282Z,563,1055
est15=SSH680Z,900,1210
Translated Amino Acid sequence
infvlnftlqqtiiintyiyi*ITMSEERKVALITGITGQDGSYLTEFLISKGYYVHGII
RRSSSFNTSRIEHLYQDQHVEGKKSLTLHYGDLTDASNLHSIVSKVNPTEIYNLGAQSHV
KVSFDMSEYTGDVDGLGCLRLLDAIRSCGMEKKVKYYQASTSELYGKVQEIPQSETTPFY
PRSPYAVAKQYAYWIVVNYREAYDMYACNGILFNHESPRRGPTFVTRKITRFVAGIACGR
DEILYLGNINAKRDWGHARDYVEAMWLMLQQEKPEDFVIATGETHSVREFVEKSFKEIDI
IIKWRGEAEKEEGYCEKTGKVYVKIDEKYYRPTEVDLLLGNPNKAKKLLQWQIKTSFGEL
VKEMVAKDIEYIKNGDKYN*iflkkkkkkikkkkkiik*nfk


Translated Amino Acid sequence (All Frames)
Frame A:
klilf*ispfnkq*l*ihiyiyk*q*vknvk*h*llvllvkmvhi*qssllvraimfmvl
ledlhhlipvvlniyikinmlkeknhllyimvi*qmlviyivlfqkliqlkfii*vhkvm
lkfhlicqniqvmlmv*vvfvywmqfvvvvwrkrlniiklqplnymvkfkrfhnqrphhs
ihvhhtlsqsnmpigsl*tivrlticmhvmvsysimnhhvevqll*lerslvsllvlhvv
emkfstwvistlnvigvtleitlkqcg*cynkrsqkisllplvkliqfvnllknhskkli
sssngevkqkkkkvtvkrlvkftlklmrnitdqlklifylviqikqrnyyngklklllvn
slkkwllkilnilkmviniikff*kkkkkklkkkkk**skiln


Frame B:
n*fcfefhpstnnnykyiyiyinnne*rt*ssinywyywsrwfifnrvpy**gllcswyy
*kifii*yqsy*tfisrstc*rkkityftlw*fnrc**ft*ycfks*sn*nl*frctksc
*sfi*yvriyr*c*wfrlssfigcns*lwygekg*ilssfnl*iiw*ssrdstirdhtil
stftircrkaiclldrckls*glryvcm*wyliqs*itt*rsnfcn*kdhsfrcwycmw*
r*nsllg*yqr*t*lgsr*rlr*snvvnvttrearrfrychw*nsfss*ic*kiiqrn*y
hhqmer*srkrrrll*kdw*slr*n**eilqtn*s*sftw*sk*skeiitman*nffw*t
r*rngc*ry*iy*kw**i*lnfskkkkkkn*kkkknnkvkf*i


Frame C:
infvlnftlqqtiiintyiyi*ITMSEERKVALITGITGQDGSYLTEFLISKGYYVHGII
RRSSSFNTSRIEHLYQDQHVEGKKSLTLHYGDLTDASNLHSIVSKVNPTEIYNLGAQSHV
KVSFDMSEYTGDVDGLGCLRLLDAIRSCGMEKKVKYYQASTSELYGKVQEIPQSETTPFY
PRSPYAVAKQYAYWIVVNYREAYDMYACNGILFNHESPRRGPTFVTRKITRFVAGIACGR
DEILYLGNINAKRDWGHARDYVEAMWLMLQQEKPEDFVIATGETHSVREFVEKSFKEIDI
IIKWRGEAEKEEGYCEKTGKVYVKIDEKYYRPTEVDLLLGNPNKAKKLLQWQIKTSFGEL
VKEMVAKDIEYIKNGDKYN*iflkkkkkkikkkkkiik*nfk


own update 2004. 6.23
Homology vs CSM-cDNA
Query= Contig-U16369-1 (Contig-U16369-1Q)
/CSM_Contig/Contig-U16369-1Q.Seq.d
(1210 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U16369-1 (Contig-U16369-1Q) /CSM_Contig/Conti... 2105 0.0
Contig-U16368-1 (Contig-U16368-1Q) /CSM_Contig/Conti... 353 4e-97
Contig-U14896-1 (Contig-U14896-1Q) /CSM_Contig/Conti... 40 0.008
Contig-U12121-1 (Contig-U12121-1Q) /CSM_Contig/Conti... 38 0.031
Contig-U04481-1 (Contig-U04481-1Q) /CSM_Contig/Conti... 38 0.031
Contig-U13694-1 (Contig-U13694-1Q) /CSM_Contig/Conti... 36 0.12
Contig-U12710-1 (Contig-U12710-1Q) /CSM_Contig/Conti... 36 0.12
Contig-U11244-1 (Contig-U11244-1Q) /CSM_Contig/Conti... 36 0.12
Contig-U11049-1 (Contig-U11049-1Q) /CSM_Contig/Conti... 36 0.12
Contig-U16470-1 (Contig-U16470-1Q) /CSM_Contig/Conti... 34 0.48

>Contig-U16369-1 (Contig-U16369-1Q) /CSM_Contig/Contig-U16369-1Q.Seq.d
Length = 1210

Score = 2105 bits (1062), Expect = 0.0
Identities = 1076/1083 (99%)
Strand = Plus / Plus


Query: 68 aataacaatgagtgaagaacgtaaagtagcattaattactggtattactggtcaagatgg 127
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 68 aataacaatgagtgaagaacgtaaagtagcattaattactggtattactggtcaagatgg 127


Query: 128 ttcatatttaacagagttccttattagtaagggctattatgttcatggtattattagaag 187
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 128 ttcatatttaacagagttccttattagtaagggctattatgttcatggtattattagaag 187


Query: 188 atcttcatcatttaataccagtcgtattgaacatttatatcaagatcaacatgttgaagg 247
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 188 atcttcatcatttaataccagtcgtattgaacatttatatcaagatcaacatgttgaagg 247


Query: 248 nnnnnnntcacttactttacattatggtgatttaacagatgctagtaatttacatagtat 307
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 248 aaaaaaatcacttactttacattatggtgatttaacagatgctagtaatttacatagtat 307


Query: 308 tgtttcaaaagttaatccaactgaaatttataatttaggtgcacaaagtcatgttaaagt 367
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 308 tgtttcaaaagttaatccaactgaaatttataatttaggtgcacaaagtcatgttaaagt 367


Query: 368 ttcatttgatatgtcagaatatacaggtgatgttgatggtttaggttgtcttcgtttatt 427
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 368 ttcatttgatatgtcagaatatacaggtgatgttgatggtttaggttgtcttcgtttatt 427


Query: 428 ggatgcaattcgtagttgtggtatggagaaaaaggttaaatattatcaagcttcaacctc 487
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 428 ggatgcaattcgtagttgtggtatggagaaaaaggttaaatattatcaagcttcaacctc 487


Query: 488 tgaattatatggtaaagttcaagagattccacaatcagagaccacaccattctatccacg 547
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 488 tgaattatatggtaaagttcaagagattccacaatcagagaccacaccattctatccacg 547


Query: 548 ttcaccatacgctgtcgcaaagcaatatgcctattggatcgttgtaaactatcgtgaggc 607
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 548 ttcaccatacgctgtcgcaaagcaatatgcctattggatcgttgtaaactatcgtgaggc 607


Query: 608 ttacgatatgtatgcatgtaatggtatcttattcaatcatgaatcaccacgtagaggtcc 667
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 608 ttacgatatgtatgcatgtaatggtatcttattcaatcatgaatcaccacgtagaggtcc 667


Query: 668 aacttttgtaactagaaagatcactcgtttcgttgctggtattgcatgtggtagagatga 727
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 668 aacttttgtaactagaaagatcactcgtttcgttgctggtattgcatgtggtagagatga 727


Query: 728 aattctctacttgggtaatatcaacgctaaacgtgattggggtcacgctagagattacgt 787
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 728 aattctctacttgggtaatatcaacgctaaacgtgattggggtcacgctagagattacgt 787


Query: 788 tgaagcaatgtggttaatgttacaacaagagaagccagaagatttcgttattgccactgg 847
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 788 tgaagcaatgtggttaatgttacaacaagagaagccagaagatttcgttattgccactgg 847


Query: 848 tgaaactcattcagttcgtgaatttgttgaaaaatcattcaaagaaattgatatcatcat 907
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 848 tgaaactcattcagttcgtgaatttgttgaaaaatcattcaaagaaattgatatcatcat 907


Query: 908 caaatggagaggtgaagcagaaaaagaagaaggttactgtgaaaagactggtaaagttta 967
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 908 caaatggagaggtgaagcagaaaaagaagaaggttactgtgaaaagactggtaaagttta 967


Query: 968 cgttaaaattgatgagaaatattacagaccaactgaagttgatcttttacttggtaatcc 1027
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 968 cgttaaaattgatgagaaatattacagaccaactgaagttgatcttttacttggtaatcc 1027


Query: 1028 aaataaagcaaagaaattattacaatggcaaattaaaacttcttttggtgaactcgttaa 1087
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1028 aaataaagcaaagaaattattacaatggcaaattaaaacttcttttggtgaactcgttaa 1087


Query: 1088 agaaatggttgctaaagatattgaatatattaaaaatggtgataaatataattaaatttt 1147
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1088 agaaatggttgctaaagatattgaatatattaaaaatggtgataaatataattaaatttt 1147


Query: 1148 tct 1150
|||
Sbjct: 1148 tct 1150


Score = 103 bits (52), Expect = 6e-22
Identities = 52/52 (100%)
Strand = Plus / Plus


Query: 1 aaattaattttgttttgaatttcacccttcaacaaacaataattataaatac 52
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 aaattaattttgttttgaatttcacccttcaacaaacaataattataaatac 52


Score = 44.1 bits (22), Expect = 5e-04
Identities = 22/22 (100%)
Strand = Plus / Plus


Query: 1189 taataaagtaaaattttaaata 1210
||||||||||||||||||||||
Sbjct: 1189 taataaagtaaaattttaaata 1210


>Contig-U16368-1 (Contig-U16368-1Q) /CSM_Contig/Contig-U16368-1Q.Seq.d
Length = 2359

Score = 353 bits (178), Expect = 4e-97
Identities = 178/178 (100%)
Strand = Plus / Plus


Query: 68 aataacaatgagtgaagaacgtaaagtagcattaattactggtattactggtcaagatgg 127
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2182 aataacaatgagtgaagaacgtaaagtagcattaattactggtattactggtcaagatgg 2241


Query: 128 ttcatatttaacagagttccttattagtaagggctattatgttcatggtattattagaag 187
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2242 ttcatatttaacagagttccttattagtaagggctattatgttcatggtattattagaag 2301


Query: 188 atcttcatcatttaataccagtcgtattgaacatttatatcaagatcaacatgttgaa 245
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2302 atcttcatcatttaataccagtcgtattgaacatttatatcaagatcaacatgttgaa 2359


Score = 103 bits (52), Expect = 6e-22
Identities = 52/52 (100%)
Strand = Plus / Plus


Query: 1 aaattaattttgttttgaatttcacccttcaacaaacaataattataaatac 52
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2115 aaattaattttgttttgaatttcacccttcaacaaacaataattataaatac 2166


>Contig-U14896-1 (Contig-U14896-1Q) /CSM_Contig/Contig-U14896-1Q.Seq.d
Length = 846

Score = 40.1 bits (20), Expect = 0.008
Identities = 20/20 (100%)
Strand = Plus / Plus


Query: 490 aattatatggtaaagttcaa 509
||||||||||||||||||||
Sbjct: 155 aattatatggtaaagttcaa 174


Database: CSM
Posted date: Jun 21, 2004 1:35 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 23,571
Number of Sequences: 8402
Number of extensions: 23571
Number of successful extensions: 2654
Number of sequences better than 10.0: 224
length of query: 1210
length of database: 8,075,542
effective HSP length: 16
effective length of query: 1194
effective length of database: 7,941,110
effective search space: 9481685340
effective search space used: 9481685340
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 3.29
Homology vs DNA
Query= Contig-U16369-1 (Contig-U16369-1Q) /CSM_Contig/Contig-U16369-1Q.Seq.d
(1210 letters)

Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(C90350) Dictyostelium discoideum slug cDNA, clone SSI286. 1451 0.0 1
(BJ346598) Dictyostelium discoideum cDNA clone:dda24n10, 3' ... 1370 0.0 1
(BJ375612) Dictyostelium discoideum cDNA clone:ddc19g12, 3' ... 1336 0.0 1
(BJ399769) Dictyostelium discoideum cDNA clone:dds7l12, 3' e... 1330 0.0 1
(AU261799) Dictyostelium discoideum vegetative cDNA clone:VS... 1287 0.0 1
(BJ428822) Dictyostelium discoideum cDNA clone:ddv1j09, 3' e... 1281 0.0 2
(BJ342254) Dictyostelium discoideum cDNA clone:dda13j01, 3' ... 1231 0.0 1
(AU262174) Dictyostelium discoideum vegetative cDNA clone:VS... 1209 0.0 1
(BJ399651) Dictyostelium discoideum cDNA clone:dds6i24, 3' e... 1205 0.0 1
(BJ344559) Dictyostelium discoideum cDNA clone:dda19b19, 3' ... 1124 0.0 1
(BJ398592) Dictyostelium discoideum cDNA clone:dds1j01, 3' e... 1049 0.0 2
(BJ390126) Dictyostelium discoideum cDNA clone:dds21b11, 5' ... 763 0.0 3
(BJ329285) Dictyostelium discoideum cDNA clone:dda24n10, 5' ... 571 0.0 5
(BJ327247) Dictyostelium discoideum cDNA clone:dda19b19, 5' ... 692 0.0 3
(BJ361915) Dictyostelium discoideum cDNA clone:ddc19g12, 5' ... 690 0.0 3
(C94397) Dictyostelium discoideum slug cDNA, clone SSK622. 1070 0.0 2
(BJ325178) Dictyostelium discoideum cDNA clone:dda13j01, 5' ... 640 0.0 3
(BJ388704) Dictyostelium discoideum cDNA clone:dds6i24, 5' e... 656 0.0 3
(BJ360010) Dictyostelium discoideum cDNA clone:ddc3c22, 5' e... 662 0.0 3
(BJ341341) Dictyostelium discoideum cDNA clone:dda6b07, 3' e... 975 0.0 1
(BJ373583) Dictyostelium discoideum cDNA clone:ddc3c22, 3' e... 914 0.0 2
(BJ410654) Dictyostelium discoideum cDNA clone:ddv1j09, 5' e... 515 0.0 3
(AU038413) Dictyostelium discoideum slug cDNA, clone SSH680. 502 e-144 2
(AU074408) Dictyostelium discoideum slug cDNA, clone SSK622. 351 e-103 3
(DY888422) CeleSEQ5382 Cunninghamella elegans pBluescript (E... 117 7e-71 7
(DY888116) CeleSEQ3563 Cunninghamella elegans pBluescript (E... 101 1e-51 6
(DY888893) CeleSEQ6297 Cunninghamella elegans pBluescript (E... 76 1e-51 8
(DY887951) CeleSEQ4812 Cunninghamella elegans pBluescript (E... 94 1e-49 6
(DY888805) CeleSEQ6129 Cunninghamella elegans pBluescript (E... 94 1e-49 6
(DY888293) CeleSEQ5126 Cunninghamella elegans pBluescript (E... 94 2e-49 6
(EJ015696) 1095433016454 Global-Ocean-Sampling_GS-26-01-01-1... 68 1e-47 9
(DY894109) CeleSEQ13604 Cunninghamella elegans pBluescript (... 76 1e-44 6
(DY889759) CeleSEQ11959 Cunninghamella elegans pBluescript (... 56 1e-44 7
(DY894200) CeleSEQ13714 Cunninghamella elegans pBluescript (... 92 1e-44 5
(DY891675) CeleSEQ10423 Cunninghamella elegans pBluescript (... 68 2e-42 6
(AM810369) Nicotiana tabacum EST, clone nt005096085. 92 2e-41 4
(ER530372) 1093015745510 Global-Ocean-Sampling_GS-35-01-01-1... 66 5e-40 8
(DY886404) CeleSEQ2050 Cunninghamella elegans pBluescript (E... 101 2e-38 4
(ER491754) 1093015330210 Global-Ocean-Sampling_GS-35-01-01-1... 98 2e-36 5
(EJ083460) 1095460071242 Global-Ocean-Sampling_GS-26-01-01-1... 64 2e-35 6
(EC825292) SME00009397 esmbsro2 Sawyeria marylandensis cDNA,... 72 4e-35 5
(DY890420) CeleSEQ9422 Cunninghamella elegans pBluescript (E... 56 2e-33 6
(EK016808) 1092955243743 Global-Ocean-Sampling_GS-31-01-01-1... 60 4e-33 6
(EC825437) SME00004854 esmbsro2 Sawyeria marylandensis cDNA,... 64 1e-32 5
(EK087189) 1092961164964 Global-Ocean-Sampling_GS-31-01-01-1... 98 1e-32 4
(EJ960968) 1093022003436 Global-Ocean-Sampling_GS-30-02-01-1... 100 2e-32 3
(EK101060) 1092963017600 Global-Ocean-Sampling_GS-31-01-01-1... 70 6e-32 5
(DY895313) CeleSEQ15107 Cunninghamella elegans pBluescript (... 56 1e-28 5
(DR940681) EST1132220 Aquilegia cDNA library Aquilegia formo... 74 2e-27 4
(DR940083) EST1131622 Aquilegia cDNA library Aquilegia formo... 74 2e-27 4
(DR925821) EST1117360 Aquilegia cDNA library Aquilegia formo... 74 2e-27 4
(EJ284186) 1095368008204 Global-Ocean-Sampling_GS-27-01-01-1... 58 5e-27 7
(EC822365) SME00001006 esmbsro2 Sawyeria marylandensis cDNA,... 64 1e-26 4
(DR923807) EST1115346 Aquilegia cDNA library Aquilegia formo... 74 1e-25 4
(CZ547054) SRAA-aad71e12.g1 Strongyloides ratti whole genome... 62 1e-24 4
(FC686865) CAXX19111.fwd CAXX Lottia gigantea from male gona... 68 3e-24 5
(FC683048) CAXX16804.fwd CAXX Lottia gigantea from male gona... 68 3e-24 5
(FC694438) CAXX4403.fwd CAXX Lottia gigantea from male gonad... 68 5e-24 5
(FC678595) CAXX12674.fwd CAXX Lottia gigantea from male gona... 68 5e-24 5
(FC698062) CAXX6489.fwd CAXX Lottia gigantea from male gonad... 68 6e-24 5
(ER442202) 1092963817318 Global-Ocean-Sampling_GS-35-01-01-1... 66 2e-23 5
(EJ219635) 1092351206461 Global-Ocean-Sampling_GS-27-01-01-1... 76 4e-23 5
(EK100452) 1092963013376 Global-Ocean-Sampling_GS-31-01-01-1... 70 8e-23 4
(EJ407751) 1093012109336 Global-Ocean-Sampling_GS-28-01-01-1... 60 9e-23 6
(EK102996) 1092963029199 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-22 6
(ER426703) 1092963755165 Global-Ocean-Sampling_GS-35-01-01-1... 50 3e-22 6
(AM231684) Caenorhabditis elegans mRNA for GDP-mannose 4,6-d... 54 3e-22 6
(AM231683) Caenorhabditis elegans mRNA for GDP-mannose 4,6-d... 54 4e-22 6
(EK200224) 1095460053822 Global-Ocean-Sampling_GS-31-01-01-1... 70 9e-22 4
(EK259214) 1095462087843 Global-Ocean-Sampling_GS-31-01-01-1... 62 1e-21 4
(FC640718) CAXU4975.fwd CAXU Lottia gigantea from female gon... 68 1e-21 5
(AJ871364) Yersinia aldovae O-antigen gene cluster, strain A... 62 2e-21 7
(EJ620675) 1092963059365 Global-Ocean-Sampling_GS-29-01-01-1... 50 5e-21 5
(FE258306) CAPH7075.fwd CAPH Naegleria gruberi amoeba stage ... 66 5e-21 5
(ER600471) 1093016241839 Global-Ocean-Sampling_GS-36-01-01-2... 80 5e-21 3
(FE250007) CAPH2606.fwd CAPH Naegleria gruberi amoeba stage ... 66 5e-21 5
(EJ728378) 1092959706127 Global-Ocean-Sampling_GS-30-02-01-1... 66 1e-20 4
(FE260301) CAZN827.fwd CAZN Naegleria gruberi Flagellate Sta... 66 1e-20 5
(EJ977140) 1093022127165 Global-Ocean-Sampling_GS-30-02-01-1... 50 1e-20 5
(EJ718858) 1092959440193 Global-Ocean-Sampling_GS-30-02-01-1... 66 2e-20 4
(EJ968137) 1093022059389 Global-Ocean-Sampling_GS-30-02-01-1... 50 5e-20 6
(EK010242) 1092955163371 Global-Ocean-Sampling_GS-31-01-01-1... 48 5e-20 5
(FK076903) XABT134079.b1 Gateway compatible cien cDNA librar... 66 6e-20 6
(EK084776) 1092961135779 Global-Ocean-Sampling_GS-31-01-01-1... 58 6e-20 5
(EK444753) 1095462428047 Global-Ocean-Sampling_GS-32-01-01-1... 80 2e-19 4
(EA404886) Sequence 878 from patent US 7319142. 62 2e-19 5
(EK490479) 1095505073651 Global-Ocean-Sampling_GS-32-01-01-1... 80 2e-19 4
(EK490329) 1095505015595 Global-Ocean-Sampling_GS-32-01-01-1... 80 3e-19 4
(EJ074432) 1095458111000 Global-Ocean-Sampling_GS-26-01-01-1... 60 5e-19 4
(FC721490) CBBG14078.fwd CBBG Lottia gigantea 12,15,18h embr... 68 6e-19 5
(EK127804) 1092993802255 Global-Ocean-Sampling_GS-31-01-01-1... 56 7e-19 4
(DQ011534) Escherichia fergusonii strain EC2781b serotype O1... 58 9e-19 5
(EJ328553) 1092963411910 Global-Ocean-Sampling_GS-28-01-01-1... 52 9e-19 7
(EK479816) 1095469510488 Global-Ocean-Sampling_GS-32-01-01-1... 60 1e-18 4
(EK405703) 1095500042541 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-18 5
(EJ007134) 1091139289796 Global-Ocean-Sampling_GS-26-01-01-1... 60 3e-18 4
(EJ743364) 1092962035875 Global-Ocean-Sampling_GS-30-02-01-1... 46 3e-18 5
(FF669028) G826P5377RB1.T0 Acorn worm normalized juvenile pE... 64 4e-18 4
(EA395083) Sequence 43907 from patent US 7314974. 66 4e-18 2
(EK226008) 1095460158933 Global-Ocean-Sampling_GS-31-01-01-1... 54 4e-18 5
(FF478771) G613P6204RF2.T0 Acorn worm blastula/gastrula pCMV... 64 4e-18 4
(DT935654) BAAC-PNP1281L04.g1 C.remanei EST SB146 Caenorhabd... 54 4e-18 3
(FF470216) G613P6054RB12.T0 Acorn worm blastula/gastrula pCM... 64 4e-18 4
(EJ277311) 1095366028214 Global-Ocean-Sampling_GS-27-01-01-1... 58 4e-18 3
(EJ350729) 1092963584704 Global-Ocean-Sampling_GS-28-01-01-1... 72 4e-18 3
(EJ543409) 1092955416385 Global-Ocean-Sampling_GS-29-01-01-1... 60 6e-18 4
(FF495932) G708P536RG2.T0 Acorn worm normalized gastrula pEx... 64 7e-18 4
(EJ015020) 1095433014726 Global-Ocean-Sampling_GS-26-01-01-1... 66 1e-17 4
(EA034911) Sequence 1 from patent US 7148005. 78 1e-17 4
(EA009979) Sequence 45 from patent US 7125661. 78 1e-17 4
(BD085554) Nucleic acid molecules specific for bacterial ant... 78 1e-17 4
(AF078736) Escherichia coli O111 O antigen gene cluster, par... 78 1e-17 4
(AX029261) Sequence 1 from Patent WO9850531. 78 1e-17 4
(EK058205) 1092960047594 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-17 3
(DQ465248) Escherichia coli strain O126 O antigen gene clust... 44 2e-17 7
(EK205606) 1095460072957 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-17 3
(FE258023) CAPH693.fwd CAPH Naegleria gruberi amoeba stage N... 66 3e-17 4
(EC825394) SME00004708 esmbsro2 Sawyeria marylandensis cDNA,... 70 5e-17 3
(U72147) Anabaena CA ORF4 and ORF3 genes, partial cds, and p... 62 8e-17 3
(FE249042) CAPH2051.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE258443) CAPH7149.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE251308) CAPH3374.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE259786) CAPH7906.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE254208) CAPH4937.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE250912) CAPH3140.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE256521) CAPH6156.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(Z68215) Caenorhabditis elegans Cosmid C53B4. 54 1e-16 7
(AJ605741) Yersinia enterocolitica (type 0:9) O-antigen gene... 54 1e-16 7
(FE254209) CAPH4937.fwd CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE260300) CAZN827.rev CAZN Naegleria gruberi Flagellate Sta... 66 1e-16 4
(FE249516) CAPH2326.fwd CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(EJ603191) 1092961212403 Global-Ocean-Sampling_GS-29-01-01-1... 50 1e-16 4
(FE249515) CAPH2326.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE256898) CAPH6346.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE232607) CAPG1839.rev CAPG Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE249731) CAPH2446.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE254010) CAPH4835.rev CAPH Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE245986) CAPG9179.rev CAPG Naegleria gruberi amoeba stage ... 66 1e-16 4
(FE250006) CAPH2606.rev CAPH Naegleria gruberi amoeba stage ... 66 2e-16 4
(ER338363) 1092344325295 Global-Ocean-Sampling_GS-34-01-01-1... 64 2e-16 3
(FE249501) CAPH2319.rev CAPH Naegleria gruberi amoeba stage ... 66 2e-16 4
(AF049343) Escherichia coli GDP-mannose dehydratase (rfbA) a... 58 2e-16 4
(AF387640) Coxiella burnetii dTDP-glucose-4,6 dehydratase, d... 58 3e-16 6
(EK010788) 1092955173949 Global-Ocean-Sampling_GS-31-01-01-1... 54 3e-16 3
(ER424254) 1092963737814 Global-Ocean-Sampling_GS-35-01-01-1... 48 3e-16 4
(EK248900) 1095460269188 Global-Ocean-Sampling_GS-31-01-01-1... 54 3e-16 6
(EJ934668) 1093018822115 Global-Ocean-Sampling_GS-30-02-01-1... 52 4e-16 4
(EJ124022) 1092343385788 Global-Ocean-Sampling_GS-27-01-01-1... 56 4e-16 4
(FE259787) CAPH7906.fwd CAPH Naegleria gruberi amoeba stage ... 66 5e-16 4
(EJ072126) 1095458092545 Global-Ocean-Sampling_GS-26-01-01-1... 44 7e-16 5
(FF746354) XABT56296.fwd Gateway compatible cien cDNA librar... 66 8e-16 5
(DY525239) BAAC-PNP1302L09.g1 C.remanei EST SB146 Caenorhabd... 54 8e-16 3
(FF711342) XABT31697.fwd Gateway compatible cien cDNA librar... 64 1e-15 5
(FE258444) CAPH7149.fwd CAPH Naegleria gruberi amoeba stage ... 66 1e-15 4
(FE254837) CAPH526.fwd CAPH Naegleria gruberi amoeba stage N... 66 2e-15 4
(FE251309) CAPH3374.fwd CAPH Naegleria gruberi amoeba stage ... 66 2e-15 4
(FE249732) CAPH2446.fwd CAPH Naegleria gruberi amoeba stage ... 66 2e-15 4
(FE254011) CAPH4835.fwd CAPH Naegleria gruberi amoeba stage ... 66 2e-15 4
(FE249502) CAPH2319.fwd CAPH Naegleria gruberi amoeba stage ... 66 2e-15 4
(EK164944) 1095458047275 Global-Ocean-Sampling_GS-31-01-01-1... 42 2e-15 5
(EK031044) 1092955408097 Global-Ocean-Sampling_GS-31-01-01-1... 54 2e-15 4
(EJ328304) 1092963411454 Global-Ocean-Sampling_GS-28-01-01-1... 46 2e-15 5
(ER363261) 1093018906299 Global-Ocean-Sampling_GS-34-01-01-1... 62 3e-15 4
(ES321965) Ps34 Wheat stripe rust fungus cDNA library Puccin... 54 3e-15 4
(EK036945) 1092959470591 Global-Ocean-Sampling_GS-31-01-01-1... 54 3e-15 4
