| Contig-U16299-1 |
| Contig ID |
Contig-U16299-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
2007 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
5352474 |
| End point |
5350484 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
73 |
| Number of EST |
109 |
| Link to clone list |
U16299 |
| List of clone(s) |
est1=VFL661F,1,271
est2=VFK160F,8,521
est3=VFH674F,13,128
est4=VFI274F,17,541
est5=VFC742F,18,633
est6=VFD302F,18,562
est7=VHC664F,18,557
est8=VHJ289F,18,564
est9=VHJ423F,18,611
est10=VHK790F,18,632
est11=VHN173F,18,536
est12=VHP385F,18,547
est13=VFH681F,22,550
est14=VFK876F,22,632
est15=VFC543F,24,614
est16=VFD476F,24,541
est17=VFK158F,24,549
est18=VHL626F,24,673
est19=VHN460F,24,653
est20=VHP748F,24,565
est21=VHP774F,24,555
est22=VHG208F,26,673
est23=VFC688F,27,660
est24=VFF319F,27,633
est25=VHE538F,37,633
est26=VHM377F,37,553
est27=VHM153F,39,565
est28=VHD171F,42,632
est29=VFM694F,45,638
est30=VFL209F,241,825
est31=VHH265F,339,880
est32=VFI209F,449,1069
est33=VFN853F,637,843
est34=VSK271F,665,1179
est35=CFJ278F,787,1322
est36=SLD657F,903,1146
est37=SFD543Z,1014,1753
est38=VFD476Z,1068,1752
est39=VFF319Z,1131,1752
est40=VHN460Z,1211,1923
est41=VHB101Z,1212,1915
est42=VHN664Z,1213,1955
est43=VHP385Z,1214,1977
est44=VHB447Z,1215,1883
est45=VHL626Z,1215,1919
est46=VHE538Z,1216,1974
est47=VHM817Z,1216,1919
est48=VHP748Z,1216,1955
est49=SLE162F,1219,1910
est50=VHD171Z,1225,1975
est51=VHH516Z,1225,1917
est52=VHI865Z,1226,1934
est53=VFI209Z,1227,1979
est54=VFC688Z,1228,1980
est55=VFK876Z,1228,1920
est56=VFL661Z,1228,1953
est57=VFC742Z,1229,1980
est58=VHL630Z,1229,1921
est59=VHM213Z,1229,1921
est60=VHJ289Z,1230,1952
est61=VHJ423Z,1230,1938
est62=VHK790Z,1230,1956
est63=VFC543Z,1232,1980
est64=VFM694Z,1232,1956
est65=VFK160Z,1233,1942
est66=CHN209Z,1237,1990
est67=VHO390Z,1259,1947
est68=VHC664Z,1264,1988
est69=VHI454Z,1289,1933
est70=AHI136Z,1291,1900
est71=VHF344Z,1297,1690
est72=CHM582Z,1301,1874
est73=VHP774Z,1303,1958
est74=VFL209Z,1304,1980
est75=VHM153Z,1304,1945
est76=VFD302Z,1305,1949
est77=CHG386Z,1309,1892
est78=SSG880Z,1309,1991
est79=VFI274Z,1312,1956
est80=VFK158Z,1313,1980
est81=VHN173Z,1319,1990
est82=VFJ251Z,1326,1948
est83=CFI802Z,1328,1846
est84=CFJ278Z,1329,1971
est85=VFB859Z,1360,1962
est86=VHM377Z,1360,1978
est87=VHH265Z,1362,1952
est88=VHG208Z,1374,1991
est89=SLD555F,1380,1654
est90=AHA746Z,1386,1729
est91=VHL215Z,1392,1913
est92=VFA549Z,1401,1794
est93=VFH681Z,1402,1939
est94=VHF743Z,1417,1874
est95=VSC466Z,1431,1995
est96=SLI173Z,1470,2007
est97=VFO449Z,1473,1914
est98=VSK271Z,1530,1971
est99=VFH674Z,1547,1916
est100=SLA317Z,1592,1997
est101=VHG767Z,1640,1795
est102=VFC378Z,1648,1922
est103=SLJ155Z,1663,1993
est104=VHD761Z,1703,1845
est105=VHG495Z,1705,1846
est106=VSG168F,1739,1982
est107=VSG168Z,1739,1971
est108=VFE767Z,1760,1936
est109=SLD555Z,1800,1996
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.25 |
| Homology vs DNA |
Query= Contig-U16299-1 (Contig-U16299-1Q) /CSM_Contig/Contig-U16299-1Q.Seq.d
(2007 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(U49169) Dictyostelium discoideum V-ATPase A subunit (vatA) ... 2282 0.0 2
(BJ399985) Dictyostelium discoideum cDNA clone:dds8e11, 3' e... 1407 0.0 2
(BJ446168) Dictyostelium discoideum cDNA clone:ddv61j21, 3' ... 1376 0.0 1
(BJ437029) Dictyostelium discoideum cDNA clone:ddv33a01, 3' ... 1374 0.0 1
(AU061417) Dictyostelium discoideum slug cDNA, clone SLE162. 1372 0.0 1
(BJ444835) Dictyostelium discoideum cDNA clone:ddv57h16, 3' ... 1368 0.0 1
(BJ430349) Dictyostelium discoideum cDNA clone:ddv6o22, 3' e... 1358 0.0 1
(BJ430159) Dictyostelium discoideum cDNA clone:ddv6d11, 3' e... 1356 0.0 1
(BJ441267) Dictyostelium discoideum cDNA clone:ddv46o03, 3' ... 1354 0.0 1
(BJ438355) Dictyostelium discoideum cDNA clone:ddv37m17, 3' ... 1354 0.0 1
(BJ443864) Dictyostelium discoideum cDNA clone:ddv54k08, 3' ... 1352 0.0 1
(BJ446361) Dictyostelium discoideum cDNA clone:ddv62p11, 3' ... 1350 0.0 1
(BJ445182) Dictyostelium discoideum cDNA clone:ddv58o16, 3' ... 1350 0.0 1
(BJ430165) Dictyostelium discoideum cDNA clone:ddv6e11, 3' e... 1350 0.0 1
(BJ431903) Dictyostelium discoideum cDNA clone:ddv17a04, 3' ... 1344 0.0 1
(BJ442393) Dictyostelium discoideum cDNA clone:ddv49a24, 3' ... 1338 0.0 1
(BJ434667) Dictyostelium discoideum cDNA clone:ddv24i16, 3' ... 1338 0.0 1
(BJ433753) Dictyostelium discoideum cDNA clone:ddv22h20, 3' ... 1338 0.0 1
(BJ442219) Dictyostelium discoideum cDNA clone:ddv49n06, 3' ... 1336 0.0 1
(BJ441995) Dictyostelium discoideum cDNA clone:ddv48b18, 3' ... 1330 0.0 1
(BJ435361) Dictyostelium discoideum cDNA clone:ddv26k24, 3' ... 1330 0.0 1
(BJ439417) Dictyostelium discoideum cDNA clone:ddv40k09, 3' ... 1326 0.0 1
(BJ443392) Dictyostelium discoideum cDNA clone:ddv52d23, 3' ... 1324 0.0 1
(BJ443829) Dictyostelium discoideum cDNA clone:ddv54c08, 3' ... 1318 0.0 2
(BJ433358) Dictyostelium discoideum cDNA clone:ddv21g15, 3' ... 1312 0.0 1
(BJ437177) Dictyostelium discoideum cDNA clone:ddv33n12, 3' ... 1308 0.0 1
(BJ430587) Dictyostelium discoideum cDNA clone:ddv7h20, 3' e... 1304 0.0 1
(BJ384025) Dictyostelium discoideum cDNA clone:ddc48a04, 3' ... 1302 0.0 1
(BJ424991) Dictyostelium discoideum cDNA clone:ddv54c08, 5' ... 1289 0.0 1
(BJ421593) Dictyostelium discoideum cDNA clone:ddv43o02, 5' ... 1283 0.0 1
(BJ438209) Dictyostelium discoideum cDNA clone:ddv36o16, 3' ... 1277 0.0 1
(BJ425941) Dictyostelium discoideum cDNA clone:ddv57h16, 5' ... 1249 0.0 1
(BJ445540) Dictyostelium discoideum cDNA clone:ddv59d23, 3' ... 1241 0.0 2
(BJ444065) Dictyostelium discoideum cDNA clone:ddv55i04, 3' ... 1225 0.0 3
(BJ411909) Dictyostelium discoideum cDNA clone:ddv6d11, 5' e... 1215 0.0 1
(BJ441727) Dictyostelium discoideum cDNA clone:ddv47l14, 3' ... 1213 0.0 1
(BJ424538) Dictyostelium discoideum cDNA clone:ddv52d23, 5' ... 1213 0.0 1
(BJ433803) Dictyostelium discoideum cDNA clone:ddv23a04, 3' ... 1207 0.0 1
(BJ446452) Dictyostelium discoideum cDNA clone:ddv62d19, 3' ... 1205 0.0 1
(C90005) Dictyostelium discoideum slug cDNA, clone SSG880. 1193 0.0 1
(BJ444204) Dictyostelium discoideum cDNA clone:ddv55i13, 3' ... 1189 0.0 1
(BJ410060) Dictyostelium discoideum cDNA clone:ddv11f05, 5' ... 1189 0.0 1
(BJ420770) Dictyostelium discoideum cDNA clone:ddv40k09, 5' ... 1183 0.0 1
(BJ444879) Dictyostelium discoideum cDNA clone:ddv57a19, 3' ... 1181 0.0 1
(BJ433344) Dictyostelium discoideum cDNA clone:ddv21c15, 3' ... 1181 0.0 1
(BJ428194) Dictyostelium discoideum cDNA clone:ddv11f05, 3' ... 1179 0.0 2
(BJ430371) Dictyostelium discoideum cDNA clone:ddv7d01, 3' e... 1178 0.0 1
(BJ432135) Dictyostelium discoideum cDNA clone:ddv17c20, 3' ... 1172 0.0 1
(BJ419930) Dictyostelium discoideum cDNA clone:ddv37m17, 5' ... 1172 0.0 1
(BJ352617) Dictyostelium discoideum cDNA clone:dda47g09, 3' ... 1172 0.0 1
(BJ444323) Dictyostelium discoideum cDNA clone:ddv56b06, 3' ... 1170 0.0 2
(BJ411915) Dictyostelium discoideum cDNA clone:ddv6e11, 5' e... 1168 0.0 1
(BJ432720) Dictyostelium discoideum cDNA clone:ddv19e14, 3' ... 1164 0.0 1
(BJ423436) Dictyostelium discoideum cDNA clone:ddv49n06, 5' ... 1164 0.0 1
(BJ416587) Dictyostelium discoideum cDNA clone:ddv26k24, 5' ... 1164 0.0 1
(BJ375763) Dictyostelium discoideum cDNA clone:ddc19k20, 3' ... 1136 0.0 1
(BJ415518) Dictyostelium discoideum cDNA clone:ddv22h20, 5' ... 1132 0.0 3
(BJ379451) Dictyostelium discoideum cDNA clone:ddc34l21, 3' ... 1130 0.0 1
(BJ383951) Dictyostelium discoideum cDNA clone:ddc47c21, 3' ... 1120 0.0 1
(BJ444283) Dictyostelium discoideum cDNA clone:ddv55j19, 3' ... 1094 0.0 1
(BJ423590) Dictyostelium discoideum cDNA clone:ddv49a24, 5' ... 1084 0.0 1
(BJ412118) Dictyostelium discoideum cDNA clone:ddv7d01, 5' e... 1076 0.0 1
(BJ415566) Dictyostelium discoideum cDNA clone:ddv23a04, 5' ... 1035 0.0 2
(BJ412095) Dictyostelium discoideum cDNA clone:ddv6o22, 5' e... 944 0.0 2
(BJ413793) Dictyostelium discoideum cDNA clone:ddv17a04, 5' ... 622 0.0 2
(BJ427452) Dictyostelium discoideum cDNA clone:ddv62p11, 5' ... 1074 0.0 1
(BJ440278) Dictyostelium discoideum cDNA clone:ddv43o02, 3' ... 1065 0.0 1
(BJ441038) Dictyostelium discoideum cDNA clone:ddv45a18, 3' ... 1061 0.0 1
(BJ427548) Dictyostelium discoideum cDNA clone:ddv62d19, 5' ... 1055 0.0 1
(BJ429692) Dictyostelium discoideum cDNA clone:ddv4f16, 3' e... 1037 0.0 2
(BJ427271) Dictyostelium discoideum cDNA clone:ddv61j21, 5' ... 1051 0.0 1
(BJ362044) Dictyostelium discoideum cDNA clone:ddc19k20, 5' ... 1051 0.0 1
(BJ419632) Dictyostelium discoideum cDNA clone:ddv36o16, 5' ... 975 0.0 2
(BJ425401) Dictyostelium discoideum cDNA clone:ddv55i13, 5' ... 1045 0.0 1
(BJ415128) Dictyostelium discoideum cDNA clone:ddv21c15, 5' ... 1039 0.0 1
(BJ425982) Dictyostelium discoideum cDNA clone:ddv57a19, 5' ... 1029 0.0 1
(BJ414016) Dictyostelium discoideum cDNA clone:ddv17c20, 5' ... 1029 0.0 1
(BJ425483) Dictyostelium discoideum cDNA clone:ddv55j19, 5' ... 1025 0.0 1
(BJ412311) Dictyostelium discoideum cDNA clone:ddv7h20, 5' e... 1023 0.0 1
(BJ422298) Dictyostelium discoideum cDNA clone:ddv45a18, 5' ... 1007 0.0 1
(BJ413718) Dictyostelium discoideum cDNA clone:ddv16a22, 5' ... 981 0.0 3
(AU270916) Dictyostelium discoideum vegetative cDNA clone:VS... 829 0.0 2
(BJ434392) Dictyostelium discoideum cDNA clone:ddv16a22, 3' ... 999 0.0 1
(BJ375250) Dictyostelium discoideum cDNA clone:ddc18d02, 3' ... 997 0.0 1
(BJ415144) Dictyostelium discoideum cDNA clone:ddv21g15, 5' ... 957 0.0 2
(AU262585) Dictyostelium discoideum vegetative cDNA clone:VS... 955 0.0 1
(BJ443516) Dictyostelium discoideum cDNA clone:ddv53m04, 3' ... 630 0.0 2
(BJ439997) Dictyostelium discoideum cDNA clone:ddv42f11, 3' ... 860 0.0 1
(AU053223) Dictyostelium discoideum slug cDNA, clone SLI173. 507 0.0 2
(BJ436021) Dictyostelium discoideum cDNA clone:ddv29b14, 3' ... 662 0.0 2
(BJ429138) Dictyostelium discoideum cDNA clone:ddv2a13, 3' e... 773 0.0 1
(L43963) Dictyostelium discoideum vacuolar proton transporti... 488 0.0 2
(BJ434402) Dictyostelium discoideum cDNA clone:ddv16c20, 3' ... 726 0.0 1
(BJ439710) Dictyostelium discoideum cDNA clone:ddv41h11, 3' ... 670 0.0 2
(AU270917) Dictyostelium discoideum vegetative cDNA clone:VS... 682 0.0 1
(BJ348173) Dictyostelium discoideum cDNA clone:dda32l11, 3' ... 648 0.0 1
(AU040048) Dictyostelium discoideum slug cDNA, clone SLA317. 632 e-176 1
(AU061218) Dictyostelium discoideum slug cDNA, clone SLD555. 545 e-150 1
(BJ416023) Dictyostelium discoideum cDNA clone:ddv24i16, 5' ... 527 e-145 1
(AU053581) Dictyostelium discoideum slug cDNA, clone SLJ155. 492 e-134 1
(BJ430051) Dictyostelium discoideum cDNA clone:ddv5l19, 3' e... 460 e-130 2
(AU061274) Dictyostelium discoideum slug cDNA, clone SLD657. 470 e-127 1
(DY886672) CeleSEQ2416 Cunninghamella elegans pBluescript (E... 149 e-113 6
(FD455284) EGGB059TR Haematobia irritans eggs Haematobia irr... 246 4e-95 5
(BJ417738) Dictyostelium discoideum cDNA clone:ddv28j14, 5' ... 234 5e-94 2
(AB093511) Saccharomyces unisporus VMA1 gene for vacuolar me... 86 6e-92 9
(AX109951) Sequence 684 from Patent WO0123604. 101 1e-91 10
(FD464152) LARW394TR Haematobia irritans 1st Instar Larvae H... 254 1e-91 2
(FC815372) Sr_pAMT7_02n15_T7 S. ratti mixed stage pAMP Stron... 228 5e-91 4
(M64984) Candida tropicalis open reading frame DNA sequence. 101 5e-90 10
(AB093510) Saccharomyces exiguus VMA1-2 gene for vacuolar me... 80 2e-89 12
(AU266074) Dictyostelium discoideum vegetative cDNA clone:VS... 339 2e-88 1
(AU266075) Dictyostelium discoideum vegetative cDNA clone:VS... 333 2e-86 1
(AB093509) Saccharomyces exiguus VMA1-1 gene for vacuolar me... 74 9e-85 13
(CZ531869) SRAA-aac75d01.g1 Strongyloides ratti whole genome... 212 3e-83 3
(AB093506) Kluyveromyces lactis VMA1 gene for vacuolar membr... 109 3e-81 14
(DI129475) Target gene of anti-cancer drugs and screening ki... 135 5e-81 8
(AX109958) Sequence 691 from Patent WO0123604. 135 5e-81 8
(EA377027) Sequence 25850 from patent US 7314974. 135 5e-81 8
(AR548187) Sequence 3318 from patent US 6747137. 117 1e-80 9
(X68580) S.pombe gene for vacuolar H+-ATPase, subunit A. 135 1e-79 8
(AY813539) Schistosoma japonicum SJCHGC09310 protein mRNA, c... 167 2e-78 8
(BI772916) kq01g06.y1 TBN95TM-SSR Strongyloides stercoralis ... 228 1e-76 2
(CS592097) Sequence 817 from Patent WO2007035650. 100 3e-76 8
(CS591403) Sequence 123 from Patent WO2007035650. 100 4e-76 8
(BI703941) kt23d10.y3 Strongyloides ratti L1 pAMP1 v3 Chiape... 212 1e-75 2
(BI773046) kq31d05.y1 TBN95TM-SSR Strongyloides stercoralis ... 222 7e-75 2
(BI772943) kq08f06.y1 TBN95TM-SSR Strongyloides stercoralis ... 151 2e-71 4
(EH073929) PMDA373TR Perkinsus marinus small insert cDNA lib... 149 2e-69 4
(EH086000) PMEB505TR Perkinsus marinus large insert cDNA lib... 149 2e-69 4
(DV619009) EST1222005 Glossina morsitans morsitans Fat body ... 153 3e-66 5
(AL033512) Caenorhabditis elegans YAC Y49A3A. 161 1e-65 6
(EB457573) 1099341444294 12-DrosW-std-1P6Kb Drosophila willi... 194 2e-65 4
(ES411553) HTAB-aaa37c08.b2 Heterorhabditis_bacteriophora_HT... 127 9e-65 5
(BI773050) kq33c01.y1 TBN95TM-SSR Strongyloides stercoralis ... 159 2e-64 2
(EB455943) 1099341379449 12-DrosW-std-1P6Kb Drosophila willi... 194 9e-64 4
(BI772898) kp97e10.y1 TBN95TM-SSR Strongyloides stercoralis ... 178 2e-63 4
(EE008772) ROE00004849 Rhizopus oryzae Company Rhizopus oryz... 180 3e-63 3
(DV618809) EST1221805 Glossina morsitans morsitans Fat body ... 153 3e-63 6
(FD458501) LARV346TR Haematobia irritans 1st Instar Larvae H... 137 5e-63 4
(BJ756004) Caenorhabditis elegans cDNA clone:yk1420h08 : 5' ... 159 1e-61 3
(EC585283) SpEST-C247 Spironucleus Uni-Zap XR EST Library Sp... 127 6e-61 8
(EH084856) PMEAX68TR Perkinsus marinus large insert cDNA lib... 101 6e-61 6
(BU799911) SJF2CKH07 SJF Schistosoma japonicum cDNA similar ... 174 1e-59 5
(FC774344) CBBN8283.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 135 2e-59 4
(FE231522) CAPG1264.fwd CAPG Naegleria gruberi amoeba stage ... 147 4e-59 5
(AB093508) Saccharomyces dairenensis VMA1 gene for vacuolar ... 64 3e-58 14
(FD397694) 1106514238987 Cryptosporidium muris (strain RN66)... 147 4e-58 5
(FC728517) CBBG4817.fwd CBBG Lottia gigantea 12,15,18h embry... 135 6e-57 5
(BU720283) SJM2AQB07 SJM Schistosoma japonicum cDNA similar ... 167 3e-56 3
(BJ125714) Caenorhabditis elegans cDNA clone:yk1326f03 : 5' ... 165 7e-56 3
(AB093512) Saccharomyces pastorianus VMA1 gene for vacuolar ... 72 9e-56 11
(AB093514) Saccharomyces pastorianus VMA1 gene for vacuolar ... 72 1e-55 11
(DJ133009) Method for identification of useful proteins deri... 72 1e-55 11
(BJ440518) Dictyostelium discoideum cDNA clone:ddv43n24, 3' ... 230 2e-55 1
(FC727245) CBBG4049.fwd CBBG Lottia gigantea 12,15,18h embry... 135 2e-55 4
(BJ762145) Caenorhabditis elegans cDNA clone:yk1584b12 : 5' ... 165 3e-55 2
(BJ113910) Caenorhabditis elegans cDNA clone:yk1173f04 : 5' ... 165 3e-55 2
(BJ127666) Caenorhabditis elegans cDNA clone:yk1349d06 : 5' ... 165 3e-55 2
(BJ119111) Caenorhabditis elegans cDNA clone:yk1239d07 : 5' ... 165 3e-55 2
(BJ114186) Caenorhabditis elegans cDNA clone:yk1176h02 : 5' ... 165 4e-55 2
(BJ113109) Caenorhabditis elegans cDNA clone:yk1164b08 : 5' ... 165 4e-55 2
(BJ111916) Caenorhabditis elegans cDNA clone:yk1148h01 : 5' ... 165 4e-55 2
(BJ808586) Caenorhabditis elegans cDNA clone:yk1687d01 : 5' ... 165 4e-55 2
(BJ108904) Caenorhabditis elegans cDNA clone:yk1113c05 : 5' ... 165 4e-55 2
(DT777441) 125661399 TH1 Tribolium castaneum cDNA clone 16I2... 86 1e-54 6
(AX109956) Sequence 689 from Patent WO0123604. 70 2e-54 9
(CU351101) Aphanomyces euteiches cDNA. 129 5e-54 4
(L08200) Plasmodium falciparum vacuolar proton adenosine tri... 70 1e-53 9
(BJ801436) Caenorhabditis elegans cDNA clone:yk1449d04 : 5' ... 159 2e-53 2
(BJ757769) Caenorhabditis elegans cDNA clone:yk1506c05 : 5' ... 159 2e-53 2
(DW013266) w2k13_M13F Myzus persicae, tobacco lineage, whole... 119 5e-53 4
(AU199560) Caenorhabditis elegans cDNA clone:yk766e09 : 5' e... 157 7e-53 2
(CU361892) Aphanomyces euteiches cDNA. 125 8e-53 4