(EJ404331) 1093012078029 Global-Ocean-Sampling_GS-28-01-01-1... 60 4e-15 3
(EJ836141) 1093017634961 Global-Ocean-Sampling_GS-30-02-01-1... 46 7e-15 6
(EJ352244) 1092963600770 Global-Ocean-Sampling_GS-28-01-01-1... 62 7e-15 4
(FK146960) XABT178112.b1 Gateway compatible cien cDNA librar... 64 1e-14 4
(EJ094744) 1095460271469 Global-Ocean-Sampling_GS-26-01-01-1... 72 1e-14 3
(EK417210) 1095515471823 Global-Ocean-Sampling_GS-31-01-01-1... 94 1e-14 1
(EK407560) 1095505091377 Global-Ocean-Sampling_GS-31-01-01-1... 94 1e-14 1
(AJ251712) Yersinia pseudotuberculosis serotype O:1b hemH ge... 52 2e-14 7
(FE257450) CAPH6634.rev CAPH Naegleria gruberi amoeba stage ... 58 2e-14 4
(CP001037) Nostoc punctiforme PCC 73102, complete genome. 66 2e-14 2
(ER615636) 1093017104997 Global-Ocean-Sampling_GS-36-01-01-2... 46 2e-14 5
(EK380904) 1095469461245 Global-Ocean-Sampling_GS-31-01-01-1... 44 3e-14 6
(AF061251) Eschericia coli serotype O157:H7 O antigen gene c... 58 3e-14 5
(EA034912) Sequence 2 from patent US 7148005. 58 3e-14 5
(EA009990) Sequence 56 from patent US 7125661. 58 3e-14 5
(BD085555) Nucleic acid molecules specific for bacterial ant... 58 3e-14 5
(AX029262) Sequence 2 from Patent WO9850531. 58 3e-14 5
(EK052594) 1092959718992 Global-Ocean-Sampling_GS-31-01-01-1... 48 3e-14 4
(BD184789) Nucleic acid molecule and polypeptide specific to... 58 3e-14 5
(AR637574) Sequence 121 from patent US 6855814. 58 3e-14 5
(AR204225) Sequence 121 from patent US 6365723. 58 3e-14 5
(EJ121073) 1092343373124 Global-Ocean-Sampling_GS-27-01-01-1... 48 3e-14 4
(EK495439) 1095505155910 Global-Ocean-Sampling_GS-32-01-01-1... 48 4e-14 4
(FE258305) CAPH7075.rev CAPH Naegleria gruberi amoeba stage ... 66 4e-14 3
(EJ522604) 1092955155644 Global-Ocean-Sampling_GS-29-01-01-1... 62 5e-14 4
(EX541929) AIAC-aaa98g03.b1 Ancylostoma_caninum_EST_Male_pSM... 48 5e-14 3
(ER598074) 1093016230113 Global-Ocean-Sampling_GS-36-01-01-2... 56 5e-14 3
(EJ066585) 1095458044370 Global-Ocean-Sampling_GS-26-01-01-1... 60 5e-14 3
(EA385233) Sequence 34057 from patent US 7314974. 48 6e-14 5
(DT758340) EST1192189 Aquilegia cDNA library Aquilegia formo... 74 1e-13 3
(FF491859) G708P5208RD1.T0 Acorn worm normalized gastrula pE... 56 1e-13 4
(EK201001) 1095460056644 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-13 3
(EK216936) 1095460121767 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-13 3
(FF606109) G825P5126RD9.T0 Acorn worm normalized gastrula pE... 56 2e-13 4
(FF470345) G613P6055RG8.T0 Acorn worm blastula/gastrula pCMV... 56 2e-13 4
(EK251491) 1095460282240 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-13 6
(EK063464) 1092960100747 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-13 3
(EJ166828) 1092344068714 Global-Ocean-Sampling_GS-27-01-01-1... 50 3e-13 4
(FC695501) CAXX5006.fwd CAXX Lottia gigantea from male gonad... 68 3e-13 4
(EK476263) 1095469483360 Global-Ocean-Sampling_GS-32-01-01-1... 74 4e-13 2
(FE255436) CAPH558.fwd CAPH Naegleria gruberi amoeba stage N... 66 4e-13 3
(EJ006039) 1091138302640 Global-Ocean-Sampling_GS-26-01-01-1... 52 4e-13 4
(EK267421) 1095462235905 Global-Ocean-Sampling_GS-31-01-01-1... 54 4e-13 5
(FE250913) CAPH3140.fwd CAPH Naegleria gruberi amoeba stage ... 66 4e-13 3
(FE239395) CAPG5342.fwd CAPG Naegleria gruberi amoeba stage ... 66 5e-13 3
(FE256899) CAPH6346.fwd CAPH Naegleria gruberi amoeba stage ... 66 5e-13 3
(FE249043) CAPH2051.fwd CAPH Naegleria gruberi amoeba stage ... 66 5e-13 3
(FE232787) CAPG1938.fwd CAPG Naegleria gruberi amoeba stage ... 66 5e-13 3
(AB008676) Escherichia coli 0157 DNA, map position at 46 min... 58 6e-13 5
(FE245987) CAPG9179.fwd CAPG Naegleria gruberi amoeba stage ... 66 6e-13 3
(FE256522) CAPH6156.fwd CAPH Naegleria gruberi amoeba stage ... 66 6e-13 3
(FE243955) CAPG7928.fwd CAPG Naegleria gruberi amoeba stage ... 66 6e-13 3
(FE232608) CAPG1839.fwd CAPG Naegleria gruberi amoeba stage ... 66 6e-13 3
(EJ581442) 1092960170987 Global-Ocean-Sampling_GS-29-01-01-1... 66 8e-13 3
(EJ332962) 1092963455219 Global-Ocean-Sampling_GS-28-01-01-1... 50 9e-13 4
(EJ296173) 1095388041128 Global-Ocean-Sampling_GS-27-01-01-1... 66 1e-12 3
(BQ836826) rf34f09.y1 Meloidogyne hapla J2 pAMP1 v1 Meloidog... 46 2e-12 4
(EJ411162) 1093012147358 Global-Ocean-Sampling_GS-28-01-01-1... 50 2e-12 4
(FK173150) XABT194341.b1 Gateway compatible cien cDNA librar... 54 2e-12 5
(DR949422) EST1140961 Aquilegia cDNA library Aquilegia formo... 70 2e-12 3
(EK465673) 1095469421254 Global-Ocean-Sampling_GS-32-01-01-1... 52 3e-12 4
(DR949421) EST1140960 Aquilegia cDNA library Aquilegia formo... 70 3e-12 3
(FE248920) CAPH1979.rev CAPH Naegleria gruberi amoeba stage ... 50 3e-12 4
(DT758339) EST1192188 Aquilegia cDNA library Aquilegia formo... 70 3e-12 3
(EI105880) ChBa_A_006C07.y01 Chesapeake Bay viral metagenome... 86 4e-12 1
(FE703293) Pv034B_M13R_C03.ab1 Phaseolus vulgaris cv Early g... 60 4e-12 4
(EJ612161) 1092962052567 Global-Ocean-Sampling_GS-29-01-01-1... 56 5e-12 4
(EJ156853) 1092344032732 Global-Ocean-Sampling_GS-27-01-01-1... 44 7e-12 4
(EJ787995) 1093017362239 Global-Ocean-Sampling_GS-30-02-01-1... 50 7e-12 4
(EK050119) 1092959688860 Global-Ocean-Sampling_GS-31-01-01-1... 76 8e-12 2
(ER584790) 1093015863571 Global-Ocean-Sampling_GS-36-01-01-2... 84 9e-12 2
(EK204165) 1095460067796 Global-Ocean-Sampling_GS-31-01-01-1... 50 1e-11 3
(BJ818394) Caenorhabditis elegans cDNA clone:yk1688g05 : 3' ... 52 1e-11 4
(EK196385) 1095460040160 Global-Ocean-Sampling_GS-31-01-01-1... 56 1e-11 3
(EJ541046) 1092955373546 Global-Ocean-Sampling_GS-29-01-01-1... 60 1e-11 3
(EE000569) ROE00008664 Rhizopus oryzae Company Rhizopus oryz... 44 1e-11 4
(CP000745) Methanococcus maripaludis C7, complete genome. 84 1e-11 1
(EE000809) ROE00011324 Rhizopus oryzae Company Rhizopus oryz... 44 1e-11 4
(GE362197) 292285894 Nasonia vitripennis Male Pupae Nasonia ... 66 1e-11 4
(ER287857) 1092343581042 Global-Ocean-Sampling_GS-34-01-01-1... 40 2e-11 5
(EE003138) ROE00011936 Rhizopus oryzae Company Rhizopus oryz... 44 2e-11 4
(EJ126377) 1092343395333 Global-Ocean-Sampling_GS-27-01-01-1... 48 2e-11 4
(EK177996) 1095458106692 Global-Ocean-Sampling_GS-31-01-01-1... 58 2e-11 3
(BC104708) Rattus norvegicus GDP-mannose 4, 6-dehydratase, m... 50 2e-11 4
(DR940082) EST1131621 Aquilegia cDNA library Aquilegia formo... 70 3e-11 2
(EK030634) 1092955404706 Global-Ocean-Sampling_GS-31-01-01-1... 72 3e-11 2
(DR923806) EST1115345 Aquilegia cDNA library Aquilegia formo... 70 3e-11 2
(DR925820) EST1117359 Aquilegia cDNA library Aquilegia formo... 70 3e-11 2
(DR940680) EST1132219 Aquilegia cDNA library Aquilegia formo... 70 3e-11 2
(EJ410208) 1093012133955 Global-Ocean-Sampling_GS-28-01-01-1... 42 5e-11 4
(EA414740) Sequence 16848 from patent US 7319142. 62 5e-11 6
(CB403761) OSTR012C9_1 AD-wrmcDNA Caenorhabditis elegans cDN... 52 7e-11 4
(GC493180) Sequence 65 from patent US 7393683. 42 9e-11 4
(DJ047929) CD10-specific antibody composition. 42 9e-11 4
(DI153209) Process for producing Antithrombin III composition. 42 9e-11 4
(DI152784) Process for producing Antithrombin III composition. 42 9e-11 4
(DI059314) CELLS PRODUCING ANTIBODY COMPOSITIONS. 42 9e-11 4
(DD462015) RECOMBINANT ANTIBODY COMPOSITION. 42 9e-11 4
(DD431824) Gene Recombinant Erythropoietin composition. 42 9e-11 4
(DD431799) Gene recombinant follicle stimulating hormone com... 42 9e-11 4
(DD431778) Gene Recombinant Haptoglobin Composition. 42 9e-11 4
(DD152054) Fusion protein composition. 42 9e-11 4
(DD152051) Method of producing Antithrombin III composition. 42 9e-11 4
(DD152024) Method of producing Antithrombin III composition. 42 9e-11 4
(DD152002) IL-5 receptor-specific antibody composition. 42 9e-11 4
(DD151983) CCR4-specific antibody composition. 42 9e-11 4
(DD151961) Human VFGF receptor Flt-1-specific antibody compo... 42 9e-11 4
(DD151943) CELL IN WHICH GENOME IS MODIFIED. 42 9e-11 4
(DD151926) Ganglioside GM2-specific antibody composition. 42 9e-11 4
(DD151862) Ganglioside GD3-specific antibody composition. 42 9e-11 4
(BD392274) Method of enhancing of binding activity of antibo... 42 9e-11 4
(BD392193) Production process for antibody composition. 42 9e-11 4
(BD392144) Production process for antibody composition. 42 9e-11 4
(BD343275) ANTI-CD20 ANTIBODY COMPOSITION. 42 9e-11 4
(BD168577) Cells producing antibody composition. 42 9e-11 4
(AR721244) Sequence 65 from patent US 6946292. 42 9e-11 4
(EJ892408) 1093018449714 Global-Ocean-Sampling_GS-30-02-01-1... 68 1e-10 2
(EK399328) 1095469534827 Global-Ocean-Sampling_GS-31-01-01-1... 46 1e-10 5
(EJ584502) 1092961007667 Global-Ocean-Sampling_GS-29-01-01-1... 60 1e-10 3
(AF525364) Cricetulus griseus GDP-mannose 4,6-dehydratase (G... 42 1e-10 4
(DD290985) Process for producing the glycoprotein composition. 42 1e-10 4
(FE257451) CAPH6634.fwd CAPH Naegleria gruberi amoeba stage ... 58 1e-10 3
(EK191890) 1095460021774 Global-Ocean-Sampling_GS-31-01-01-1... 66 1e-10 2
(FK084759) XABT139107.b1 Gateway compatible cien cDNA librar... 48 1e-10 4
(EK420108) 1095515500456 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-10 2
(EK129065) 1093000802079 Global-Ocean-Sampling_GS-31-01-01-1... 38 2e-10 5
(FK077240) XABT134296.b1 Gateway compatible cien cDNA librar... 46 3e-10 5
(ER284701) 1092343549490 Global-Ocean-Sampling_GS-34-01-01-1... 48 3e-10 4
(EK030726) 1092955404901 Global-Ocean-Sampling_GS-31-01-01-1... 52 3e-10 3
(FF439142) G142P60243RB10.T0 Acorn worm juvenile pCMVSport6 ... 64 3e-10 2
(ER483676) 1093015282652 Global-Ocean-Sampling_GS-35-01-01-1... 50 4e-10 4
(FE254836) CAPH526.rev CAPH Naegleria gruberi amoeba stage N... 42 4e-10 4
(EK251771) 1095460283812 Global-Ocean-Sampling_GS-31-01-01-1... 50 5e-10 3
(EK529082) 1095516001520 Global-Ocean-Sampling_GS-32-01-01-1... 50 5e-10 3
(EJ118819) 1092343364373 Global-Ocean-Sampling_GS-27-01-01-1... 64 5e-10 2
(ER332623) 1092344275966 Global-Ocean-Sampling_GS-34-01-01-1... 44 8e-10 4
(CP000937) Francisella philomiragia subsp. philomiragia ATCC... 78 9e-10 1
(ER547363) 1093016191173 Global-Ocean-Sampling_GS-35-01-01-1... 58 1e-09 3
(AY762939) Klebsiella pneumoniae strain DTS cps gene cluster... 56 1e-09 4
(EJ028254) 1095454032492 Global-Ocean-Sampling_GS-26-01-01-1... 48 1e-09 3
(AB117611) Klebsiella pneumoniae DNA, mucoviscosity-associat... 56 1e-09 5
(EJ082658) 1095460060234 Global-Ocean-Sampling_GS-26-01-01-1... 56 1e-09 3
(EK012970) 1092955209027 Global-Ocean-Sampling_GS-31-01-01-1... 54 2e-09 2
(EK497459) 1095505168750 Global-Ocean-Sampling_GS-32-01-01-1... 52 2e-09 3
(AB198423) Klebsiella pneumoniae DNA, cps loci and adjacent ... 56 2e-09 4
(EK126607) 1092986500539 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-09 5
(EK522521) 1095515630932 Global-Ocean-Sampling_GS-32-01-01-1... 52 2e-09 3
(EC819677) SME00006227 esmbsro2 Sawyeria marylandensis cDNA,... 64 2e-09 2
(FK171927) XABT193566.b1 Gateway compatible cien cDNA librar... 40 4e-09 5
(EJ591002) 1092961050233 Global-Ocean-Sampling_GS-29-01-01-1... 52 4e-09 3
(EJ180695) 1092344121146 Global-Ocean-Sampling_GS-27-01-01-1... 56 4e-09 2
(EK469404) 1095469441994 Global-Ocean-Sampling_GS-32-01-01-1... 60 4e-09 2
(EJ013750) 1095407100830 Global-Ocean-Sampling_GS-26-01-01-1... 64 4e-09 2
(CN622227) tad88b06.x1 Hydra EST Darmstadt I Hydra magnipapi... 56 5e-09 3
(AY406367) Mus musculus GMDS gene, VIRTUAL TRANSCRIPT, parti... 42 5e-09 4
(EJ599126) 1092961121945 Global-Ocean-Sampling_GS-29-01-01-1... 52 6e-09 3
(DD151945) CELL IN WHICH GENOME IS MODIFIED. 42 7e-09 4
(EJ373123) 1092963730405 Global-Ocean-Sampling_GS-28-01-01-1... 68 7e-09 3
(EJ283093) 1095368003414 Global-Ocean-Sampling_GS-27-01-01-1... 70 7e-09 2
(CZ547043) SRAA-aad71e06.b1 Strongyloides ratti whole genome... 50 8e-09 3
(ER455589) 1092963867575 Global-Ocean-Sampling_GS-35-01-01-1... 58 8e-09 2
(EK069554) 1092960173844 Global-Ocean-Sampling_GS-31-01-01-1... 48 9e-09 3
(AY939844) Cyanophage P-SSM2, complete genome. 58 9e-09 7
(EJ061049) 1095456066635 Global-Ocean-Sampling_GS-26-01-01-1... 50 1e-08 4
(BC031788) Mus musculus GDP-mannose 4, 6-dehydratase, mRNA (... 42 2e-08 4
(DD290987) Process for producing the glycoprotein composition. 42 2e-08 4
(ER582733) 1093015850302 Global-Ocean-Sampling_GS-36-01-01-2... 54 2e-08 4
(FF499721) G708P59RE12.T0 Acorn worm normalized gastrula pEx... 64 2e-08 2
(FF632036) G825P551RC2.T0 Acorn worm normalized gastrula pEx... 64 2e-08 2