(FE236176) CAPG3754.rev CAPG Naegleria gruberi amoeba stage ... 137 8e-53 4
(AU052587) Dictyostelium discoideum slug cDNA, clone SLD555. 220 2e-52 1
(FE238496) CAPG4886.fwd CAPG Naegleria gruberi amoeba stage ... 123 3e-52 5
(AF389404) Saccharomyces sp. DH1-1A VMA1 (VMA1) gene, comple... 68 3e-52 11
(AY864912) Aedes albopictus V-ATPase subunit A mRNA, complet... 180 5e-52 6
(BJ438834) Dictyostelium discoideum cDNA clone:ddv38j15, 3' ... 208 7e-52 2
(FE247080) CAPG9763.rev CAPG Naegleria gruberi amoeba stage ... 98 1e-51 5
(AB093504) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 2e-51 12
(BJ440732) Dictyostelium discoideum cDNA clone:ddv44f17, 3' ... 214 1e-50 1
(C62741) Caenorhabditis elegans cDNA clone yk294g6 : 5' end,... 159 4e-50 2
(FK911659) EST_lsal_evj_960514 lsalevj mixed_tissue_mixed_st... 180 9e-50 4
(FE241076) CAPG631.fwd CAPG Naegleria gruberi amoeba stage N... 159 1e-49 4
(FC551037) AIAI-aad86a05.b1 Anclostoma_caninum_EST_L3_Activa... 135 2e-49 4
(FC547983) AIAI-aad26f12.g1 Anclostoma_caninum_EST_L3_Activa... 135 2e-49 4
(AM678098) Entamoeba terrapinae GSS, clone terra161a05.q1k. 113 3e-49 5
(CU329670) Schizosaccharomyces pombe chromosome I. 135 3e-49 22
(U04849) Entamoeba histolytica HM-1-IMSS putative vacuolar p... 86 4e-49 10
(AB093502) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093501) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093500) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093499) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093498) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093497) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093496) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 5e-49 12
(AB093513) Saccharomyces pastorianus VMA1 gene for vacuolar ... 68 7e-49 12
(EC011191) 2977155 KZ41 Caenorhabditis elegans cDNA clone 14... 153 7e-49 2
(FE232736) CAPG1909.fwd CAPG Naegleria gruberi amoeba stage ... 111 1e-48 5
(AB093507) Saccharomyces castellii VMA1 gene for vacuolar me... 78 2e-48 9
(BJ771010) Caenorhabditis elegans cDNA clone:yk1713a11 : 5' ... 165 2e-48 4
(FF295339) 279307368 Pea aphid whole body normalized full le... 149 2e-48 2
(CB403150) OSTR002F10_1 AD-wrmcDNA Caenorhabditis elegans cD... 139 2e-47 2
(AX110102) Sequence 835 from Patent WO0123604. 113 4e-47 3
(EX821151) CBNA7430.fwd CBNA Phycomyces blakesleeanus NRRL15... 96 4e-47 4
(EX820821) CBNA7267.fwd CBNA Phycomyces blakesleeanus NRRL15... 96 4e-47 4
(AF367445) Prunus persica clone AtpvA1 V-ATPase catalytic su... 60 7e-47 7
(AB093503) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 8e-47 12
(AB093495) Saccharomyces cerevisiae VMA1 gene for vacuolar m... 68 8e-47 12
(DQ333092) Synthetic construct Saccharomyces cerevisiae clon... 68 1e-46 12
(EA376416) Sequence 25239 from patent US 7314974. 68 1e-46 12
(AX109957) Sequence 690 from Patent WO0123604. 68 1e-46 12
(FC850423) CBHN6308.fwd CBHN Metridium senile tentacle Metri... 170 1e-46 2
(CD160608) ML1-0066P-A180-C03-U.B ML1-0066 Schistosoma manso... 159 3e-46 4
(EB485373) 1099288469412 12-DrosW-norm-1P5Kb Drosophila will... 135 5e-46 3
(AV189504) Caenorhabditis elegans cDNA clone:yk537a10 : 5' e... 159 6e-46 2
(EH082280) PMEAG96TR Perkinsus marinus large insert cDNA lib... 76 7e-46 5
(FE238377) CAPG4827.rev CAPG Naegleria gruberi amoeba stage ... 98 8e-46 5
(EH086456) PMEB792TR Perkinsus marinus large insert cDNA lib... 76 1e-45 5
(EL737363) Osmo01498 F. cylindrus osmotic stress library Fra... 96 1e-45 4
(DR027002) Osmo01072 F. cylindrus osmotic stress library Fra... 96 1e-45 4
(Z74233) S.cerevisiae chromosome IV reading frame ORF YDL185w. 68 1e-45 12
(J05409) S.cerevisiae vacuolar membrane H+-ATPase subunit a ... 68 2e-45 12
(CV683014) SJS01_C09_SJS01C09-T3 SJS Schistosoma japonicum c... 159 3e-45 3
(CR764097) Paramecium tetraurelia, complete gene. 143 4e-45 5
(M21609) Saccharomyces cerevisiae transmembrane ATPase-like ... 68 4e-45 12
(AF008922) Aedes aegypti V-ATPase A-subunit mRNA, complete cds. 96 4e-45 6
(EX483537) EST_lsal_evj_793936 lsalevj mixed_tissue_mixed_st... 178 8e-45 3
(BJ428044) Dictyostelium discoideum cDNA clone:ddv10f17, 3' ... 194 9e-45 1
(CD664407) TVEST019.E07 Tv30236_PT cDNA Library Trichomonas ... 107 1e-44 7
(FE240789) CAPG6021.rev CAPG Naegleria gruberi amoeba stage ... 109 1e-44 4
(AU202879) Caenorhabditis elegans cDNA clone:yk813g02 : 5' e... 165 2e-44 4
(BJ803437) Caenorhabditis elegans cDNA clone:yk1473c06 : 5' ... 165 2e-44 4
(BJ803537) Caenorhabditis elegans cDNA clone:yk1474e04 : 5' ... 165 2e-44 4
(BJ752441) Caenorhabditis elegans cDNA clone:yk1377g05 : 5' ... 165 2e-44 4
(EL621963) 23-17 Chaetoceros neogracile EST Library Chaetoce... 103 3e-44 4
(BJ116636) Caenorhabditis elegans cDNA clone:yk1205f03 : 5' ... 165 5e-44 3
(AR548185) Sequence 3316 from patent US 6747137. 117 1e-43 2
(BJ112553) Caenorhabditis elegans cDNA clone:yk1157a07 : 5' ... 165 2e-43 3
(BJ803519) Caenorhabditis elegans cDNA clone:yk1474c09 : 5' ... 165 2e-43 3
(BJ118065) Caenorhabditis elegans cDNA clone:yk1222h11 : 5' ... 165 2e-43 3
(BJ110331) Caenorhabditis elegans cDNA clone:yk1129f11 : 5' ... 165 2e-43 3
(BJ763258) Caenorhabditis elegans cDNA clone:yk1597f07 : 5' ... 165 2e-43 3
(BJ120456) Caenorhabditis elegans cDNA clone:yk1256d08 : 5' ... 165 2e-43 3
(BJ757340) Caenorhabditis elegans cDNA clone:yk1500g12 : 5' ... 165 2e-43 3
(BJ806988) Caenorhabditis elegans cDNA clone:yk1624g09 : 5' ... 125 3e-43 2
(CD066979) MA1-0049T-R070-B12-U.B MA1-0049 Schistosoma manso... 167 3e-43 3
(FE243623) CAPG7744.fwd CAPG Naegleria gruberi amoeba stage ... 98 5e-43 5
(CN585442) USDA-FP_128513 Acyrthosiphon pisum, Pea Aphid Acy... 109 8e-43 5
(FE233098) CAPG2101.fwd CAPG Naegleria gruberi amoeba stage ... 98 2e-42 5
(FC679978) CAXX13874.fwd CAXX Lottia gigantea from male gona... 135 3e-42 2
(AI650064) AEMTAK47 Aedes aegypti MT pSPORT Library Aedes ae... 96 5e-42 4
(CR382126) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 109 5e-42 25
(FE233748) CAPG2449.fwd CAPG Naegleria gruberi amoeba stage ... 98 7e-42 5
(FE242229) CAPG7068.fwd CAPG Naegleria gruberi amoeba stage ... 98 7e-42 5
(EY473328) AIAG-aaa63b05.g1 Anclostoma_caninum_EST_L3_Normal... 151 7e-42 4
(BJ123628) Caenorhabditis elegans cDNA clone:yk1302c01 : 5' ... 159 1e-41 3
(EH086220) PMEB639TR Perkinsus marinus large insert cDNA lib... 74 1e-41 5
(BJ127402) Caenorhabditis elegans cDNA clone:yk1346b02 : 5' ... 165 1e-41 3
(DV617445) EST1220441 Glossina morsitans morsitans Fat body ... 111 1e-41 5
(ES599706) BPE00000576 Buddenbrockia plumatellae SMART cDNA ... 74 3e-41 6
(ES599766) BPE00000551 Buddenbrockia plumatellae SMART cDNA ... 74 3e-41 6
(AB093505) Candida glabrata VMA1 gene for vacuolar membrane ... 70 4e-41 7
(AB189964) Pyrus communis PcVHA-A2 mRNA for vacuolar H+-ATPa... 68 4e-41 6
(DW211248) EST27512 Larval Stage 1 Aedes aegypti cDNA clone ... 96 5e-41 4
(CT764200) Paramecium tetraurelia 5-PRIME EST from clone LK0... 135 7e-41 6
(DT777800) 125592002 TH1 Tribolium castaneum cDNA clone 24M1... 123 9e-41 2
(FE242522) CAPG7206.fwd CAPG Naegleria gruberi amoeba stage ... 98 9e-41 5
(BQ087455) Cri_10_J19_SP6 Ceratopteris Spore Library Ceratop... 141 2e-40 3
(EH083810) PMEAR16TR Perkinsus marinus large insert cDNA lib... 74 2e-40 5
(BX552725) Glossina morsitans morsitans (Tseatse fly) EST fr... 153 2e-40 2
(CR764095) Paramecium tetraurelia, complete gene. 105 2e-40 6
(EB587258) AGENCOURT_51403459 D. ananassae EST Drosophila an... 157 4e-40 3
(EL916023) INIT2_98_D07.g1_A006 G5 trophont cDNA (INIT2) Ich... 117 4e-40 4
(EE995270) EST67749 Larval Stage 1 Aedes aegypti cDNA clone ... 96 5e-40 3
(CT797538) Paramecium tetraurelia 5-PRIME EST from clone LK0... 105 1e-39 6
(DR409364) mhn39a07.b1 C.remanei EST SB146 Caenorhabditis re... 149 1e-39 2
(EH066894) PMDCE18TR Perkinsus marinus small insert cDNA lib... 131 2e-39 3
(DQ440543) Ostertagia ostertagi ATPase beta-subunit mRNA, pa... 170 2e-39 2
(AM050349) Trichostrongylus vitrinus partial ORF for putativ... 167 2e-39 2
(EC759010) PPE00006031 Agencourt Biosciences Agen-0020 Non-n... 119 5e-39 4