(FF450694) G178P60131RA2.T0 Acorn worm gastrula/neurula pCMV... 64 2e-08 2
(BC093502) Mus musculus GDP-mannose 4, 6-dehydratase, mRNA (... 42 2e-08 4
(CP000488) Candidatus Ruthia magnifica str. Cm (Calyptogena ... 56 2e-08 15
(ER545671) 1093016172692 Global-Ocean-Sampling_GS-35-01-01-1... 64 2e-08 3
(EK031016) 1092955407781 Global-Ocean-Sampling_GS-31-01-01-1... 52 2e-08 3
(EJ334180) 1092963464690 Global-Ocean-Sampling_GS-28-01-01-1... 48 2e-08 3
(ER564869) 1093015763781 Global-Ocean-Sampling_GS-36-01-01-2... 50 2e-08 3
(EA380949) Sequence 29773 from patent US 7314974. 54 3e-08 3
(EJ382357) 1092963767277 Global-Ocean-Sampling_GS-28-01-01-1... 66 3e-08 2
(ER317342) 1092344152755 Global-Ocean-Sampling_GS-34-01-01-1... 42 3e-08 4
(BJ147192) Caenorhabditis elegans cDNA clone:yk1244a05 : 3' ... 48 3e-08 3
(CP000462) Aeromonas hydrophila subsp. hydrophila ATCC 7966,... 60 3e-08 2
(EJ997507) 1093024003594 Global-Ocean-Sampling_GS-30-02-01-1... 48 4e-08 4
(BA000037) Vibrio vulnificus YJ016 DNA, chromosome I, comple... 48 5e-08 2
(EK101406) 1092963018975 Global-Ocean-Sampling_GS-31-01-01-1... 46 5e-08 5
(CP000117) Anabaena variabilis ATCC 29413, complete genome. 72 5e-08 1
(ER422271) 1092963715677 Global-Ocean-Sampling_GS-35-01-01-1... 42 6e-08 4
(EJ398443) 1093012018907 Global-Ocean-Sampling_GS-28-01-01-1... 56 6e-08 2
(ER483738) 1093015283771 Global-Ocean-Sampling_GS-35-01-01-1... 58 7e-08 2
(DY891572) CeleSEQ10300 Cunninghamella elegans pBluescript (... 56 8e-08 2
(DC219146) Plasmodium berghei strain ANKA cDNA clone:MZ00057... 56 8e-08 3
(ER548262) 1093016198034 Global-Ocean-Sampling_GS-35-01-01-1... 56 8e-08 3
(FF085648) CPAD-aaa67a06.b1 PB2801_EST_CPAD1 Caenorhabditis ... 40 9e-08 3
(EX844692) CBNC5520.rev CBNC Phycomyces blakesleeanus NRRL15... 48 1e-07 4
(EX855480) CBNF11376.rev CBNF Phycomyces blakesleeanus NRRL1... 48 1e-07 4
(DD307219) NUCLEIC ACID AND POLYPEPTIDE SEQUENCES FROM LAWSO... 42 1e-07 5
(EX855481) CBNF11376.fwd CBNF Phycomyces blakesleeanus NRRL1... 48 1e-07 4
(EJ921776) 1093018646843 Global-Ocean-Sampling_GS-30-02-01-1... 46 1e-07 4
(BA000007) Escherichia coli O157:H7 str. Sakai DNA, complete... 58 1e-07 2
(AE005174) Escherichia coli O157:H7 EDL933, complete genome. 58 1e-07 2
(CP001164) Escherichia coli O157:H7 str. EC4115, complete ge... 58 1e-07 2
(BH395417) AG-ND-160J2.TF ND-TAM Anopheles gambiae genomic c... 38 1e-07 4
(EJ932463) 1093018813231 Global-Ocean-Sampling_GS-30-02-01-1... 38 2e-07 4
(BH371859) AG-ND-164F8.TF ND-TAM Anopheles gambiae genomic c... 38 2e-07 4
(CP000393) Trichodesmium erythraeum IMS101, complete genome. 60 2e-07 2
(AE016828) Coxiella burnetii RSA 493, complete genome. 58 2e-07 2
(CP001019) Coxiella burnetii CbuG_Q212, complete genome. 58 2e-07 2
(CP000383) Cytophaga hutchinsonii ATCC 33406, complete genome. 48 2e-07 3
(CP001020) Coxiella burnetii CbuK_Q154, complete genome. 58 2e-07 2
(BH404994) AG-ND-129F4.TF ND-TAM Anopheles gambiae genomic c... 70 2e-07 1
(ER309966) 1092343785280 Global-Ocean-Sampling_GS-34-01-01-1... 70 2e-07 1
(EJ291157) 1095383002476 Global-Ocean-Sampling_GS-27-01-01-1... 70 2e-07 1
(CP000733) Coxiella burnetii Dugway 5J108-111, complete genome. 58 2e-07 2
(DU731997) APKI1508.b2 HF70_10-07-02 uncultured marine micro... 44 2e-07 4
(EJ219630) 1092351206456 Global-Ocean-Sampling_GS-27-01-01-1... 54 2e-07 2
(EJ786905) 1093017355039 Global-Ocean-Sampling_GS-30-02-01-1... 50 3e-07 3
(FE258022) CAPH693.rev CAPH Naegleria gruberi amoeba stage N... 40 3e-07 4
(FK066100) XABT127530.b1 Gateway compatible cien cDNA librar... 40 3e-07 4
(FK206646) XABT215032.b1 Gateway compatible cien cDNA librar... 42 3e-07 4
(EJ811440) 1093017491599 Global-Ocean-Sampling_GS-30-02-01-1... 44 3e-07 3
(EJ692988) 1092956009344 Global-Ocean-Sampling_GS-30-02-01-1... 50 3e-07 2
(ER420186) 1092963699045 Global-Ocean-Sampling_GS-35-01-01-1... 40 3e-07 4
(AF285969) Salmonella enterica O antigen gene cluster, compl... 60 4e-07 5
(EK122625) 1092964603600 Global-Ocean-Sampling_GS-31-01-01-1... 52 4e-07 3
(EK574470) 1095521129664 Global-Ocean-Sampling_GS-32-01-01-1... 50 4e-07 2
(EX844693) CBNC5520.fwd CBNC Phycomyces blakesleeanus NRRL15... 34 4e-07 6
(EK055474) 1092960017054 Global-Ocean-Sampling_GS-31-01-01-1... 58 4e-07 2
(EX854535) CBNF10752.fwd CBNF Phycomyces blakesleeanus NRRL1... 34 4e-07 6
(ER461230) 1092963895756 Global-Ocean-Sampling_GS-35-01-01-1... 42 4e-07 3
(ER495756) 1093015346844 Global-Ocean-Sampling_GS-35-01-01-1... 42 4e-07 3
(EE000158) ROE00008642 Rhizopus oryzae Company Rhizopus oryz... 52 5e-07 3
(EJ326557) 1092963392828 Global-Ocean-Sampling_GS-28-01-01-1... 60 5e-07 2
(ER558332) 1093015730305 Global-Ocean-Sampling_GS-36-01-01-2... 40 6e-07 4
(CP000890) Coxiella burnetii RSA 331, complete genome. 58 6e-07 14
(EJ362123) 1092963691100 Global-Ocean-Sampling_GS-28-01-01-1... 44 7e-07 4
(AE001437) Clostridium acetobutylicum ATCC 824, complete gen... 58 7e-07 2
(EJ287924) 1095370001287 Global-Ocean-Sampling_GS-27-01-01-1... 68 8e-07 1
(CU466930) Candidatus Cloacamonas acidaminovorans provisiona... 68 8e-07 1
(ER526213) 1093015644950 Global-Ocean-Sampling_GS-35-01-01-1... 52 9e-07 2
(ER542849) 1093016085786 Global-Ocean-Sampling_GS-35-01-01-1... 54 1e-06 2
(AJ251713) Yersinia pestis strain EV76 hemH gene (partial) a... 42 1e-06 6
(ER339444) 1092344333148 Global-Ocean-Sampling_GS-34-01-01-1... 42 1e-06 3
(EJ153721) 1092343792156 Global-Ocean-Sampling_GS-27-01-01-1... 50 1e-06 2
(EJ887158) 1093018423957 Global-Ocean-Sampling_GS-30-02-01-1... 54 1e-06 3
(EK413436) 1095505217287 Global-Ocean-Sampling_GS-31-01-01-1... 42 1e-06 3
(FE380083) CBNS4263.fwd CBNS_Daphnia_pulex_Chosen_One_Librar... 46 1e-06 4
(CN769342) taf32a11.x1 Hydra EST Darmstadt I Hydra magnipapi... 56 1e-06 2
(FE371719) CBNP2719.fwd CBNP_Daphnia_pulex_Chosen_One_Librar... 46 2e-06 4
(EJ677711) 1092955098883 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-06 2
(EJ236975) 1095306074230 Global-Ocean-Sampling_GS-27-01-01-1... 44 2e-06 3
(EJ979184) 1093022141398 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-06 2
(FE411656) CBTU2619.fwd CBTU_Daphnia_pulex_Chosen_One_Librar... 46 2e-06 4
(AB353134) Vibrio parahaemolyticus DNA, O and K-antigen bios... 58 2e-06 3
(CK175361) EST764681 BEA Rhipicephalus microplus cDNA clone ... 42 2e-06 3
(EJ336691) 1092963483135 Global-Ocean-Sampling_GS-28-01-01-1... 46 2e-06 3
(EJ969710) 1093022072077 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-06 2
(EJ888180) 1093018428757 Global-Ocean-Sampling_GS-30-02-01-1... 54 2e-06 3
(EJ679324) 1092955117458 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-06 2
(ER483058) 1093015279499 Global-Ocean-Sampling_GS-35-01-01-1... 48 2e-06 3
(EU795297) Uncultured bacterium AZOG21036 genomic sequence. 52 2e-06 5
(EK437701) 1095521098973 Global-Ocean-Sampling_GS-31-01-01-1... 36 2e-06 4
(BH400630) AG-ND-164D9.TR ND-TAM Anopheles gambiae genomic c... 66 3e-06 1
(EK509942) 1095515473175 Global-Ocean-Sampling_GS-32-01-01-1... 66 3e-06 1
(ER531707) 1093015763974 Global-Ocean-Sampling_GS-35-01-01-1... 46 4e-06 3
(CN193477) rg87d03.y1 Meloidogyne hapla female SMART pGEM Me... 46 4e-06 3
(EK118875) 1092963305223 Global-Ocean-Sampling_GS-31-01-01-1... 52 5e-06 2
(EK478211) 1095469498245 Global-Ocean-Sampling_GS-32-01-01-1... 56 5e-06 3
(EJ681531) 1092955133608 Global-Ocean-Sampling_GS-30-02-01-1... 42 5e-06 4
(EJ681854) 1092955136090 Global-Ocean-Sampling_GS-30-02-01-1... 42 6e-06 3
(EK361385) 1095469010061 Global-Ocean-Sampling_GS-31-01-01-1... 38 6e-06 4
(EA393604) Sequence 42428 from patent US 7314974. 42 6e-06 3
(ER441611) 1092963815538 Global-Ocean-Sampling_GS-35-01-01-1... 48 6e-06 2
(CP000612) Desulfotomaculum reducens MI-1, complete genome. 42 1e-05 2
(EA393747) Sequence 42571 from patent US 7314974. 64 1e-05 1
(EK311145) 1095462397334 Global-Ocean-Sampling_GS-31-01-01-1... 64 1e-05 1
(EJ276772) 1095366024741 Global-Ocean-Sampling_GS-27-01-01-1... 64 1e-05 1
(DC244060) Petunia axillaris subsp. axillaris cDNA, clone: p... 64 1e-05 1
(U75690) Nostoc sp. PCC 7120 first mannosyl transferase (rfb... 64 1e-05 1
(BA000019) Nostoc sp. PCC 7120 DNA, complete genome. 64 1e-05 1
(EK069932) 1092960177638 Global-Ocean-Sampling_GS-31-01-01-1... 40 1e-05 3
(ER428732) 1092963766963 Global-Ocean-Sampling_GS-35-01-01-1... 50 1e-05 2
(CP000083) Colwellia psychrerythraea 34H, complete genome. 60 1e-05 4
(EJ603305) 1092961213006 Global-Ocean-Sampling_GS-29-01-01-1... 46 1e-05 2
(EJ624125) 1092963122260 Global-Ocean-Sampling_GS-29-01-01-1... 44 1e-05 3
(EK262449) 1095462185889 Global-Ocean-Sampling_GS-31-01-01-1... 52 2e-05 2
(FC853627) CBHN8011.fwd CBHN Metridium senile tentacle Metri... 44 2e-05 3
(EJ959673) 1093018995933 Global-Ocean-Sampling_GS-30-02-01-1... 48 2e-05 3
(FK119137) XABT161333.b1 Gateway compatible cien cDNA librar... 54 2e-05 2
(EX834455) CBNB4565.fwd CBNB Phycomyces blakesleeanus NRRL15... 36 2e-05 4
(EK191258) 1095460019976 Global-Ocean-Sampling_GS-31-01-01-1... 50 2e-05 3
(EK284121) 1095462306817 Global-Ocean-Sampling_GS-31-01-01-1... 44 2e-05 3
(EJ514167) 1092343604188 Global-Ocean-Sampling_GS-29-01-01-1... 40 2e-05 3
(EX851340) CBNC8969.fwd CBNC Phycomyces blakesleeanus NRRL15... 36 2e-05 4
(EK312389) 1095462401195 Global-Ocean-Sampling_GS-31-01-01-1... 38 2e-05 3
(EJ204302) 1092344327827 Global-Ocean-Sampling_GS-27-01-01-1... 36 2e-05 4
(EX846929) CBNC6643.fwd CBNC Phycomyces blakesleeanus NRRL15... 36 2e-05 4
(EJ945350) 1093018910696 Global-Ocean-Sampling_GS-30-02-01-1... 58 2e-05 2
(ER399962) 1095349049127 Global-Ocean-Sampling_GS-34-01-01-1... 56 2e-05 3
(EX814292) CBNA3962.fwd CBNA Phycomyces blakesleeanus NRRL15... 36 2e-05 4
(EX847516) CBNC6938.fwd CBNC Phycomyces blakesleeanus NRRL15... 36 2e-05 4
(EX854384) CBNF10661.fwd CBNF Phycomyces blakesleeanus NRRL1... 36 2e-05 4
(EJ179908) 1092344116546 Global-Ocean-Sampling_GS-27-01-01-1... 58 2e-05 2
(EK498541) 1095505198674 Global-Ocean-Sampling_GS-32-01-01-1... 50 2e-05 2
(EJ507995) 1095407015893 Global-Ocean-Sampling_GS-28-01-01-1... 58 2e-05 2
(EJ578118) 1092960127482 Global-Ocean-Sampling_GS-29-01-01-1... 60 2e-05 2
(DC219301) Plasmodium berghei strain ANKA cDNA clone:MZ00082... 56 2e-05 2
(EK286790) 1095462315752 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-05 2
(EJ348882) 1092963568328 Global-Ocean-Sampling_GS-28-01-01-1... 58 2e-05 2
(EJ815402) 1093017512863 Global-Ocean-Sampling_GS-30-02-01-1... 44 2e-05 3
(EJ101348) 1095469536776 Global-Ocean-Sampling_GS-26-01-01-1... 62 2e-05 2
(EK373064) 1095469426716 Global-Ocean-Sampling_GS-31-01-01-1... 36 3e-05 4
(EJ678275) 1092955106420 Global-Ocean-Sampling_GS-30-02-01-1... 40 3e-05 4
(EJ722393) 1092959460570 Global-Ocean-Sampling_GS-30-02-01-1... 40 3e-05 4
(EK030131) 1092955401379 Global-Ocean-Sampling_GS-31-01-01-1... 40 3e-05 4
(AY223181) Schistosoma japonicum SJCHGC02171 protein mRNA, c... 54 3e-05 4
(CP000518) Mycobacterium sp. KMS, complete genome. 32 3e-05 3
(CP000384) Mycobacterium sp. MCS, complete genome. 32 3e-05 3
(EK151263) 1095456052545 Global-Ocean-Sampling_GS-31-01-01-1... 40 4e-05 3
(EX559467) AIAE-aaa74c05.b1 Ancylostoma_caninum_EST_Female_p... 48 4e-05 3
(EX860386) CBNF5456.fwd CBNF Phycomyces blakesleeanus NRRL15... 48 4e-05 3
(EX860385) CBNF5456.rev CBNF Phycomyces blakesleeanus NRRL15... 48 4e-05 3
(CJ413636) Molgula tectiformis cDNA, larva clone:mtlv016d17,... 32 4e-05 5
(FF800250) XABT92912.fwd Gateway compatible cien cDNA librar... 36 4e-05 4
(FE378265) CBNS3176.fwd CBNS_Daphnia_pulex_Chosen_One_Librar... 46 4e-05 3
(EX554774) AIAE-aaa74c05.g1 Ancylostoma_caninum_EST_Female_p... 46 4e-05 2
(EX854534) CBNF10752.rev CBNF Phycomyces blakesleeanus NRRL1... 48 5e-05 3
(FE397966) CBTS1092.rev CBTS_Daphnia_pulex_Chosen_One_Librar... 46 5e-05 3
(U81805) Arabidopsis thaliana GDP-D-mannose-4,6-dehydratase ... 62 5e-05 1
(BT025710) Arabidopsis thaliana. 62 5e-05 1
(AY084574) Arabidopsis thaliana clone 11217 mRNA, complete s... 62 5e-05 1
(AL132980) Arabidopsis thaliana DNA chromosome 3, BAC clone ... 62 5e-05 1
(DD259478) Yeast transformant into which genes associated wi... 62 5e-05 1
(BX822751) Arabidopsis thaliana Full-length cDNA Complete se... 62 5e-05 1
(EJ556669) 1092959507154 Global-Ocean-Sampling_GS-29-01-01-1... 62 5e-05 1
(EJ485983) 1095403500856 Global-Ocean-Sampling_GS-28-01-01-1... 62 5e-05 1
(CC179018) SALK_057153.49.05.x Arabidopsis thaliana TDNA ins... 62 5e-05 1