(BJ101504) Caenorhabditis elegans cDNA clone:yk1027c04 : 5' ... 165 1e-38 2
(BJ115969) Caenorhabditis elegans cDNA clone:yk1197f06 : 5' ... 165 1e-38 2
(AU201158) Caenorhabditis elegans cDNA clone:yk789a11 : 5' e... 165 1e-38 2
(AU208059) Caenorhabditis elegans cDNA clone:yk889f08 : 5' e... 165 1e-38 2
(FE236177) CAPG3754.fwd CAPG Naegleria gruberi amoeba stage ... 98 2e-38 5
(CT905386) Phaeodactylum tricornutum 5-PRIME EST from clone ... 103 2e-38 2
(EH082325) PMEAH29TR Perkinsus marinus large insert cDNA lib... 74 3e-38 5
(AL049181) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 70 6e-38 11
(FD391105) 1106162215777 Cryptosporidium muris (strain RN66)... 137 6e-38 4
(CT945590) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 9e-38 3
(BJ413726) Dictyostelium discoideum cDNA clone:ddv16c20, 5' ... 113 1e-37 2
(CT869424) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 1e-37 3
(CT909516) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 1e-37 3
(CR764096) Paramecium tetraurelia, complete gene. 135 1e-37 6
(CR764094) Paramecium tetraurelia, complete gene. 98 1e-37 6
(DT793568) 126502143 TL1 Tribolium castaneum cDNA clone 20K1... 78 1e-37 5
(CT773087) Paramecium tetraurelia 5-PRIME EST from clone LK0... 135 1e-37 5
(CB277160) pk96e07.y1 Ancylostoma ceylanicum L3 Ancylostoma ... 131 2e-37 3
(BX552715) Glossina morsitans morsitans (Tseatse fly) EST fr... 137 3e-37 3
(EF128033) Malus x domestica vacuolar H+-ATPase mRNA, comple... 68 3e-37 6
(CX094239) EHAFW41TR E. histolytica Normalized cDNA library ... 86 5e-37 5
(FD390630) 1106162214625 Cryptosporidium muris (strain RN66)... 133 1e-36 4
(CU703192) Phaeodactylum tricornutum mRNA 5-prime sequence f... 105 1e-36 2
(CU722952) Phaeodactylum tricornutum mRNA 5-prime sequence f... 105 1e-36 2
(CT904172) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 1e-36 2
(DT338743) JBW089C03.b_027.abi Pineapple week 5-10 nematode-... 139 1e-36 4
(CT910186) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 1e-36 2
(AX110223) Sequence 956 from Patent WO0123604. 103 1e-36 3
(EH083632) PMEAP93TR Perkinsus marinus large insert cDNA lib... 74 2e-36 5
(CU359283) Aphanomyces euteiches cDNA. 121 2e-36 2
(CV172767) dba25d12.y1 Drosophila simulans testis pSport1 li... 115 2e-36 2
(CD067489) MA1-0049T-R078-C08-U.B MA1-0049 Schistosoma manso... 167 2e-36 1
(D27176) Caenorhabditis elegans cDNA clone yk4d5 : 5' end, s... 165 2e-36 2
(EH081983) PMEA012TR Perkinsus marinus large insert cDNA lib... 74 2e-36 5
(AZ539025) ENTED87TRB Entamoeba histolytica Sheared DNA Enta... 86 2e-36 5
(EL351016) CCEL7634.b1_D14.ab1 CCE(LMS) endive Cichorium end... 74 2e-36 6
(X83276) S.cerevisiae DNA for ORFs from chromosome IV. 68 4e-36 12
(FG082428) UI-FF-IH0-aba-b-18-0-UI.r1 Ceratitis capitata adu... 64 7e-36 6
(AU208513) Caenorhabditis elegans cDNA clone:yk895a11 : 5' e... 165 8e-36 1
(C41159) Caenorhabditis elegans cDNA clone yk245d1 : 5' end,... 165 8e-36 1
(BJ104540) Caenorhabditis elegans cDNA clone:yk1062h03 : 5' ... 165 8e-36 1
(CT770072) Paramecium tetraurelia 5-PRIME EST from clone LK0... 98 1e-35 4
(CT938524) Phaeodactylum tricornutum 5-PRIME EST from clone ... 101 1e-35 2
(FE242228) CAPG7068.rev CAPG Naegleria gruberi amoeba stage ... 98 2e-35 4
(FE232735) CAPG1909.rev CAPG Naegleria gruberi amoeba stage ... 98 2e-35 4
(BJ864161) Marchantia polymorpha cDNA clone:lwb29j08, 5' end. 98 2e-35 4
(FE238495) CAPG4886.rev CAPG Naegleria gruberi amoeba stage ... 98 2e-35 4
(CN498337) F08_02558.AB1 Diabrotica virgifera virgifera midg... 100 2e-35 4
(FE242521) CAPG7206.rev CAPG Naegleria gruberi amoeba stage ... 98 2e-35 4
(X62338) S.scrofa mRNA for H+ ATPase. 76 5e-35 5
(CV836670) ID0ACC30DH07RM1 ID0ACC Acyrthosiphon pisum cDNA c... 113 7e-35 3
(AY104754) Zea mays PCO134411 mRNA sequence. 72 7e-35 6
(CN759450) ID0AAA25CD06RM1 ApMS Acyrthosiphon pisum cDNA clo... 103 1e-34 2
(DW217332) EST33590 Larval Stage 1 Aedes aegypti cDNA clone ... 96 1e-34 2
(DW994853) EST47234 Larval Stage 1 Aedes aegypti cDNA clone ... 96 1e-34 2
(CK570810) est_l_vannamei501 g6hCd95t Litopenaeus vannamei c... 131 1e-34 2
(AV187027) Caenorhabditis elegans cDNA clone:yk506h4 : 5' en... 151 1e-34 2
(EC758327) PPE00001508 Agencourt Biosciences Agen-0020 Non-n... 119 2e-34 3
(EC758916) PPE00006491 Agencourt Biosciences Agen-0020 Non-n... 119 2e-34 3
(AB189963) Pyrus communis PcVHA-A1 mRNA for vacuolar H+-ATPa... 70 2e-34 7
(BW303708) Ciona intestinalis cDNA, clone:cinc030h06, 5' end... 125 2e-34 2
(FF957124) CBWU84904.b1 Yutaka Satou unpublished cDNA librar... 125 2e-34 2
(AE014134) Drosophila melanogaster chromosome 2L, complete s... 115 3e-34 2
(AC009352) Drosophila melanogaster, chromosome 2L, region 34... 107 4e-34 2
(AC008332) Drosophila melanogaster, chromosome 2L, region 34... 115 4e-34 2
(AC014144) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 107 4e-34 2
(EA023723) Sequence 364 from patent US 7135558. 107 4e-34 2
(CQ579470) Sequence 7228 from Patent WO0171042. 107 4e-34 2
(EA024271) Sequence 1186 from patent US 7135558. 107 4e-34 2
(CQ597143) Sequence 24901 from Patent WO0171042. 107 4e-34 2
(EA024273) Sequence 1189 from patent US 7135558. 107 4e-34 2
(CQ597149) Sequence 24907 from Patent WO0171042. 107 4e-34 2
(AY084150) Drosophila melanogaster RE30552 full insert cDNA. 107 4e-34 2
(EA024274) Sequence 1190 from patent US 7135558. 107 4e-34 2
(CQ597150) Sequence 24908 from Patent WO0171042. 107 4e-34 2
(EA023724) Sequence 365 from patent US 7135558. 107 4e-34 2
(CQ579471) Sequence 7229 from Patent WO0171042. 107 4e-34 2
(EA024272) Sequence 1187 from patent US 7135558. 107 4e-34 2
(CQ597144) Sequence 24902 from Patent WO0171042. 107 4e-34 2
(FC589873) CAXP5725.fwd CAXP Lottia gigantea from head, foot... 105 4e-34 4
(AI114011) GH10636.5prime GH Drosophila melanogaster head pO... 107 4e-34 2
(C68553) Caenorhabditis elegans cDNA clone yk305d1 : 5' end,... 119 4e-34 2
(EL493770) B10_PFBAMHI-M-T7-PLATE20A.AB1 Blood stage Plasmod... 70 5e-34 5
(EL495197) E03_PFBAMHI-M-T3-PLATE33A.AB1 Blood stage Plasmod... 70 6e-34 5
(EL508491) F01_PF-SAU3A-T3-M-P39_D.AB1 Blood stage Plasmodiu... 70 7e-34 5
(EL508490) F01_PF-SAU3A-T3-M-P39.AB1 Blood stage Plasmodium ... 70 7e-34 5
(AK067063) Oryza sativa Japonica Group cDNA clone:J013089J10... 94 1e-33 6
(AX109955) Sequence 688 from Patent WO0123604. 101 1e-33 6
(L09234) Human vacuolar ATPase (isoform HO68) mRNA, complete... 101 1e-33 6
(EB602378) AGENCOURT_54969905 D. mojavensis EST Drosophila m... 96 1e-33 3
(FC644130) CAXU6982.fwd CAXU Lottia gigantea from female gon... 105 1e-33 4
(EL494728) D06_PFBAMHI-L-T3-PLATE8A.AB1 Blood stage Plasmodi... 70 2e-33 5
(BM285272) kh96g03.y1 Ascaris suum L4 pSPORT1 Zarlenga v1 As... 111 2e-33 2
(EL496718) G11_PFBAMHI-M-T7-PLATE23A.AB1 Blood stage Plasmod... 70 2e-33 5
(EC755852) PPE00007014 Agencourt Biosciences Agen-0020 Non-n... 119 2e-33 3
(U36436) Zea mays vacuolar ATPase 69 kDa subunit mRNA, parti... 78 2e-33 6
(EL496287) G02_PFBAMHI-L-T3-PLATE7A.AB1 Blood stage Plasmodi... 70 2e-33 5
(EL495111) E01_PFBAMHI-S-T7-PLATE1A.AB1 Blood stage Plasmodi... 70 2e-33 5
(EU975098) Zea mays clone 468795 unknown mRNA. 78 4e-33 6
(CT744478) Paramecium tetraurelia 5-PRIME EST from clone LK0... 98 4e-33 5
(CT804220) Paramecium tetraurelia 5-PRIME EST from clone LK0... 105 5e-33 3
(DU002838) 289714 Tomato MboI BAC Library Solanum lycopersic... 98 6e-33 2
(EL492746) A01_PFBAMHI-M-T3-PLATE3A.AB1 Blood stage Plasmodi... 70 6e-33 5
(EB619319) AGENCOURT_54728513 D. mojavensis EST Drosophila m... 96 8e-33 5
(X61612) B.taurus mRNA for vacuolar H+ATPase Mr 70000 subunit. 86 1e-32 5
(X58386) B.taurus mRNA for bovine vacuolar ATPase subunit A. 86 1e-32 5
(BW256104) Ciona intestinalis cDNA, clone:cign010b18, 5' end... 125 1e-32 2
(FF696330) XABT107099.fwd Gateway compatible cien cDNA libra... 125 1e-32 2
(FF876448) CBWU18521.b1 Yutaka Satou unpublished cDNA librar... 119 1e-32 2
(FF907215) CBWU38022.b1 Yutaka Satou unpublished cDNA librar... 125 1e-32 2
(AL669504) Ciona intestinalis; larval mRNA; EST 5PRIM end of... 119 1e-32 2