>(C90350) Dictyostelium discoideum slug cDNA, clone SSI286.
Length = 734

Score = 1451 bits (732), Expect = 0.0
Identities = 732/732 (100%)
Strand = Plus / Plus


Query: 419 tcgtttattggatgcaattcgtagttgtggtatggagaaaaaggttaaatattatcaagc 478
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 tcgtttattggatgcaattcgtagttgtggtatggagaaaaaggttaaatattatcaagc 60


Query: 479 ttcaacctctgaattatatggtaaagttcaagagattccacaatcagagaccacaccatt 538
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ttcaacctctgaattatatggtaaagttcaagagattccacaatcagagaccacaccatt 120


Query: 539 ctatccacgttcaccatacgctgtcgcaaagcaatatgcctattggatcgttgtaaacta 598
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ctatccacgttcaccatacgctgtcgcaaagcaatatgcctattggatcgttgtaaacta 180


Query: 599 tcgtgaggcttacgatatgtatgcatgtaatggtatcttattcaatcatgaatcaccacg 658
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tcgtgaggcttacgatatgtatgcatgtaatggtatcttattcaatcatgaatcaccacg 240


Query: 659 tagaggtccaacttttgtaactagaaagatcactcgtttcgttgctggtattgcatgtgg 718
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 tagaggtccaacttttgtaactagaaagatcactcgtttcgttgctggtattgcatgtgg 300


Query: 719 tagagatgaaattctctacttgggtaatatcaacgctaaacgtgattggggtcacgctag 778
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tagagatgaaattctctacttgggtaatatcaacgctaaacgtgattggggtcacgctag 360


Query: 779 agattacgttgaagcaatgtggttaatgttacaacaagagaagccagaagatttcgttat 838
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 agattacgttgaagcaatgtggttaatgttacaacaagagaagccagaagatttcgttat 420


Query: 839 tgccactggtgaaactcattcagttcgtgaatttgttgaaaaatcattcaaagaaattga 898
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 tgccactggtgaaactcattcagttcgtgaatttgttgaaaaatcattcaaagaaattga 480


Query: 899 tatcatcatcaaatggagaggtgaagcagaaaaagaagaaggttactgtgaaaagactgg 958
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tatcatcatcaaatggagaggtgaagcagaaaaagaagaaggttactgtgaaaagactgg 540


Query: 959 taaagtttacgttaaaattgatgagaaatattacagaccaactgaagttgatcttttact 1018
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 taaagtttacgttaaaattgatgagaaatattacagaccaactgaagttgatcttttact 600


Query: 1019 tggtaatccaaataaagcaaagaaattattacaatggcaaattaaaacttcttttggtga 1078
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 tggtaatccaaataaagcaaagaaattattacaatggcaaattaaaacttcttttggtga 660


Query: 1079 actcgttaaagaaatggttgctaaagatattgaatatattaaaaatggtgataaatataa 1138
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 actcgttaaagaaatggttgctaaagatattgaatatattaaaaatggtgataaatataa 720


Query: 1139 ttaaatttttct 1150
||||||||||||
Sbjct: 721 ttaaatttttct 732

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,422,220,816
Number of extensions: 86642396
Number of successful extensions: 7253772
Number of sequences better than 10.0: 1240
Length of query: 1210
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1186
Effective length of database: 96,409,374,237
Effective search space: 114341517845082
Effective search space used: 114341517845082
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.27
Homology vs Protein
Query= Contig-U16369-1 (Contig-U16369-1Q) /CSM_Contig/Contig-U16369-1Q.Seq.d
(1210 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

CR761176_1(CR761176|pid:none) Xenopus tropicalis finished cDNA, ... 497 e-139
BC042270_1(BC042270|pid:none) Xenopus laevis GDP-mannose 4, 6-de... 496 e-139
BC073020_1(BC073020|pid:none) Xenopus laevis MGC82624 protein, m... 495 e-138
BC104708_1(BC104708|pid:none) Rattus norvegicus GDP-mannose 4, 6... 494 e-138
BT049328_1(BT049328|pid:none) Salmo salar clone ssal-plnb-025-16... 493 e-138
AY891140_1(AY891140|pid:none) Synthetic construct Homo sapiens c... 493 e-138
(O60547) RecName: Full=GDP-mannose 4,6 dehydratase; EC=... 493 e-138
AB170853_1(AB170853|pid:none) Macaca fascicularis brain cDNA clo... 491 e-137
AB290320_1(AB290320|pid:none) Danio rerio L-GMDS mRNA for GDP-ma... 486 e-136
AM236083_130(AM236083|pid:none) Rhizobium leguminosarum bv. vici... 474 e-132
CP001626_259(CP001626|pid:none) Rhizobium leguminosarum bv. trif... 473 e-132
CP000133_1331(CP000133|pid:none) Rhizobium etli CFN 42, complete... 472 e-131
AF040260_1(AF040260|pid:none) Homo sapiens GDP-D-mannose-4,6-deh... 471 e-131
AE008384_659(AE008384|pid:none) Methanosarcina mazei strain Goe1... 470 e-131
T20182(T20182) hypothetical protein C53B4.7 - Caenorhabditis ele... 469 e-131
AM231687_1(AM231687|pid:none) Drosophila melanogaster mRNA for G... 469 e-131
(Q18801) RecName: Full=GDP-mannose 4,6 dehydratase 1; E... 469 e-131
AM231685_1(AM231685|pid:none) Caenorhabditis elegans partial mRN... 462 e-128
CP000834_57(CP000834|pid:none) Dinoroseobacter shibae DFL 12 pla... 461 e-128
BT078126_1(BT078126|pid:none) Lepeophtheirus salmonis Pacific fo... 461 e-128
CP000100_1340(CP000100|pid:none) Synechococcus elongatus PCC 794... 461 e-128
CP000099_31(CP000099|pid:none) Methanosarcina barkeri str. Fusar... 459 e-128
CP000613_3944(CP000613|pid:none) Rhodospirillum centenum SW, com... 458 e-127
CP000698_3153(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 457 e-127
CP000494_5360(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 457 e-127
CP000115_2371(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 457 e-127
BT076898_1(BT076898|pid:none) Caligus rogercresseyi clone crog-e... 456 e-127
AL672114_116(AL672114|pid:none) Mesorhizobium loti R7A symbiosis... 456 e-127
BA000040_5465(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 456 e-127
AE008917_1412(AE008917|pid:none) Brucella melitensis 16M chromos... 456 e-126
CP001616_2022(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 456 e-126
CP000745_336(CP000745|pid:none) Methanococcus maripaludis C7, co... 456 e-126
BT080910_1(BT080910|pid:none) Caligus clemensi clone ccle-evs-50... 455 e-126
BA000012_4546(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 455 e-126
CP001191_420(CP001191|pid:none) Rhizobium leguminosarum bv. trif... 455 e-126
CP000116_1776(CP000116|pid:none) Thiobacillus denitrificans ATCC... 455 e-126
CP000655_301(CP000655|pid:none) Polynucleobacter necessarius sub... 454 e-126
CP000911_525(CP000911|pid:none) Brucella suis ATCC 23445 chromos... 454 e-126
AE010299_1140(AE010299|pid:none) Methanosarcina acetivorans str.... 454 e-126
AF285774_4(AF285774|pid:none) Bacteroides fragilis NCTC 9343 PS ... 453 e-126
AP009380_1078(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 453 e-126
CP001340_470(CP001340|pid:none) Caulobacter crescentus NA1000, c... 453 e-126
E88769(E88769)protein C53B4.7 [imported] - Caenorhabditis elegans 453 e-126
CP001110_540(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 452 e-125
BA000040_1631(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 452 e-125
CP000555_2723(CP000555|pid:none) Methylibium petroleiphilum PM1,... 452 e-125
CP000139_2574(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 452 e-125
AE015928_1224(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 451 e-125
CP000492_2519(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 451 e-125
CP001074_833(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 451 e-125
AP009240_2312(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 451 e-125
CP001124_1123(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 451 e-125
CP001110_524(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 451 e-125
AY730592_8(AY730592|pid:none) Citrobacter freundii serotype 90 U... 450 e-125
AB289650_12(AB289650|pid:none) Klebsiella pneumoniae capsular po... 450 e-125
(Q56598) RecName: Full=Probable GDP-mannose 4,6-dehydratase; ... 450 e-125
AY217096_2(AY217096|pid:none) Escherichia coli O128:B12 O-antige... 449 e-125
CP000783_1123(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 449 e-125
AY220982_5(AY220982|pid:none) Escherichia coli O86:B7 O-antigen ... 449 e-125
CP000685_328(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 449 e-125
AE017126_63(AE017126|pid:none) Prochlorococcus marinus subsp. ma... 449 e-125
AB012957_12(AB012957|pid:none) Vibrio cholerae genes for o-antig... 449 e-125
AM849474_13(AM849474|pid:none) Yersinia pseudotuberculosis O pol... 449 e-124
EF101928_804(EF101928|pid:none) Acanthocystis turfacea Chlorella... 449 e-124
AY730593_8(AY730593|pid:none) Salmonella enterica subsp. enteric... 448 e-124
AE006468_2049(AE006468|pid:none) Salmonella enterica subsp. ente... 448 e-124
BA000037_349(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr... 448 e-124
AE015924_1108(AE015924|pid:none) Porphyromonas gingivalis W83, c... 448 e-124
EF204526_3(EF204526|pid:none) Salmonella enterica subsp. enteric... 448 e-124
CU928158_2036(CU928158|pid:none) Escherichia fergusonii ATCC 354... 448 e-124
CP000026_714(CP000026|pid:none) Salmonella enterica subsp. enter... 448 e-124
CP000822_705(CP000822|pid:none) Citrobacter koseri ATCC BAA-895,... 448 e-124
AB353131_24(AB353131|pid:none) Escherichia coli O55:H7 DNA for O... 447 e-124
CP000774_1915(CP000774|pid:none) Parvibaculum lavamentivorans DS... 447 e-124
CP000482_3356(CP000482|pid:none) Pelobacter propionicus DSM 2379... 447 e-124
CP001113_2151(CP001113|pid:none) Salmonella enterica subsp. ente... 447 e-124
AF503594_2(AF503594|pid:none) Pectobacterium chrysanthemi ManB (... 447 e-124
AY493508_4(AY493508|pid:none) Escherichia coli serotype O127:K63... 446 e-124
AB198423_17(AB198423|pid:none) Klebsiella pneumoniae DNA, cps lo... 446 e-124
U24571_3(U24571|pid:none) Vibrio cholerae otnB and rfbQRS genes,... 446 e-124
AB117611_7(AB117611|pid:none) Klebsiella pneumoniae DNA, mucovis... 446 e-124
AF078736_3(AF078736|pid:none) Escherichia coli O111 O antigen ge... 446 e-124
CP000462_2824(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 446 e-124
CP001089_1470(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 446 e-124
CP000272_1024(CP000272|pid:none) Burkholderia xenovorans LB400 c... 446 e-124
CP000111_1436(CP000111|pid:none) Prochlorococcus marinus str. MI... 445 e-123
CP000488_813(CP000488|pid:none) Candidatus Ruthia magnifica str.... 445 e-123
AF146601_9(AF146601|pid:none) Aeromonas hydrophila clone F121-12... 444 e-123
EU296402_7(EU296402|pid:none) Shigella dysenteriae type 4 O-anti... 444 e-123
(Q56872) RecName: Full=Probable GDP-mannose 4,6-dehydratase; ... 444 e-123
CU207366_545(CU207366|pid:none) Gramella forsetii KT0803 complet... 444 e-123
AB0769(AB0769) GDPmannose 4,6-dehydratase (EC 4.2.1.47) - Salmon... 443 e-123
CP000247_2074(CP000247|pid:none) Escherichia coli 536, complete ... 443 e-123
CT978603_217(CT978603|pid:none) Synechococcus sp. RCC307 genomic... 442 e-123
CP001101_1857(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 442 e-123
AB008676_8(AB008676|pid:none) Escherichia coli 0157 DNA, map pos... 442 e-122
S70961(S70961) rfbD protein - Vibrio cholerae (fragment) &X9054... 442 e-122
CP001100_2045(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 442 e-122
(O85713) RecName: Full=GDP-mannose 4,6-dehydratase; EC=... 441 e-122
EU294176_6(EU294176|pid:none) Escherichia coli serogroup O159 O ... 441 e-122
AE001437_2151(AE001437|pid:none) Clostridium acetobutylicum ATCC... 441 e-122
CP000097_174(CP000097|pid:none) Synechococcus sp. CC9902, comple... 440 e-122
(Q06952) RecName: Full=Probable GDP-mannose 4,6-dehydratase; ... 439 e-122
(P55354) RecName: Full=GDP-mannose 4,6-dehydratase; EC=... 439 e-121
AJ605741_6(AJ605741|pid:none) Yersinia enterocolitica (type 0:9)... 439 e-121
AF222753_27(AF222753|pid:none) Bradyrhizobium sp. WM9 nodulation... 438 e-121
CP000240_1069(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 438 e-121
CP001349_6072(CP001349|pid:none) Methylobacterium nodulans ORS 2... 438 e-121
AM181176_3587(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 438 e-121
AE016823_3076(AE016823|pid:none) Leptospira interrogans serovar ... 437 e-121
CP000576_1445(CP000576|pid:none) Prochlorococcus marinus str. MI... 437 e-121
AE010300_3961(AE010300|pid:none) Leptospira interrogans serovar ... 436 e-121
CP001279_1606(CP001279|pid:none) Nautilia profundicola AmH, comp... 436 e-121
CP001052_790(CP001052|pid:none) Burkholderia phytofirmans PsJN c... 436 e-120
CP000510_746(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 436 e-120
CP000825_1411(CP000825|pid:none) Prochlorococcus marinus str. MI... 435 e-120
CP000270_597(CP000270|pid:none) Burkholderia xenovorans LB400 ch... 434 e-120
CP000230_253(CP000230|pid:none) Rhodospirillum rubrum ATCC 11170... 434 e-120
CP001358_404(CP001358|pid:none) Desulfovibrio desulfuricans subs... 433 e-120
AJ871364_4(AJ871364|pid:none) Yersinia sp. A125 KOH2 O-antigen g... 433 e-120
CP000353_2232(CP000353|pid:none) Ralstonia metallidurans CH34 me... 433 e-120
CP001032_4224(CP001032|pid:none) Opitutus terrae PB90-1, complet... 432 e-120
CT971583_114(CT971583|pid:none) Synechococcus WH7803 complete ge... 431 e-119
CU633750_37(CU633750|pid:none) Cupriavidus taiwanensis str. LMG1... 431 e-119
BX569690_68(BX569690|pid:none) Synechococcus sp. WH8102 complete... 431 e-119
CP000937_1249(CP000937|pid:none) Francisella philomiragia subsp.... 430 e-119
CP000282_2113(CP000282|pid:none) Saccharophagus degradans 2-40, ... 430 e-119
DQ366712_3(DQ366712|pid:none) Uncultured Prochlorococcus marinus... 429 e-118
CP000377_1482(CP000377|pid:none) Silicibacter sp. TM1040, comple... 428 e-118
CP000859_1277(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 427 e-118
CP000552_1367(CP000552|pid:none) Prochlorococcus marinus str. MI... 426 e-118
CP001656_404(CP001656|pid:none) Paenibacillus sp. JDR-2, complet... 426 e-118
CR522870_25(CR522870|pid:none) Desulfotalea psychrophila LSv54 c... 425 e-117
FN357450_8(FN357450|pid:none) Schistosoma mansoni genome sequenc... 424 e-117
CP001037_3089(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 424 e-117
AY458649_114(AY458649|pid:none) Uncultured marine bacterium 582 ... 423 e-117
U72147_3(U72147|pid:none) Anabaena CA ORF4 and ORF3 genes, parti... 422 e-116
AY939844_257(AY939844|pid:none) Cyanophage P-SSM2, complete geno... 422 e-116
AM260522_49(AM260522|pid:none) Helicobacter acinonychis str. She... 422 e-116
CP000551_1396(CP000551|pid:none) Prochlorococcus marinus str. AS... 420 e-116
CR954214_64(CR954214|pid:none) Ostreococcus tauri strain OTTH059... 419 e-116
CP001291_3316(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 419 e-115
CP000489_1286(CP000489|pid:none) Paracoccus denitrificans PD1222... 418 e-115
AE014292_404(AE014292|pid:none) Brucella suis 1330 chromosome II... 417 e-115
CP001287_2462(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 417 e-115
AE000511_43(AE000511|pid:none) Helicobacter pylori 26695, comple... 416 e-115
CP000759_615(CP000759|pid:none) Ochrobactrum anthropi ATCC 49188... 416 e-114
CP000912_390(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 416 e-114
CP001080_1360(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 415 e-114
CP001173_39(CP001173|pid:none) Helicobacter pylori G27, complete... 415 e-114
CP001147_460(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 415 e-114
CP001072_41(CP001072|pid:none) Helicobacter pylori Shi470, compl... 414 e-114
CP001229_1169(CP001229|pid:none) Sulfurihydrogenibium azorense A... 414 e-114
CP000241_42(CP000241|pid:none) Helicobacter pylori HPAG1, comple... 414 e-114
AE017125_172(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 413 e-114
BX548174_1394(BX548174|pid:none) Prochlorococcus marinus MED4 co... 410 e-113
BA000022_7(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA, co... 410 e-113
AM746334_1(AM746334|pid:none) Trypanosoma brucei brucei GMD gene... 409 e-112
AP009552_2989(AP009552|pid:none) Microcystis aeruginosa NIES-843... 408 e-112
AM778929_15(AM778929|pid:none) Microcystis aeruginosa PCC 7806 g... 406 e-112
CP000951_2523(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 405 e-111
CP000251_4273(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 402 e-110
AE010299_1141(AE010299|pid:none) Methanosarcina acetivorans str.... 399 e-110
(Q9SNY3) RecName: Full=GDP-mannose 4,6 dehydratase 1; E... 397 e-109
AE008206_11(AE008206|pid:none) Agrobacterium tumefaciens str. C5... 394 e-108
(P93031) RecName: Full=GDP-mannose 4,6 dehydratase 2; E... 393 e-108
AY084574_1(AY084574|pid:none) Arabidopsis thaliana clone 11217 m... 391 e-107
AP009152_2045(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 390 e-107
CP000117_2093(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 390 e-107
CP000769_4399(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 389 e-106
DQ491003_155(DQ491003|pid:none) Paramecium bursaria Chlorella vi... 387 e-106
DQ491002_163(DQ491002|pid:none) Paramecium bursaria Chlorella vi... 387 e-106
AB476645_1(AB476645|pid:none) Nicotiana benthamiana GMD mRNA for... 386 e-106
BX294137_127(BX294137|pid:none) Rhodopirellula baltica SH 1 comp... 386 e-105
EF146646_1(EF146646|pid:none) Populus trichocarpa clone WS01211_... 384 e-105
CP001032_3927(CP001032|pid:none) Opitutus terrae PB90-1, complet... 383 e-105
AY225120_1(AY225120|pid:none) Paramecium bursaria Chlorella viru... 380 e-104
CP000481_447(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 379 e-104
CP000474_3947(CP000474|pid:none) Arthrobacter aurescens TC1, com... 379 e-103
EU961896_1(EU961896|pid:none) Zea mays clone 238929 GDP-mannose ... 379 e-103
AX172655_1(AX172655|pid:none) Sequence 145 from Patent WO0144476. 376 e-103
AE000657_749(AE000657|pid:none) Aquifex aeolicus VF5, complete g... 375 e-102
CP001338_2031(CP001338|pid:none) Candidatus Methanosphaerula pal... 375 e-102
AM849034_1566(AM849034|pid:none) Clavibacter michiganensis subsp... 374 e-102
AL844507_129(AL844507|pid:none) Plasmodium falciparum 3D7 chromo... 374 e-102
AK061097_1(AK061097|pid:none) Oryza sativa Japonica Group cDNA c... 374 e-102
AM711867_1619(AM711867|pid:none) Clavibacter michiganensis subsp... 373 e-102
CP000780_1754(CP000780|pid:none) Candidatus Methanoregula boonei... 373 e-102
CP000656_4726(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 373 e-102
BA000045_763(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 372 e-101
AP008957_1324(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 370 e-101
CP000254_2058(CP000254|pid:none) Methanospirillum hungatei JF-1,... 370 e-101
CP000075_915(CP000075|pid:none) Pseudomonas syringae pv. syringa... 368 e-100
CP000743_390(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 367 e-100
AE016853_980(AE016853|pid:none) Pseudomonas syringae pv. tomato ... 367 e-100
AD2409(AD2409) GDP-D-mannose dehydratase [imported] - Nostoc sp.... 366 e-100
CP000058_912(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 365 2e-99
AP009493_1542(AP009493|pid:none) Streptomyces griseus subsp. gri... 365 2e-99
CP000431_5388(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 365 2e-99
AP009179_342(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic D... 365 2e-99
CP000708_480(CP000708|pid:none) Brucella ovis ATCC 25840 chromos... 364 3e-99
CP000750_1821(CP000750|pid:none) Kineococcus radiotolerans SRS30... 363 5e-99
AP007255_1077(AP007255|pid:none) Magnetospirillum magneticum AMB... 362 2e-98
CP000384_938(CP000384|pid:none) Mycobacterium sp. MCS, complete ... 361 3e-98
AB046360_8(AB046360|pid:none) Actinobacillus actinomycetemcomita... 361 3e-98
AP009178_1386(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 359 1e-97
AF134575_1(AF134575|pid:none) Zea mays root cap-specific protein... 359 1e-97
AF125999_13(AF125999|pid:none) Mycobacterium avium glycopeptidol... 359 1e-97
CP001392_552(CP001392|pid:none) Diaphorobacter sp. TPSY, complet... 358 2e-97
CP001635_747(CP001635|pid:none) Variovorax paradoxus S110 chromo... 358 2e-97
A63788_1(A63788|pid:none) Sequence 9 from Patent WO9723624. 358 2e-97
AJ223832_3(AJ223832|pid:none) Mycobacterium avium silvaticum gs[... 358 2e-97
CP000909_1091(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 358 2e-97
AJ223833_1(AJ223833|pid:none) Mycobacterium avium paratuberculos... 358 3e-97
AE000516_1609(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 358 3e-97
A63790_1(A63790|pid:none) Sequence 11 from Patent WO9723624. 358 3e-97
AE015451_1784(AE015451|pid:none) Pseudomonas putida KT2440 compl... 357 5e-97
CP001337_2019(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 354 4e-96
CP000440_755(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 353 5e-96
CP000609_1287(CP000609|pid:none) Methanococcus maripaludis C5, c... 353 5e-96
CP000109_1679(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 353 5e-96
CP000875_4546(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 353 7e-96
AM260479_2824(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 353 7e-96
CP001654_3220(CP001654|pid:none) Dickeya dadantii Ech703, comple... 352 1e-95
AM039952_3718(AM039952|pid:none) Xanthomonas campestris pv. vesi... 352 2e-95
CP001025_763(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 352 2e-95
CP000804_3132(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 350 6e-95
DQ314862_5(DQ314862|pid:none) Streptomyces hygroscopicus strain ... 349 1e-94
AL954681_2(AL954681|pid:none) Zebrafish DNA sequence from clone ... 348 2e-94
CP000379_1398(CP000379|pid:none) Burkholderia cenocepacia AU 105... 348 3e-94
AY442352_3(AY442352|pid:none) Aneurinibacillus thermoaerophilus ... 348 3e-94
CP000152_2109(CP000152|pid:none) Burkholderia sp. 383 chromosome... 347 6e-94
AE009442_1479(AE009442|pid:none) Xylella fastidiosa Temecula1, c... 347 6e-94
AP009386_703(AP009386|pid:none) Burkholderia multivorans ATCC 17... 346 1e-93
AE003849_606(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 345 2e-93
AM398681_1588(AM398681|pid:none) Flavobacterium psychrophilum JI... 345 2e-93
CP000086_1318(CP000086|pid:none) Burkholderia thailandensis E264... 344 4e-93
CP000050_3574(CP000050|pid:none) Xanthomonas campestris pv. camp... 341 3e-92
CP000265_67(CP000265|pid:none) Jannaschia sp. CCS1 plasmid1, com... 341 4e-92
CP001132_2524(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 339 1e-91
CP001132_2812(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 339 1e-91
AP008212_210(AP008212|pid:none) Oryza sativa (japonica cultivar-... 338 2e-91
AF204145_19(AF204145|pid:none) Xanthomonas campestris pv. campes... 338 2e-91
BX571966_1718(BX571966|pid:none) Burkholderia pseudomallei strai... 337 4e-91
CP000011_1635(CP000011|pid:none) Burkholderia mallei ATCC 23344 ... 337 5e-91
CP000509_4150(CP000509|pid:none) Nocardioides sp. JS614, complet... 335 1e-90
CP000113_5191(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 333 1e-89
CP001052_1920(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 331 3e-89
CP000319_2655(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 328 2e-88