(EL507098) C05_PF-SAU3A-T3-M-P19_D.AB1 Blood stage Plasmodiu... 70 2e-32 5
(EL507097) C05_PF-SAU3A-T3-M-P19.AB1 Blood stage Plasmodium ... 70 2e-32 5
(CT898311) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 2e-32 3
(BF779872) 3243-29 hindgut and Malpighian tubule cDNA librar... 117 2e-32 3
(CN763182) ID0AAA6BD08RM1 ApMS Acyrthosiphon pisum cDNA clon... 96 2e-32 2
(CT751526) Paramecium tetraurelia 5-PRIME EST from clone LK0... 98 2e-32 4
(M80430) Bovine vacuolar H+-ATPase A subunit mRNA, complete ... 86 3e-32 5
(BC105145) Bos taurus ATPase, H+ transporting, lysosomal 70k... 86 3e-32 5
(CT811389) Paramecium tetraurelia 5-PRIME EST from clone LK0... 127 4e-32 4
(EL495117) E02_PFBAMHI-L-T3-PLATE14A.AB1 Blood stage Plasmod... 70 6e-32 5
(FE233097) CAPG2101.rev CAPG Naegleria gruberi amoeba stage ... 98 6e-32 4
(CP000885) Clostridium phytofermentans ISDg, complete genome. 76 6e-32 3
(EH080505) PMECK13TR Perkinsus marinus large insert cDNA lib... 74 6e-32 5
(EH078987) PMEC837TR Perkinsus marinus large insert cDNA lib... 74 6e-32 5
(FC816419) Sr_pAMT7_06b06_T7 S. ratti mixed stage pAMP Stron... 105 7e-32 4
(FD463160) LARVX61TR Haematobia irritans 1st Instar Larvae H... 117 8e-32 3
(ES550408) TH1021H10SP6 TH1 Tribolium castaneum cDNA, mRNA s... 86 3e-31 3
(DN559906) ME17-A04-T3-96-R1 E7PCR Zea mays cDNA clone E7PCR... 70 5e-31 5
(CT758157) Paramecium tetraurelia 5-PRIME EST from clone LK0... 141 5e-31 2
(D35256) Caenorhabditis elegans cDNA clone yk19a6 : 5' end, ... 92 5e-31 3
(DT338842) JBW090D11.b_089.abi Pineapple week 5-10 nematode-... 139 6e-31 3
(BT024092) Zea mays clone EL01N0551D01 mRNA sequence. 70 7e-31 6
(EU976570) Zea mays clone 983784 unknown mRNA. 70 8e-31 6
(DN676946) PP_YEa0019C05 Peach developing fruit mesocarp Sta... 60 1e-30 5
(CR382136) Debaryomyces hansenii strain CBS767 chromosome A ... 76 3e-30 7
(EH084579) PMEAV81TR Perkinsus marinus large insert cDNA lib... 74 4e-30 4
(FE247081) CAPG9763.fwd CAPG Naegleria gruberi amoeba stage ... 98 7e-30 5
(FF631468) G825P548RF7.T0 Acorn worm normalized gastrula pEx... 80 1e-29 5
(CO451033) MZCCL10159D11.g Maize Endosperm cDNA Library Zea ... 70 1e-29 5
(AM091193) Lutzomyia longipalpis EST clone NSFM-163d09, sequ... 107 2e-29 5
(AZ538891) ENTFM58TF Entamoeba histolytica Sheared DNA Entam... 86 2e-29 4
(FE238378) CAPG4827.fwd CAPG Naegleria gruberi amoeba stage ... 98 2e-29 5
(AF050673) Gossypium hirsutum vacuolar H+-ATPase catalytic s... 52 3e-29 7
(DR393301) USDA-FP_153233 Adult Alate Aphis gossypii (WHAGA)... 101 3e-29 2
(AY177247) Lycopersicon esculentum vacuolar H+-ATPase A1 sub... 68 4e-29 5
(BT014583) Lycopersicon esculentum clone 134040F, mRNA seque... 68 4e-29 5
(CT949377) Phaeodactylum tricornutum 5-PRIME EST from clone ... 105 6e-29 3
(FC540680) AIAI-aad61h10.b1 Anclostoma_caninum_EST_L3_Activa... 135 1e-28 2
(EH084510) PMEAV36TR Perkinsus marinus large insert cDNA lib... 76 1e-28 4
(DV896027) LB0279.CR_M05 GC_BGC-27 Bos taurus cDNA clone IMA... 86 2e-28 3
(EB802544) 3470_F14 Botrytis cinerea expressed sequence tags... 84 2e-28 4
(CU422690) Pleurobrachia pileus 5-PRIME EST from clone SQ0AA... 78 2e-28 6
(CT899717) Phaeodactylum tricornutum 5-PRIME EST from clone ... 90 2e-28 2
(CD444528) EL01N0441A02.b Endosperm_4 Zea mays cDNA, mRNA se... 72 3e-28 4
(CD444550) EL01N0441C02.b Endosperm_4 Zea mays cDNA, mRNA se... 72 3e-28 4
(AM730839) Cucumis melo subsp. melo EST, clone CI_45-D04-M13R. 66 4e-28 3
(EL494566) D02_PFBAMHI-M-T7-PLATE5A.AB1 Blood stage Plasmodi... 70 5e-28 4
(DV617217) EST1220213 Glossina morsitans morsitans Fat body ... 54 5e-28 6
(EY080439) CAZI14314.fwd CAZI Artemisia annua normalized lea... 78 5e-28 5
(DT697701) s13dFA46D09LF078_88115 Tall fescue, Festuca arund... 115 6e-28 2
(DT712135) s13dFA25F06SD059_502994 Tall fescue, Festuca arun... 115 6e-28 2
(FC810958) Sr_pASP6_06b06_SP6 S. ratti mixed stage pAMP Stro... 92 6e-28 4
(FC330388) CAYY12955.fwd CAYY Physcomitrella patens subsp. p... 119 8e-28 2
(EL509978) H10_PF-SAU3A-T3-M-P39_D.AB1 Blood stage Plasmodiu... 50 8e-28 5
(EL509977) H10_PF-SAU3A-T3-M-P39.AB1 Blood stage Plasmodium ... 50 8e-28 5
(DV614241) EST1217237 Glossina morsitans morsitans Fat body ... 90 8e-28 5
(U59147) Drosophila melanogaster Oregon R vacuolar ATPase su... 94 1e-27 2
(U59146) Drosophila melanogaster Canton S vacuolar ATPase su... 94 1e-27 2
(BM057297) 2164-72 hindgut and Malpighian tubule subtracted ... 123 1e-27 2
(EA486101) Sequence 548 from patent US 7348410. 123 1e-27 2
(CS431627) Sequence 548 from Patent EP1710252. 123 1e-27 2
(BD282098) Flea head, nerve cord, hindgut and malpighian tub... 123 1e-27 2
(BF731943) 3154-76 hindgut and Malpighian tubule subtracted ... 123 1e-27 2
(C62207) Caenorhabditis elegans cDNA clone yk271a7 : 5' end,... 92 1e-27 2
(FG972015) HTAO-aab06d04.b1 Heterorhabditis_bacteriophora_ES... 101 2e-27 2
(DB823932) Nilaparvata lugens mRNA, EST clone:NLAD3291, 5' e... 74 2e-27 3
(CX091906) EHAEZ28TR E. histolytica Normalized cDNA library ... 58 2e-27 5
(CJ972928) Physcomitrella patens subsp. patens cDNA clone:PP... 68 2e-27 6
(EY574797) CAWU13676.fwd CAWU Capitella sp. I ECS-2004 Prima... 68 2e-27 5
(CV206153) EST865863 non-normalized T1 cDNA library Trichomo... 74 3e-27 5
(CF026562) QCA9a01.yg QCA Zea mays cDNA clone QCA9a01, mRNA ... 78 3e-27 4
(CF026272) QCA5b12.yg QCA Zea mays cDNA clone QCA5b12, mRNA ... 78 3e-27 4
(CF025677) QCA1d07.yg QCA Zea mays cDNA clone QCA1d07, mRNA ... 78 3e-27 4
(CF026423) QCA7c01.yg QCA Zea mays cDNA clone QCA7c01, mRNA ... 78 3e-27 4
(DT585368) she01-29ms4-e09 She01 Saruma henryi cDNA clone sh... 113 3e-27 4
(CF026574) QCA9b06.yg QCA Zea mays cDNA clone QCA9b06, mRNA ... 78 3e-27 4
(CV206152) EST865862 non-normalized T1 cDNA library Trichomo... 74 4e-27 5
(EB545244) AGENCOURT_52977028 D. erecta EST Drosophila erect... 100 5e-27 2
(CF026166) QCA3h08.yg QCA Zea mays cDNA clone QCA3h08, mRNA ... 78 5e-27 5
(CA214968) SCSBAD1126E07.g AD1 Saccharum officinarum cDNA cl... 64 5e-27 4
(DT735719) EST1169569 Aquilegia cDNA library Aquilegia formo... 92 5e-27 4
(CA073776) SCEQAM1037H12.g AM1 Saccharum officinarum cDNA cl... 64 6e-27 4
(FC342212) CAYY21320.fwd CAYY Physcomitrella patens subsp. p... 68 8e-27 6
(FC326278) CAYY10267.fwd CAYY Physcomitrella patens subsp. p... 111 8e-27 3
(DY892011) CeleSEQ8899 Cunninghamella elegans pBluescript (E... 117 1e-26 4
(FG115238) PRAG-aac76h05.g1 Sand_fly_EST_Normalized Phleboto... 100 1e-26 3
(CT944569) Phaeodactylum tricornutum 5-PRIME EST from clone ... 90 1e-26 2
(BH157066) ENTRU18TF Entamoeba histolytica Sheared DNA Entam... 86 1e-26 6
(DR443907) AR1002F07 A. gomesiana hemocytes normalized libra... 88 2e-26 3
(CR380955) Candida glabrata strain CBS138 chromosome I compl... 70 2e-26 13
(EE354858) LB02950.CR_N10 GC_BGC-29 Bos taurus cDNA clone IM... 86 4e-26 3
(FC589505) CAXP5545.fwd CAXP Lottia gigantea from head, foot... 105 4e-26 4
(FD466900) molt531 Daphnia magna molting related cDNA librar... 86 4e-26 3
(BY990566) Physcomitrella patens subsp. patens cDNA clone: P... 113 5e-26 2
(BI504827) BB170002B20H03.5 Bee Brain Normalized/Subtracted ... 101 6e-26 3
(AB016483) Ascidia sydneiensis samea mRNA for vacuolar-type ... 54 7e-26 10
(D50528) Acetabularia acetabulum clone pVAL V type adenosine... 58 7e-26 6
(ES760815) ISBL_1_G01_E003.g1 USDA-Tifton Peanut Library ISB... 78 7e-26 3
(EL496514) G07_PFBAMHI-L-T7-PLATE14A.AB1 Blood stage Plasmod... 70 8e-26 4
(EC759355) PPE00005027 Agencourt Biosciences Agen-0020 Non-n... 119 1e-25 3
(EC820177) SME00002939 esmbsro2 Sawyeria marylandensis cDNA,... 80 1e-25 4
(CV072035) EST4196 Zea mays embryo sac cDNA library Zea mays... 70 1e-25 4
(CD038046) UTPPI001_G01 USDA-Tifton Peanut Immature Pod cDNA... 78 1e-25 3
(FC758275) CBBN10614.fwd CBBN Lottia gigantea 3,4,5,6.5d Lar... 105 1e-25 4
(AX110225) Sequence 958 from Patent WO0123604. 74 2e-25 3
(BT008383) Arabidopsis thaliana At1g78900 gene, complete cds. 54 2e-25 7
>(U49169) Dictyostelium discoideum V-ATPase A subunit (vatA) mRNA,
complete cds.