EU304328_9(EU304328|pid:none) Ostreococcus virus OsV5, complete ... 327 7e-88
CP001096_4405(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 322 2e-86
BX572605_243(BX572605|pid:none) Rhodopseudomonas palustris CGA00... 322 2e-86
CP000283_1644(CP000283|pid:none) Rhodopseudomonas palustris BisB... 322 2e-86
CP000820_5384(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 320 5e-86
CP000774_1916(CP000774|pid:none) Parvibaculum lavamentivorans DS... 320 8e-86
AE005673_1006(AE005673|pid:none) Caulobacter crescentus CB15, co... 319 1e-85
CT573213_1722(CT573213|pid:none) Frankia alni str. ACN14A chromo... 319 1e-85
CT573213_1994(CT573213|pid:none) Frankia alni str. ACN14A chromo... 319 1e-85
AP008955_1758(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 318 2e-85
CP001001_172(CP001001|pid:none) Methylobacterium radiotolerans J... 318 3e-85
AP009384_54(AP009384|pid:none) Azorhizobium caulinodans ORS 571 ... 317 4e-85
CP000249_1040(CP000249|pid:none) Frankia sp. CcI3, complete geno... 316 1e-84
CP000249_1289(CP000249|pid:none) Frankia sp. CcI3, complete geno... 316 1e-84
CP000463_4225(CP000463|pid:none) Rhodopseudomonas palustris BisA... 315 3e-84
(Q51366) RecName: Full=GDP-mannose 4,6-dehydratase; EC=... 315 3e-84
CP000094_5676(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 313 6e-84
CP001399_562(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 305 2e-81
CP000943_3794(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 305 2e-81
AE000666_330(AE000666|pid:none) Methanothermobacter thermautotro... 303 6e-81
BX294137_121(BX294137|pid:none) Rhodopirellula baltica SH 1 comp... 301 4e-80
BT056139_1(BT056139|pid:none) Zea mays full-length cDNA clone ZM... 300 5e-80
CP000231_47(CP000231|pid:none) Rhodospirillum rubrum ATCC 11170 ... 299 1e-79
CP000009_1554(CP000009|pid:none) Gluconobacter oxydans 621H, com... 296 1e-78
AF357202_3(AF357202|pid:none) Streptomyces nodosus amphotericin ... 293 6e-78
AX195960_1(AX195960|pid:none) Sequence 32 from Patent WO0151639. 288 3e-76
X84374_9(X84374|pid:none) Saccharothrix mutabilis subsp. capreol... 283 9e-75
AF263912_4(AF263912|pid:none) Streptomyces noursei ATCC 11455 ny... 283 1e-74
AF049343_1(AF049343|pid:none) Escherichia coli GDP-mannose dehyd... 277 5e-73
AY310323_21(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 275 3e-72
AP009552_316(AP009552|pid:none) Microcystis aeruginosa NIES-843 ... 260 6e-68
CP001037_295(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 260 8e-68
CP000393_2579(CP000393|pid:none) Trichodesmium erythraeum IMS101... 260 8e-68
CP000698_3734(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 259 1e-67
CP000806_3331(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 257 7e-67
CP000117_3425(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 255 3e-66
CP001291_3177(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 251 4e-65
AY523973_7(AY523973|pid:none) Azospirillum brasilense plasmid 90... 248 4e-64
CP001032_3923(CP001032|pid:none) Opitutus terrae PB90-1, complet... 246 9e-64
CP000552_1299(CP000552|pid:none) Prochlorococcus marinus str. MI... 243 1e-62
CP000471_2406(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 238 4e-61
CP000859_1962(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 228 3e-58
CP000668_2677(CP000668|pid:none) Yersinia pestis Pestoides F, co... 222 2e-56
CP000910_1317(CP000910|pid:none) Renibacterium salmoninarum ATCC... 218 3e-55
AY811672_1(AY811672|pid:none) Schistosoma japonicum SJCHGC02170 ... 213 1e-53
FJ183325_1(FJ183325|pid:none) Capsella rubella isolate Cumbredor... 211 3e-53
FJ183347_1(FJ183347|pid:none) Capsella grandiflora isolate Metso... 209 2e-52
CP000509_4129(CP000509|pid:none) Nocardioides sp. JS614, complet... 207 6e-52
AY297861_1(AY297861|pid:none) Vibrio cholerae strain NLC64 catal... 196 1e-48
BA000012_4608(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 182 2e-44
AY297857_1(AY297857|pid:none) Vibrio cholerae strain SG20 GDP-D-... 180 8e-44
AY297859_1(AY297859|pid:none) Vibrio cholerae strain AS239 GDP-D... 179 2e-43
AY297866_1(AY297866|pid:none) Vibrio cholerae strain CO0481 GDP-... 163 1e-38
AY297860_1(AY297860|pid:none) Vibrio cholerae strain AS238 GDP-D... 159 1e-37
CP000095_2058(CP000095|pid:none) Prochlorococcus marinus str. NA... 158 3e-37
CP000553_2099(CP000553|pid:none) Prochlorococcus marinus str. NA... 155 3e-36
AY297863_1(AY297863|pid:none) Vibrio cholerae strain CO0529 GDP-... 153 1e-35
CP001656_3464(CP001656|pid:none) Paenibacillus sp. JDR-2, comple... 150 7e-35
AY297867_1(AY297867|pid:none) Vibrio cholerae strain PG266 GDP-D... 149 3e-34
AL033517_2(AL033517|pid:none) Human DNA sequence from clone RP1-... 138 5e-31
CP000804_893(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 137 1e-30
CP000875_3726(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 136 1e-30
CP000254_2769(CP000254|pid:none) Methanospirillum hungatei JF-1,... 134 7e-30
CP000686_3567(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 132 2e-29
CP000102_958(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 131 4e-29
CP001337_1977(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 131 6e-29
AY332625_13(AY332625|pid:none) Campylobacter jejuni serotype HS:... 127 1e-27
AF228583_16(AF228583|pid:none) Burkholderia pseudomallei capsula... 126 1e-27
BX545857_12(BX545857|pid:none) Campylobacter jejuni. 126 2e-27
AY332624_13(AY332624|pid:none) Campylobacter jejuni serotype HS:... 126 2e-27
CP000570_3200(CP000570|pid:none) Burkholderia pseudomallei 668 c... 123 1e-26
AY927785_8(AY927785|pid:none) Campylobacter jejuni subsp. jejuni... 123 2e-26
AY596297_889(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 121 6e-26
CP000477_1044(CP000477|pid:none) Methanosaeta thermophila PT, co... 120 1e-25
EU686620_13(EU686620|pid:none) Uncultured marine crenarchaeote A... 120 1e-25
AY596297_1404(AY596297|pid:none) Haloarcula marismortui ATCC 430... 119 2e-25
CP000450_151(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 118 5e-25
AY442352_4(AY442352|pid:none) Aneurinibacillus thermoaerophilus ... 111 6e-23
AF461768_13(AF461768|pid:none) Yersinia pseudotuberculosis serog... 108 3e-22
U75690_3(U75690|pid:none) Nostoc sp. PCC 7120 first mannosyl tra... 105 3e-21
CP000113_5192(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 105 4e-21
CP000780_1748(CP000780|pid:none) Candidatus Methanoregula boonei... 104 6e-21
CP000909_2633(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 102 4e-20
AY528413_10(AY528413|pid:none) Escherichia coli O52 O-antigen ge... 101 6e-20
CT573071_969(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 99 2e-19
CP000686_3979(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 96 3e-18
AL111168_1252(AL111168|pid:none) Campylobacter jejuni subsp. jej... 96 3e-18
CP000025_1469(CP000025|pid:none) Campylobacter jejuni RM1221, co... 95 4e-18
CP000598_61(CP000598|pid:none) Ostreococcus lucimarinus CCE9901 ... 94 7e-18
CP000576_1412(CP000576|pid:none) Prochlorococcus marinus str. MI... 94 1e-17
A84167(A84167) UDP-glucose 4-epimerase [imported] - Halobacteriu... 93 2e-17
CP001132_2811(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 90 1e-16
CP001230_1598(CP001230|pid:none) Persephonella marina EX-H1, com... 90 1e-16
CP000728_2629(CP000728|pid:none) Clostridium botulinum F str. La... 89 2e-16
CU458896_499(CU458896|pid:none) Mycobacterium abscessus chromoso... 88 5e-16
AX887450_1(AX887450|pid:none) Sequence 3313 from Patent EP1033401. 88 5e-16
CP000817_1124(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 88 7e-16
DQ780122_1(DQ780122|pid:none) Endoriftia persephone 'Hot96_1+Hot... 88 7e-16
CU466930_623(CU466930|pid:none) Candidatus Cloacamonas acidamino... 87 9e-16
AL954681_3(AL954681|pid:none) Zebrafish DNA sequence from clone ... 87 1e-15
CP000232_729(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 87 2e-15
AX065159_1(AX065159|pid:none) Sequence 285 from Patent WO0100844... 86 2e-15
BA000035_333(BA000035|pid:none) Corynebacterium efficiens YS-314... 86 2e-15
AE016853_982(AE016853|pid:none) Pseudomonas syringae pv. tomato ... 86 3e-15
AY596297_2556(AY596297|pid:none) Haloarcula marismortui ATCC 430... 86 3e-15
CP000962_2694(CP000962|pid:none) Clostridium botulinum A3 str. L... 86 3e-15
CP000386_561(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 86 3e-15
CP000542_4756(CP000542|pid:none) Verminephrobacter eiseniae EF01... 86 3e-15
AJ300303_2(AJ300303|pid:none) Streptomyces griseus partial canPF... 85 5e-15
BC055239_1(BC055239|pid:none) Danio rerio GDP-mannose 4,6-dehydr... 85 5e-15
CP000686_1799(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 85 6e-15
AL935258_44(AL935258|pid:none) Lactobacillus plantarum strain WC... 85 6e-15
CP000348_2592(CP000348|pid:none) Leptospira borgpetersenii serov... 85 6e-15
CP000879_913(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 84 8e-15
BA000030_1016(BA000030|pid:none) Streptomyces avermitilis MA-468... 84 1e-14
AP009049_2188(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 84 1e-14
CP000554_112(CP000554|pid:none) Prochlorococcus marinus str. MIT... 84 1e-14
BX842651_50(BX842651|pid:none) Bdellovibrio bacteriovorus comple... 83 2e-14
CP000628_3659(CP000628|pid:none) Agrobacterium radiobacter K84 c... 82 3e-14
CP000804_3193(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 82 4e-14
AM114193_1512(AM114193|pid:none) Uncultured methanogenic archaeo... 82 4e-14
AE000516_3876(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 82 5e-14
AM408590_3697(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 82 5e-14
AM238664_600(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 81 7e-14
CP000878_1241(CP000878|pid:none) Prochlorococcus marinus str. MI... 81 7e-14
AE010300_1579(AE010300|pid:none) Leptospira interrogans serovar ... 80 1e-13
AP008230_4440(AP008230|pid:none) Desulfitobacterium hafniense Y5... 80 1e-13
CP000854_5066(CP000854|pid:none) Mycobacterium marinum M, comple... 80 1e-13
CP000325_3464(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 80 1e-13
AJ544861_9(AJ544861|pid:none) Thermotoga sp strain RQ2 rhamnose ... 80 2e-13
BX640411_109(BX640411|pid:none) Bordetella pertussis strain Toha... 80 2e-13
CP000780_1742(CP000780|pid:none) Candidatus Methanoregula boonei... 79 3e-13
AF498403_5(AF498403|pid:none) Pseudomonas aeruginosa serotype 01... 79 3e-13
AX172523_1(AX172523|pid:none) Sequence 13 from Patent WO0144476. 79 3e-13
CP000777_3070(CP000777|pid:none) Leptospira biflexa serovar Pato... 79 4e-13
CP000885_3636(CP000885|pid:none) Clostridium phytofermentans ISD... 78 7e-13
AF328862_11(AF328862|pid:none) Geobacillus stearothermophilus st... 78 7e-13
CP001360_26(CP001360|pid:none) Brachyspira hyodysenteriae WA1 pl... 77 9e-13
CP000891_3097(CP000891|pid:none) Shewanella baltica OS195, compl... 77 9e-13
CP000678_1309(CP000678|pid:none) Methanobrevibacter smithii ATCC... 77 9e-13
AY883421_18(AY883421|pid:none) Geobacillus tepidamans strain GS5... 77 9e-13
AP006840_1370(AP006840|pid:none) Symbiobacterium thermophilum IA... 77 1e-12
CP000716_497(CP000716|pid:none) Thermosipho melanesiensis BI429,... 77 2e-12
CP000698_2263(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 77 2e-12
CP000448_672(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 77 2e-12
CP000231_50(CP000231|pid:none) Rhodospirillum rubrum ATCC 11170 ... 77 2e-12
CP001110_489(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 77 2e-12
CP000753_2931(CP000753|pid:none) Shewanella baltica OS185, compl... 77 2e-12
AE010300_1605(AE010300|pid:none) Leptospira interrogans serovar ... 77 2e-12
AE017221_222(AE017221|pid:none) Thermus thermophilus HB27, compl... 77 2e-12
CP000916_33(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 77 2e-12
AE000666_1746(AE000666|pid:none) Methanothermobacter thermautotr... 76 2e-12
CP000903_1104(CP000903|pid:none) Bacillus weihenstephanensis KBA... 76 2e-12
AP008226_591(AP008226|pid:none) Thermus thermophilus HB8 genomic... 76 2e-12
CP001393_52(CP001393|pid:none) Anaerocellum thermophilum DSM 672... 76 2e-12
AM398681_1589(AM398681|pid:none) Flavobacterium psychrophilum JI... 76 2e-12
DQ176871_9(DQ176871|pid:none) Streptomyces aureofaciens strain T... 76 3e-12
AM114193_2497(AM114193|pid:none) Uncultured methanogenic archaeo... 76 3e-12
CP001146_147(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 76 3e-12
CP000141_954(CP000141|pid:none) Carboxydothermus hydrogenoforman... 76 3e-12
BA000030_358(BA000030|pid:none) Streptomyces avermitilis MA-4680... 76 3e-12
CP000721_4671(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 75 4e-12
EF583996_4(EF583996|pid:none) Uncultured haloarchaeon clone fosm... 75 4e-12
CP001071_206(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 75 4e-12
AE010299_1152(AE010299|pid:none) Methanosarcina acetivorans str.... 75 4e-12
DQ491003_156(DQ491003|pid:none) Paramecium bursaria Chlorella vi... 75 4e-12
AL023093_27(AL023093|pid:none) Mycobacterium leprae cosmid B2548... 75 4e-12
AE000782_318(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 75 4e-12
AF078135_6(AF078135|pid:none) Leptospira borgpetersenii lipopoly... 75 4e-12
AY422724_8(AY422724|pid:none) Thermoanaerobacterium thermosaccha... 75 4e-12
CP001186_1112(CP001186|pid:none) Bacillus cereus G9842, complete... 75 5e-12
CP000855_1850(CP000855|pid:none) Thermococcus onnurineus NA1, co... 75 5e-12
CP000804_2999(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 75 5e-12
AF144879_7(AF144879|pid:none) Leptospira interrogans rfb locus, ... 75 5e-12
CP000099_19(CP000099|pid:none) Methanosarcina barkeri str. Fusar... 75 6e-12
CP000924_1597(CP000924|pid:none) Thermoanaerobacter pseudethanol... 75 6e-12
CP001037_207(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 75 6e-12
CP000821_107(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 75 6e-12
AP006627_3679(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 74 8e-12
CP000155_4612(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 74 8e-12
AY956411_5(AY956411|pid:none) Stenotrophomonas maltophilia phosp... 74 8e-12
CP000562_203(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 74 8e-12
CP000465_19(CP000465|pid:none) Roseobacter denitrificans OCh 114... 74 1e-11
AE014184_30(AE014184|pid:none) Tropheryma whipplei str. Twist, c... 74 1e-11
CP000075_925(CP000075|pid:none) Pseudomonas syringae pv. syringa... 74 1e-11
CP000575_289(CP000575|pid:none) Staphylothermus marinus F1, comp... 74 1e-11
CP001078_2915(CP001078|pid:none) Clostridium botulinum E3 str. A... 74 1e-11
CP000076_299(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 74 1e-11
CP000939_2691(CP000939|pid:none) Clostridium botulinum B1 str. O... 74 1e-11
AP009389_1095(AP009389|pid:none) Pelotomaculum thermopropionicum... 74 1e-11
AP007255_77(AP007255|pid:none) Magnetospirillum magneticum AMB-1... 73 2e-11
AP009256_1507(AP009256|pid:none) Bifidobacterium adolescentis AT... 73 2e-11
CP000472_1530(CP000472|pid:none) Shewanella piezotolerans WP3, c... 73 2e-11
CP001581_2909(CP001581|pid:none) Clostridium botulinum A2 str. K... 73 2e-11
CP001074_817(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 73 2e-11
CP001176_1147(CP001176|pid:none) Bacillus cereus B4264, complete... 73 2e-11
BA000012_5319(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 73 2e-11
AE001437_2301(AE001437|pid:none) Clostridium acetobutylicum ATCC... 73 2e-11
EF138834_24(EF138834|pid:none) Lactobacillus johnsonii strain AT... 73 2e-11
AE017198_890(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 72 3e-11
CP000820_950(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 72 3e-11
CP001111_503(CP001111|pid:none) Stenotrophomonas maltophilia R55... 72 3e-11
AE017194_1330(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 72 4e-11
CP000828_3510(CP000828|pid:none) Acaryochloris marina MBIC11017,... 72 4e-11
DQ149987_14(DQ149987|pid:none) Streptomyces neyagawaensis concan... 72 4e-11
BX294137_116(BX294137|pid:none) Rhodopirellula baltica SH 1 comp... 72 4e-11
CP000825_1448(CP000825|pid:none) Prochlorococcus marinus str. MI... 72 4e-11
AE015451_1771(AE015451|pid:none) Pseudomonas putida KT2440 compl... 72 5e-11
AE017355_1094(AE017355|pid:none) Bacillus thuringiensis serovar ... 72 5e-11
CP000227_1183(CP000227|pid:none) Bacillus cereus Q1, complete ge... 72 5e-11
AP009484_656(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 72 5e-11
CP001080_157(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 71 7e-11
AE016879_1130(AE016879|pid:none) Bacillus anthracis str. Ames, c... 71 7e-11
CP001101_1843(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 71 7e-11
BA000016_619(BA000016|pid:none) Clostridium perfringens str. 13 ... 71 7e-11
AE008923_3536(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 71 7e-11
CP000112_2178(CP000112|pid:none) Desulfovibrio desulfuricans G20... 71 7e-11
CP000246_462(CP000246|pid:none) Clostridium perfringens ATCC 131... 71 7e-11
AP009384_53(AP009384|pid:none) Azorhizobium caulinodans ORS 571 ... 71 7e-11
DQ280500_13(DQ280500|pid:none) Streptomyces olindensis DAUFPE 56... 71 9e-11
AE014295_883(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 71 9e-11
CP000099_1118(CP000099|pid:none) Methanosarcina barkeri str. Fus... 71 9e-11
CP000708_948(CP000708|pid:none) Brucella ovis ATCC 25840 chromos... 71 9e-11
(P0C7J0) RecName: Full=dTDP-glucose 4,6-dehydratase; EC... 71 9e-11
(O06485) RecName: Full=Putative sugar dehydratase/epimerase yfnG; 71 9e-11
CP000478_2242(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 71 9e-11
CP000680_4261(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 71 9e-11
CP001283_1210(CP001283|pid:none) Bacillus cereus AH820, complete... 71 9e-11
AF078135_26(AF078135|pid:none) Leptospira borgpetersenii lipopol... 70 1e-10
CP000058_144(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 70 1e-10
CP000050_3561(CP000050|pid:none) Xanthomonas campestris pv. camp... 70 1e-10
CP000109_1461(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 70 1e-10
CP001068_1135(CP001068|pid:none) Ralstonia pickettii 12J chromos... 70 1e-10
BA000011_922(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 70 1e-10
AB030032_6(AB030032|pid:none) Actinobacillus actinomycetemcomita... 70 1e-10
AM039952_3709(AM039952|pid:none) Xanthomonas campestris pv. vesi... 70 1e-10
CR936257_2319(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 70 1e-10
AE015451_1785(AE015451|pid:none) Pseudomonas putida KT2440 compl... 70 2e-10
AP008229_720(AP008229|pid:none) Xanthomonas oryzae pv. oryzae MA... 70 2e-10
CP001147_1232(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 70 2e-10
DQ680826_1(DQ680826|pid:none) Thermus aquaticus isolate NTU103 U... 70 2e-10
DQ680825_1(DQ680825|pid:none) Thermus aquaticus isolate YT1 UDP-... 70 2e-10
CP000110_1993(CP000110|pid:none) Synechococcus sp. CC9605, compl... 70 2e-10
AP007255_61(AP007255|pid:none) Magnetospirillum magneticum AMB-1... 70 2e-10
CP000254_2061(CP000254|pid:none) Methanospirillum hungatei JF-1,... 70 2e-10
AP009049_1837(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 70 2e-10
CP000813_3179(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 70 2e-10
CU466930_657(CU466930|pid:none) Candidatus Cloacamonas acidamino... 70 2e-10
DQ232586_8(DQ232586|pid:none) Rhodobacter sphaeroides 2.4.1 plas... 70 2e-10
CP000961_1667(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 70 2e-10
(B0RVL0) RecName: Full=dTDP-glucose 4,6-dehydratase; EC... 70 2e-10