Length = 1967
Score = 2282 bits (1151), Expect(2) = 0.0
Identities = 1151/1151 (100%)
Strand = Plus / Plus
Query: 760 ttgattcacttttcccatgcgtacaaggtggtacatgtgctattccaggtgcttttggtt 819
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 713 ttgattcacttttcccatgcgtacaaggtggtacatgtgctattccaggtgcttttggtt 772
Query: 820 gtggtaagactgtaatttctcaatctctctctaaattctccaactctgatgcaattgttt 879
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 773 gtggtaagactgtaatttctcaatctctctctaaattctccaactctgatgcaattgttt 832
Query: 880 acgtaggttgtggtgaacgtggtaatgaaatggctgaagtacttatggaattcccagaac 939
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 833 acgtaggttgtggtgaacgtggtaatgaaatggctgaagtacttatggaattcccagaac 892
Query: 940 tccatactaaagtcggtgataaagaagaaccaattatgcaacgtacttgtttagttgcca 999
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 893 tccatactaaagtcggtgataaagaagaaccaattatgcaacgtacttgtttagttgcca 952
Query: 1000 acacttcaaatatgccagtagctgctcgtgaagcttctatctacactggtattacattgg 1059
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 953 acacttcaaatatgccagtagctgctcgtgaagcttctatctacactggtattacattgg 1012
Query: 1060 cagaatatttccgtgatatgggtttaaatgttgctatgatggctgattctacctctcgtt 1119
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1013 cagaatatttccgtgatatgggtttaaatgttgctatgatggctgattctacctctcgtt 1072
Query: 1120 gggctgaagctcttcgtgaaatttctggtcgtttagctgaaatgccagcagattctggtt 1179
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1073 gggctgaagctcttcgtgaaatttctggtcgtttagctgaaatgccagcagattctggtt 1132
Query: 1180 atccagcttacttgggtgctcgtcttgcatctttctatgaaagagctggtcgtgtatcat 1239
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1133 atccagcttacttgggtgctcgtcttgcatctttctatgaaagagctggtcgtgtatcat 1192
Query: 1240 gtattggtcatccaactcgtattggttcagttacaattgtcggtgcagtctctcccccag 1299
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1193 gtattggtcatccaactcgtattggttcagttacaattgtcggtgcagtctctcccccag 1252
Query: 1300 gtggagattttgctgatccagtcactgctgccactttaggtatcgtccaagtattctggg 1359
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1253 gtggagattttgctgatccagtcactgctgccactttaggtatcgtccaagtattctggg 1312
Query: 1360 gtttagataaaaaattagcacaacgtaaacatttcccatccatcaattggttaatttctt 1419
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1313 gtttagataaaaaattagcacaacgtaaacatttcccatccatcaattggttaatttctt 1372
Query: 1420 tctccaaatatatgcaagctcttgatactcattatgatcaaatggatccagaattcgttc 1479
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1373 tctccaaatatatgcaagctcttgatactcattatgatcaaatggatccagaattcgttc 1432
Query: 1480 cactccgtaccagagccaaggaaattcttcaaatggaagaagatctctctgaaatcgtcc 1539
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1433 cactccgtaccagagccaaggaaattcttcaaatggaagaagatctctctgaaatcgtcc 1492
Query: 1540 aattggtcggtcaagattctttaggtgaatctgaaaagattaccattgaagtcgctcgta 1599
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1493 aattggtcggtcaagattctttaggtgaatctgaaaagattaccattgaagtcgctcgta 1552
Query: 1600 ttattcgtgatgatttccttcaacaaaatggtttctctccatacgataaatgttgtccat 1659
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1553 ttattcgtgatgatttccttcaacaaaatggtttctctccatacgataaatgttgtccat 1612
Query: 1660 tcttcaagaccgtttggatgttaaagaatatgatgactttctacaatttagcacaaaaag 1719
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1613 tcttcaagaccgtttggatgttaaagaatatgatgactttctacaatttagcacaaaaag 1672
Query: 1720 ctgttgaatcaagtaccgctgataataaagttacttggaatcaaattaaaaatgaattaa 1779
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1673 ctgttgaatcaagtaccgctgataataaagttacttggaatcaaattaaaaatgaattaa 1732
Query: 1780 aagaaatcattcacagaattacttcaatgaaattccaagatccaactgacggtgaacaaa 1839
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1733 aagaaatcattcacagaattacttcaatgaaattccaagatccaactgacggtgaacaaa 1792
Query: 1840 ctttaactgctcatttctcaactctcaatgaagatatcattactgctttcagaaacttta 1899
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1793 ctttaactgctcatttctcaactctcaatgaagatatcattactgctttcagaaacttta 1852
Query: 1900 gtgatttagtt 1910
|||||||||||
Sbjct: 1853 gtgatttagtt 1863
Score = 1402 bits (707), Expect(2) = 0.0
Identities = 707/707 (100%)
Strand = Plus / Plus
Query: 54 aaatgtcaaaaaattcaggtttaccatcattcgcttcaactgaagctgataattcacaag 113
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 8 aaatgtcaaaaaattcaggtttaccatcattcgcttcaactgaagctgataattcacaag 67
Query: 114 gttttgtattatcagtatcaggtccagtcgtaattgctaatcaattagctggtgctgcta 173
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 68 gttttgtattatcagtatcaggtccagtcgtaattgctaatcaattagctggtgctgcta 127
Query: 174 tgtacgagttggttcgtgtaggtcacaatcaattagttggtgaaattattagattagaag 233
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 128 tgtacgagttggttcgtgtaggtcacaatcaattagttggtgaaattattagattagaag 187
Query: 234 aagatactgccacaattcaagtttacgaagaaacttctggtttaactgttggtgatccag 293
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 188 aagatactgccacaattcaagtttacgaagaaacttctggtttaactgttggtgatccag 247
Query: 294 tattaagaactcataaaccattaacagttgaattaggtccaggtattatgaataatattt 353
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 248 tattaagaactcataaaccattaacagttgaattaggtccaggtattatgaataatattt 307
Query: 354 ttgatggtattcaacgtccattaaatgcaattgcagagattacaaaaggtatttatattc 413
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 308 ttgatggtattcaacgtccattaaatgcaattgcagagattacaaaaggtatttatattc 367
Query: 414 caagaggtattaatactccatcattaaatagaactattaaatggccatatcaaccagata 473
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 368 caagaggtattaatactccatcattaaatagaactattaaatggccatatcaaccagata 427
Query: 474 ccaaattaaaagttggtgacaatgttagtggtggtgatatttttggtcaagttgttgaaa 533
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 428 ccaaattaaaagttggtgacaatgttagtggtggtgatatttttggtcaagttgttgaaa 487
Query: 534 ataatttaatcatccataagattatggttccaccaaaggaaatgggtaccatcgtagaga 593
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 488 ataatttaatcatccataagattatggttccaccaaaggaaatgggtaccatcgtagaga 547
Query: 594 ttgcaccagctggtgaatacactttggatcatgcacttttaaccattgaattcgatggta 653
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 548 ttgcaccagctggtgaatacactttggatcatgcacttttaaccattgaattcgatggta 607
Query: 654 aacgtaaacaattaactatggttcacaattggccagtacgtagtgcacgtccagtcattg 713
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 608 aacgtaaacaattaactatggttcacaattggccagtacgtagtgcacgtccagtcattg 667
Query: 714 aaaaacttccatgtaattatccattattaactggtcaacgtgtactt 760
|||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 668 aaaaacttccatgtaattatccattattaactggtcaacgtgtactt 714
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 2,184,355,325
Number of extensions: 123054182
Number of successful extensions: 9711830
Number of sequences better than 10.0: 3101
Length of query: 2007
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1983
Effective length of database: 96,409,374,237
Effective search space: 191179789111971
Effective search space used: 191179789111971
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 8. 2 |
| Homology vs Protein |
Query= Contig-U16299-1 (Contig-U16299-1Q) /CSM_Contig/Contig-U16299-1Q.Seq.d
(2007 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(P54647) RecName: Full=V-type proton ATPase catalytic subunit A;... 772 0.0
BC044025_1(BC044025|pid:none) Xenopus laevis ATPase, H+ transpor... 577 0.0
AB369668_1(AB369668|pid:none) Oreochromis mossambicus V-ATPaseA ... 581 0.0
AB250091_1(AB250091|pid:none) Rana catesbeiana VHA-A mRNA for va... 575 0.0
BC055130_1(BC055130|pid:none) Danio rerio ATPase, H+ transportin... 582 0.0
BT044780_1(BT044780|pid:none) Salmo salar clone ssal-rgf-503-219... 579 0.0
AB066243_1(AB066243|pid:none) Fundulus heteroclitus mRNA for V-A... 579 0.0
BC098963_1(BC098963|pid:none) Xenopus laevis hypothetical protei... 579 0.0
(Q90647) RecName: Full=V-type proton ATPase catalytic subunit A;... 582 0.0
BC079948_1(BC079948|pid:none) Xenopus tropicalis ATPase, H+ tran... 579 0.0
(P38607) Vacuolar ATP synthase catalytic subunit A, osteoclast i... 585 0.0
(P31400) RecName: Full=V-type proton ATPase catalytic subunit A;... 580 0.0
EF114391_1(EF114391|pid:none) Bombyx mori vacuolar ATP synthase ... 580 0.0
AY891447_1(AY891447|pid:none) Synthetic construct Homo sapiens c... 580 0.0
(Q5R5H2) RecName: Full=V-type proton ATPase catalytic subunit A;... 580 0.0
BC105145_1(BC105145|pid:none) Bos taurus ATPase, H+ transporting... 582 0.0
(P31404) RecName: Full=V-type proton ATPase catalytic subunit A;... 582 0.0
BC157719_1(BC157719|pid:none) Xenopus laevis hypothetical protei... 576 0.0
A56807(A56807) H+-transporting two-sector ATPase (EC 3.6.3.14), ... 579 0.0
(Q5TTG1) RecName: Full=V-type proton ATPase catalytic subunit A;... 580 0.0
M80430_1(M80430|pid:none) Bovine vacuolar H+-ATPase A subunit mR... 582 0.0
U13837_1(U13837|pid:none) Mus musculus vacuolar adenosine tripho... 580 0.0
B46091(B46091)H+-exporting ATPase (EC 3.6.3.6) chain A, vacuolar... 579 0.0
L09235_1(L09235|pid:none) Human vacuolar ATPase (isoform VA68) m... 579 0.0
(O16109) RecName: Full=V-type proton ATPase catalytic subunit A;... 576 0.0
(Q9XW92) RecName: Full=V-type proton ATPase catalytic subunit A;... 575 0.0
FN357409_11(FN357409|pid:none) Schistosoma mansoni genome sequen... 564 0.0
AB016483_1(AB016483|pid:none) Ascidia sydneiensis samea mRNA for... 564 0.0
AY177247_1(AY177247|pid:none) Lycopersicon esculentum vacuolar H... 565 0.0
AY178911_1(AY178911|pid:none) Lycopersicon esculentum vacuolar H... 563 0.0
EU976570_1(EU976570|pid:none) Zea mays clone 983784 vacuolar ATP... 561 0.0
(O23654) RecName: Full=V-type proton ATPase catalytic subunit A;... 558 0.0
(P13548) RecName: Full=V-type proton ATPase catalytic subunit A;... 565 0.0
AB189963_1(AB189963|pid:none) Pyrus communis PcVHA-A1 mRNA for v... 557 0.0
AB032840_1(AB032840|pid:none) Hordeum vulgare HVA/68 mRNA for va... 556 0.0
AF050673_1(AF050673|pid:none) Gossypium hirsutum vacuolar H+-ATP... 559 0.0