>CR761176_1(CR761176|pid:none) Xenopus tropicalis finished cDNA, clone
TEgg127l23.
Length = 369

Score = 497 bits (1279), Expect = e-139
Identities = 240/347 (69%), Positives = 284/347 (81%)
Frame = +3

Query: 81 EERKVALITGITGQDGSYLTEFLISKGYYVHGIIRRSSSFNTSRIEHLYQDQHVEGKKSL 260
+ RKVALITGITGQDGSYL EFL+ KGY VHGI+RRSSSFNT RIEHLY++ H + ++
Sbjct: 18 KSRKVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPHAHIEGNM 77

Query: 261 TLHYGDLTDASNLHSIVSKVNPTEIYNLGAQSHVKVSFDMSEYTGDVDGLGCLRLLDAIR 440
LHYGDLTD++ L I+++V PTEIYNLGAQSHVK+SFD++EYT DVDGLG LRLLDA +
Sbjct: 78 KLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGLGTLRLLDATK 137

Query: 441 SCGMEKKVKYYQASTSELYGKVQEIPQSETTPFYPRSPYAVAKQYAYWIVVNYREAYDMY 620
+CG+ VK+YQASTSELYGKVQEIPQ ETTPFYPRSPY AK YAYWIVVN+REAY+++
Sbjct: 138 TCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLF 197

Query: 621 ACNGILFNHESPRRGPTFVTRKITRFVAGIACGRDEILYLGNINAKRDWGHARDYVEAMW 800
A NGILFN+ESPRRG FVTRKI+R VA I G+ E + LGN++AKRDWGHA+DYVEAMW
Sbjct: 198 AVNGILFNYESPRRGANFVTRKISRSVAKIHLGQMEFVSLGNLDAKRDWGHAKDYVEAMW 257

Query: 801 LMLQQEKPEDFVIATGETHSVREFVEKSFKEIDIIIKWRGEAEKEEGYCEKTGKVYVKID 980
LMLQ ++PEDFVI+TGE HSVREFVEK+F I I W G+ E E G C +TGK++VK+D
Sbjct: 258 LMLQTDEPEDFVISTGEVHSVREFVEKAFMHIGKTIVWEGKNENEVGRCSETGKIHVKVD 317

Query: 981 EKYYRPTEVDLLLGNPNKAKKLLQWQIKTSFGELVKEMVAKDIEYIK 1121
KYYRPTEV+ L G+ +KAK L W K SF ELVKEMV DIE +K
Sbjct: 318 HKYYRPTEVEFLQGDCSKAKNKLGWIPKVSFNELVKEMVEADIELMK 364

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,702,418,493
Number of extensions: 32889063
Number of successful extensions: 108277
Number of sequences better than 10.0: 2308
Number of HSP's gapped: 106434
Number of HSP's successfully gapped: 2329
Length of query: 403
Length of database: 1,061,185,681
Length adjustment: 131
Effective length of query: 272
Effective length of database: 633,018,993
Effective search space: 172181166096
Effective search space used: 172181166096
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.93 gvh: 0.34 alm: 0.47 top: 0.60 tms: 0.00 mit: 0.22 mip: 0.00
nuc: 0.04 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

44.0 %: nuclear
28.0 %: cytoplasmic
20.0 %: cytoskeletal
4.0 %: mitochondrial
4.0 %: peroxisomal

>> prediction for Contig-U16369-1 is nuc

VS (DIR, S) 2
VH (FL, L) 0
VF (FL, S) 1
AH (FL, L) 0
AF (FL, S) 2
SL (DIR, L) 0
SS (DIR, S) 3
SH (FL, L) 0
SF (FL, S) 4
CH (FL, L) 0
CF (FL, S) 2
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0