AJ276326_1(AJ276326|pid:none) Mesembryanthemum crystallinum mRNA... 565 0.0
(P09469) RecName: Full=V-type proton ATPase catalytic subunit A;... 556 0.0
AF367445_1(AF367445|pid:none) Prunus persica clone AtpvA1 V-ATPa... 555 0.0
(Q9SM09) RecName: Full=V-type proton ATPase catalytic subunit A;... 561 0.0
(Q39442) RecName: Full=V-type proton ATPase catalytic subunit A;... 552 0.0
AP004744_9(AP004744|pid:none) Oryza sativa Japonica Group genomi... 557 0.0
AE017345_230(AE017345|pid:none) Cryptococcus neoformans var. neo... 538 0.0
(P48414) RecName: Full=V-type proton ATPase catalytic subunit A;... 547 0.0
AM476185_1(AM476185|pid:none) Vitis vinifera contig VV78X188988.... 546 0.0
CR954210_308(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 560 0.0
CP001328_92(CP001328|pid:none) Micromonas sp. RCC299 chromosome ... 546 0.0
AF008922_1(AF008922|pid:none) Aedes aegypti V-ATPase A-subunit m... 560 0.0
CP000590_297(CP000590|pid:none) Ostreococcus lucimarinus CCE9901... 556 0.0
I50715(I50715) A2 isoform of vacuolar H+-ATPase subunit A - chic... 518 0.0
AM502252_320(AM502252|pid:none) Leishmania infantum chromosome 34. 558 0.0
(P31406) RecName: Full=V-type proton ATPase catalytic subunit A;... 529 0.0
(Q38677) RecName: Full=V-type proton ATPase catalytic subunit A ... 540 0.0
AM494957_326(AM494957|pid:none) Leishmania braziliensis chromoso... 556 0.0
AE014134_2352(AE014134|pid:none) Drosophila melanogaster chromos... 545 0.0
AK149833_1(AK149833|pid:none) Mus musculus bone marrow macrophag... 512 0.0
BC063915_1(BC063915|pid:none) Xenopus tropicalis ATPase, H+ tran... 572 0.0
AB093514_1(AB093514|pid:none) Saccharomyces pastorianus VMA1 gen... 489 0.0
AB093512_1(AB093512|pid:none) Saccharomyces pastorianus VMA1 gen... 486 0.0
AF389404_1(AF389404|pid:none) Saccharomyces sp. DH1-1A VMA1 (VMA... 489 0.0
AJ131823_1(AJ131823|pid:none) Scherffelia dubia mRNA for H(+)-tr... 534 0.0
(Q9UVJ8) RecName: Full=V-type proton ATPase catalytic subunit A;... 491 0.0
CR764096_1(CR764096|pid:none) Paramecium tetraurelia, complete g... 520 0.0
CR764094_1(CR764094|pid:none) Paramecium tetraurelia, complete g... 520 0.0
(P49087) RecName: Full=V-type proton ATPase catalytic subunit A;... 561 0.0
FM992690_150(FM992690|pid:none) Candida dubliniensis CD36 chromo... 496 0.0
CU640366_640(CU640366|pid:none) Podospora anserina genomic DNA c... 486 0.0
(Q03498) RecName: Full=V-type proton ATPase catalytic subunit A;... 526 0.0
AM910996_108(AM910996|pid:none) Plasmodium knowlesi strain H chr... 523 0.0
FN392319_625(FN392319|pid:none) Pichia pastoris GS115 chromosome... 491 0.0
AY089332_1(AY089332|pid:none) Drosophila melanogaster AT13860 fu... 545 0.0
AK140873_1(AK140873|pid:none) Mus musculus 16 days embryo head c... 451 0.0
AL590450_128(AL590450|pid:none) chromosome XI of strain GB-M1 of... 505 0.0
CR940353_650(CR940353|pid:none) Theileria annulata strain Ankara... 503 0.0
BT072235_1(BT072235|pid:none) Salmo salar clone ssal-rgf-517-354... 581 e-176
EF146843_1(EF146843|pid:none) Populus trichocarpa clone WS01214_... 555 e-175
EU975098_1(EU975098|pid:none) Zea mays clone 468795 unknown mRNA. 561 e-165
(B0K5J0) RecName: Full=V-type ATP synthase alpha chain; ... 384 e-163
B64327(B64327) H+-transporting two-sector ATPase (EC 3.6.3.14) s... 382 e-162
(Q8TWL6) RecName: Full=V-type ATP synthase alpha chain; ... 397 e-162
CP001463_1772(CP001463|pid:none) Thermococcus sibiricus MM 739, ... 379 e-160
CP001251_1434(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 385 e-160
(Q72J72) RecName: Full=V-type ATP synthase alpha chain; ... 376 e-160
(Q1IWP3) RecName: Full=V-type ATP synthase alpha chain; ... 371 e-159
DQ369724_8(DQ369724|pid:none) Caloramator fervidus strain ATCC 4... 393 e-159
(Q56403) RecName: Full=V-type ATP synthase alpha chain; ... 374 e-159
(Q5JIR3) RecName: Full=V-type ATP synthase alpha chain; ... 373 e-158
(O06504) RecName: Full=V-type ATP synthase alpha chain; ... 373 e-158
(Q2FP52) RecName: Full=V-type ATP synthase alpha chain 1; ... 401 e-158
DQ056751_1(DQ056751|pid:none) Vigna unguiculata vacuolar H+-ATPa... 503 e-157
CP001114_103(CP001114|pid:none) Deinococcus deserti VCD115, comp... 369 e-157
(B5E552) RecName: Full=V-type ATP synthase alpha chain; ... 382 e-157
(Q97QA8) RecName: Full=V-type ATP synthase alpha chain; ... 382 e-157
CP000387_83(CP000387|pid:none) Streptococcus sanguinis SK36, com... 385 e-156
CP001033_862(CP001033|pid:none) Streptococcus pneumoniae CGSP14,... 381 e-156
(Q0W363) RecName: Full=V-type ATP synthase alpha chain; ... 383 e-156
(Q1JIX5) RecName: Full=V-type ATP synthase alpha chain; ... 381 e-156
CP001098_1924(CP001098|pid:none) Halothermothrix orenii H 168, c... 369 e-156
(Q8K8T1) RecName: Full=V-type ATP synthase alpha chain; ... 381 e-156
(A2RC97) RecName: Full=V-type ATP synthase alpha chain; ... 380 e-156
(Q1J8S5) RecName: Full=V-type ATP synthase alpha chain; ... 380 e-156
(A3CS71) RecName: Full=V-type ATP synthase alpha chain; ... 395 e-156
(Q0TPW7) RecName: Full=V-type ATP synthase alpha chain; ... 372 e-155
(A7IAU8) RecName: Full=V-type ATP synthase alpha chain; ... 392 e-155
(A0PZC6) RecName: Full=V-type ATP synthase alpha chain; ... 384 e-155
(Q1JDX0) RecName: Full=V-type ATP synthase alpha chain; ... 379 e-155
(A3DHP0) RecName: Full=V-type ATP synthase alpha chain; ... 372 e-155
CP001338_2545(CP001338|pid:none) Candidatus Methanosphaerula pal... 392 e-155
CP000728_2555(CP000728|pid:none) Clostridium botulinum F str. La... 378 e-154
(B1IJM8) RecName: Full=V-type ATP synthase alpha chain; ... 378 e-154
(B1KXT6) RecName: Full=V-type ATP synthase alpha chain; ... 378 e-154
(A7GGL4) RecName: Full=V-type ATP synthase alpha chain; ... 378 e-154
AP008971_1074(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 375 e-154
AM412317_2630(AM412317|pid:none) Clostridium botulinum A str. AT... 375 e-153
(Q896K4) RecName: Full=V-type ATP synthase alpha chain 1; ... 374 e-153
(A5I557) RecName: Full=V-type ATP synthase alpha chain; ... 375 e-153
CP001083_2743(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 374 e-153
CP001145_640(CP001145|pid:none) Coprothermobacter proteolyticus ... 370 e-153
(A6VFZ2) RecName: Full=V-type ATP synthase alpha chain; ... 367 e-152
(A9AAQ4) RecName: Full=V-type ATP synthase alpha chain; ... 367 e-152
S18887(S18887)H+-exporting ATPase (EC 3.6.3.6) catalytic chain, ... 469 e-152
(Q2FQE9) RecName: Full=V-type ATP synthase alpha chain 3; ... 362 e-152
CP001581_2814(CP001581|pid:none) Clostridium botulinum A2 str. K... 373 e-152
(Q6LYE7) RecName: Full=V-type ATP synthase alpha chain; ... 366 e-152
(A4FXD4) RecName: Full=V-type ATP synthase alpha chain; ... 365 e-151
(Q08636) RecName: Full=V-type sodium ATPase catalytic subunit A;... 371 e-151
(B2UWY4) RecName: Full=V-type ATP synthase alpha chain; ... 367 e-151
(B2TP91) RecName: Full=V-type ATP synthase alpha chain; ... 368 e-151
AE014074_120(AE014074|pid:none) Streptococcus pyogenes MGAS315, ... 381 e-150
(Q46FH3) RecName: Full=V-type ATP synthase alpha chain; ... 390 e-150
(Q184E7) RecName: Full=V-type ATP synthase alpha chain; ... 380 e-150
(Q9UWW6) RecName: Full=V-type ATP synthase alpha chain; ... 344 e-150
CP001403_1538(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 339 e-149
CP001400_1423(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 339 e-149
CP001404_1162(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 339 e-149
CP001399_1524(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 339 e-149
AE016830_1404(AE016830|pid:none) Enterococcus faecalis V583, com... 361 e-148
(Q8TIJ1) RecName: Full=V-type ATP synthase alpha chain; ... 382 e-148
BA000023_1562(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 346 e-147
(Q971B7) RecName: Full=V-type ATP synthase alpha chain; ... 346 e-147
(A9A2R0) RecName: Full=V-type ATP synthase alpha chain; ... 358 e-147
(Q4J8L9) RecName: Full=V-type ATP synthase alpha chain; ... 343 e-147
EU016591_8(EU016591|pid:none) Uncultured Group I marine crenarch... 363 e-146
(A4YI05) RecName: Full=V-type ATP synthase alpha chain; ... 342 e-146
(O29101) RecName: Full=V-type ATP synthase alpha chain; ... 369 e-146
CP000885_3038(CP000885|pid:none) Clostridium phytofermentans ISD... 350 e-146
BA000034_122(BA000034|pid:none) Streptococcus pyogenes SSI-1 DNA... 381 e-145
(Q48332) RecName: Full=V-type ATP synthase alpha chain; ... 359 e-144
(A0RXK1) RecName: Full=V-type ATP synthase alpha chain; ... 356 e-144
(Q891P1) RecName: Full=V-type ATP synthase alpha chain 2; ... 347 e-143
(A1RX21) RecName: Full=V-type ATP synthase alpha chain; ... 329 e-143
(Q3ITC8) RecName: Full=V-type ATP synthase alpha chain; ... 358 e-142
CP001140_994(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 344 e-142
(B0R755) RecName: Full=V-type ATP synthase alpha chain; ... 355 e-142
S14732(S14732;S18498) H+-transporting two-sector ATPase (EC 3.6.... 354 e-141
CP001365_280(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 359 e-141
AM920436_1510(AM920436|pid:none) Penicillium chrysogenum Wiscons... 499 e-139
(Q5UXY8) RecName: Full=V-type ATP synthase alpha chain; ... 349 e-139
CP000969_1086(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 352 e-139
AJ544860_7(AJ544860|pid:none) Thermotoga sp. RQ2 ORF1, ntpC gene... 352 e-138
AP008971_1166(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 352 e-138
(Q18FB7) RecName: Full=V-type ATP synthase alpha chain; ... 347 e-138
AM270026_45(AM270026|pid:none) Aspergillus niger contig An02c031... 493 e-138
CP000885_3404(CP000885|pid:none) Clostridium phytofermentans ISD... 337 e-137
CP001359_2739(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 326 e-133
(B4UH39) RecName: Full=V-type ATP synthase alpha chain; ... 326 e-132
(A7HDG9) RecName: Full=V-type ATP synthase alpha chain; ... 330 e-131
AB073302_1(AB073302|pid:none) Aspergillus oryzae vmaA gene for v... 472 e-131
CP000852_212(CP000852|pid:none) Caldivirga maquilingensis IC-167... 310 e-130
U36438_1(U36438|pid:none) Acer pseudoplatanus V-ATPase 66 kDa su... 343 e-126
(A1RSF1) RecName: Full=V-type ATP synthase alpha chain; ... 311 e-126
(A4WN96) RecName: Full=V-type ATP synthase alpha chain; ... 310 e-126
(Q3J9F3) RecName: Full=V-type ATP synthase alpha chain; ... 316 e-126
AB036926_1(AB036926|pid:none) Citrus unshiu Cit-VATP A-1 gene fo... 453 e-125
(Q8ZYR1) RecName: Full=V-type ATP synthase alpha chain; ... 315 e-125
(B1YC22) RecName: Full=V-type ATP synthase alpha chain; ... 304 e-124
EF666049_1(EF666049|pid:none) Eriobotrya japonica V-ATPase catal... 428 e-118
EF575855_1(EF575855|pid:none) Oryza sativa (indica cultivar-grou... 424 e-117
CR382126_235(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 423 e-116
CR380955_160(CR380955|pid:none) Candida glabrata strain CBS138 c... 423 e-116
CR382136_666(CR382136|pid:none) Debaryomyces hansenii strain CBS... 420 e-116
CP000496_441(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 419 e-115
(P17255) RecName: Full=V-type proton ATPase catalytic subunit A;... 417 e-115
CP001230_38(CP001230|pid:none) Persephonella marina EX-H1, compl... 328 e-115
AB093513_1(AB093513|pid:none) Saccharomyces pastorianus VMA1 gen... 416 e-114
AB093497_1(AB093497|pid:none) Saccharomyces cerevisiae VMA1 gene... 411 e-113
AB093503_1(AB093503|pid:none) Saccharomyces cerevisiae VMA1 gene... 411 e-113
AB093495_1(AB093495|pid:none) Saccharomyces cerevisiae VMA1 gene... 411 e-113
AB093496_1(AB093496|pid:none) Saccharomyces cerevisiae VMA1 gene... 411 e-113
AB093507_1(AB093507|pid:none) Saccharomyces castellii VMA1 gene ... 411 e-113
AB093510_1(AB093510|pid:none) Saccharomyces exiguus VMA1-2 gene ... 408 e-112
AB093509_1(AB093509|pid:none) Saccharomyces exiguus VMA1-1 gene ... 408 e-112
AB220510_1(AB220510|pid:none) Macaca fascicularis mRNA, clone Qn... 405 e-111
CP000698_420(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 298 e-109
AX407287_1(AX407287|pid:none) Sequence 58 from Patent WO0226984. 398 e-109
FJ999544_1(FJ999544|pid:none) Camellia sinensis mitochondrial V-... 387 e-106
EU285245_1(EU285245|pid:none) Tetraodon nigroviridis V-type ATPa... 365 3e-99
(Q8U4A6) RecName: Full=V-type ATP synthase alpha chain; ... 357 7e-97
(Q9UXU7) RecName: Full=V-type ATP synthase alpha chain; ... 355 5e-96
EU285244_1(EU285244|pid:none) Tetraodon nigroviridis V-type ATPa... 351 7e-95
(Q97CQ0) RecName: Full=V-type ATP synthase alpha chain; ... 345 4e-93
(Q9PK85) RecName: Full=V-type ATP synthase alpha chain; ... 261 3e-92
(O83441) RecName: Full=V-type ATP synthase alpha chain 1; ... 242 4e-92
(O84310) RecName: Full=V-type ATP synthase alpha chain; ... 262 6e-92
(Q73M28) RecName: Full=V-type ATP synthase alpha chain; ... 239 2e-91
S18313(S18313;S30130)Na+-transporting ATPase (EC 3.6.1.-) alpha ... 181 3e-90
S13589(S13589)H+-transporting two-sector ATPase (EC 3.6.3.14) al... 227 3e-88
AE015924_1543(AE015924|pid:none) Porphyromonas gingivalis W83, c... 232 2e-83
AF087489_1(AF087489|pid:none) Drosophila melanogaster strain Lam... 251 6e-80
AF087492_1(AF087492|pid:none) Drosophila melanogaster strain Lam... 250 8e-80
X63285_1(X63285|pid:none) E.hirae gene nakA for Na+-Atpase 73kDa... 162 5e-78
AK152785_1(AK152785|pid:none) Mus musculus bone marrow macrophag... 294 7e-78
AY737061_1(AY737061|pid:none) Oreochromis mossambicus clone Ov06... 287 1e-75
AF212304_1(AF212304|pid:none) Allium cepa vacuolar H+-ATPase cat... 260 2e-74
(Q6MAJ5) RecName: Full=V-type ATP synthase alpha chain; ... 270 1e-70
(B7J127) RecName: Full=V-type ATP synthase alpha chain; ... 253 2e-65
(O51121) RecName: Full=V-type ATP synthase alpha chain; ... 253 2e-65
(Q662R8) RecName: Full=V-type ATP synthase alpha chain; ... 252 3e-65
CP000395_93(CP000395|pid:none) Borrelia afzelii PKo, complete ge... 250 1e-64
(B2S1S8) RecName: Full=V-type ATP synthase alpha chain; ... 248 5e-64
CP000049_90(CP000049|pid:none) Borrelia turicatae 91E135, comple... 248 6e-64
S65525(S65525) H+-exporting ATPase (EC 3.6.3.6), vacuolar chain ... 137 5e-63
AF218356_1(AF218356|pid:none) Allium cepa vacuolar H+-ATPase cat... 223 2e-56
AM050349_1(AM050349|pid:none) Trichostrongylus vitrinus partial ... 219 4e-55
AY580162_1(AY580162|pid:none) Cucumis sativus vacuolar ATPase ca... 188 8e-52
DQ440543_1(DQ440543|pid:none) Ostertagia ostertagi ATPase beta-s... 198 5e-49
AB033377_1(AB033377|pid:none) Nepenthes alata NaVHA1 mRNA for va... 185 6e-45
AJ312429_1(AJ312429|pid:none) Saccharomyces servazzii partial VM... 155 7e-36
X76913_7(X76913|pid:none) E.hirae ntpL, ntpM, ntpN, ntpO, ntpP, ... 155 7e-36
AJ312430_1(AJ312430|pid:none) Torulaspora delbrueckii partial VM... 154 9e-36
AJ312432_1(AJ312432|pid:none) Saccharomyces kluyveri partial VMA... 154 9e-36
AJ312431_1(AJ312431|pid:none) Kluyveromyces thermotolerans parti... 153 2e-35
AJ312433_1(AJ312433|pid:none) Kluyveromyces dobzhanskii partial ... 152 6e-35
AJ312425_1(AJ312425|pid:none) Saccharomyces bayanus partial VMA1... 152 6e-35
(A9WGS4) RecName: Full=ATP synthase subunit beta; EC=3.... 133 3e-29
(Q38WK5) RecName: Full=ATP synthase subunit beta; EC=3.... 130 1e-28
AJ307892_1(AJ307892|pid:none) Kluyveromyces lactis partial VMA1 ... 130 2e-28
(A9AVV4) RecName: Full=ATP synthase subunit beta; EC=3.... 130 2e-28
AJ307898_1(AJ307898|pid:none) Torulaspora pretoriensis partial V... 129 5e-28
AJ307897_1(AJ307897|pid:none) Zygosaccharomyces rouxii partial V... 129 5e-28
(Q1WUC6) RecName: Full=ATP synthase subunit beta; EC=3.... 129 5e-28
AJ307891_1(AJ307891|pid:none) Saccharomyces cariocanus partial V... 128 9e-28
(B5Z8D0) RecName: Full=ATP synthase subunit beta; EC=3.... 128 9e-28
(Q9ZK81) RecName: Full=ATP synthase subunit beta; EC=3.... 128 9e-28
(P55988) RecName: Full=ATP synthase subunit beta; EC=3.... 127 1e-27
AJ307895_1(AJ307895|pid:none) Zygosaccharomyces bailii partial V... 127 2e-27
(P42467) RecName: Full=ATP synthase subunit beta; EC=3.... 127 2e-27
(A1VXJ0) RecName: Full=ATP synthase subunit beta; EC=3.... 127 2e-27
AJ307899_1(AJ307899|pid:none) Torulaspora globosa partial VMA1 g... 127 2e-27
(Q5FKY0) RecName: Full=ATP synthase subunit beta; EC=3.... 127 2e-27
AY487155_1(AY487155|pid:none) Lactobacillus amylolyticus strain ... 126 3e-27
(Q2ST34) RecName: Full=ATP synthase subunit beta; EC=3.... 126 3e-27
(B1VFY7) RecName: Full=ATP synthase subunit beta; EC=3.... 126 3e-27
AY487158_1(AY487158|pid:none) Lactobacillus crispatus strain NCT... 126 3e-27
(A5CQ60) RecName: Full=ATP synthase subunit beta; EC=3.... 126 3e-27
(B0RED4) RecName: Full=ATP synthase subunit beta; EC=3.... 126 3e-27
AY487157_1(AY487157|pid:none) Lactobacillus amylovorus strain DS... 126 3e-27
(A7ZC37) RecName: Full=ATP synthase subunit beta; EC=3.... 126 3e-27
AY487163_1(AY487163|pid:none) Lactobacillus helveticus strain NC... 126 3e-27
(Q17Y78) RecName: Full=ATP synthase subunit beta; EC=3.... 125 4e-27
CP001072_1103(CP001072|pid:none) Helicobacter pylori Shi470, com... 125 4e-27
CP001618_1300(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 125 6e-27
CP001104_1426(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 125 6e-27
AY487156_1(AY487156|pid:none) Lactobacillus gasseri strain DSM 2... 125 6e-27
(Q88UU3) RecName: Full=ATP synthase subunit beta; EC=3.... 125 6e-27
(Q04BA3) RecName: Full=ATP synthase subunit beta; EC=3.... 125 6e-27
(B7GMF3) RecName: Full=ATP synthase subunit beta; EC=3.... 125 6e-27
(B4U2E1) RecName: Full=ATP synthase subunit beta; EC=3.... 125 6e-27
AM946015_659(AM946015|pid:none) Streptococcus uberis 0140J compl... 125 8e-27
CP001022_2636(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 125 8e-27
(B1HM56) RecName: Full=ATP synthase subunit beta; EC=3.... 125 8e-27
(Q6A8C7) RecName: Full=ATP synthase subunit beta; EC=3.... 125 8e-27
AJ515143_1(AJ515143|pid:none) Pediococcus parvulus atpD gene for... 124 1e-26
(Q1GAW5) RecName: Full=ATP synthase subunit beta; EC=3.... 124 1e-26
(Q8E5U8) RecName: Full=ATP synthase subunit beta; EC=3.... 124 1e-26
(A7NIQ9) RecName: Full=ATP synthase subunit beta; EC=3.... 124 1e-26
(Q5M5J1) RecName: Full=ATP synthase subunit beta; EC=3.... 124 1e-26
AF098522_8(AF098522|pid:none) Lactobacillus acidophilus uracil p... 124 1e-26
AY487159_1(AY487159|pid:none) Lactobacillus rhamnosus strain DSM... 124 1e-26
(A8FIB2) RecName: Full=ATP synthase subunit beta; EC=3.... 124 1e-26
(Q1JCL3) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
(A4ITI9) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
(A3CM14) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
(Q9A0I7) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
AP010935_675(AP010935|pid:none) Streptococcus dysgalactiae subsp... 124 2e-26
(Q927W4) RecName: Full=ATP synthase subunit beta 2; EC=... 124 2e-26
(A0ALL3) RecName: Full=ATP synthase subunit beta 2; EC=... 124 2e-26
(Q9CES0) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
(A2RFC2) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
AF001955_7(AF001955|pid:none) Streptococcus sanguis UncE (uncE),... 124 2e-26
(Q1J7F9) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
(P43451) RecName: Full=ATP synthase subunit beta; EC=3.... 124 2e-26
(Q03234) RecName: Full=ATP synthase subunit beta; EC=3.... 123 2e-26
CP001601_1070(CP001601|pid:none) Corynebacterium aurimucosum ATC... 123 2e-26
CP001107_2815(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 123 2e-26
(A8AYG1) RecName: Full=ATP synthase subunit beta; EC=3.... 123 2e-26
CP001615_1301(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 123 2e-26
AF368465_7(AF368465|pid:none) Streptococcus pneumoniae strain R6... 123 2e-26
(Q831A5) RecName: Full=ATP synthase subunit beta; EC=3.... 123 2e-26
(B2IQX0) RecName: Full=ATP synthase subunit beta; EC=3.... 123 2e-26
(B1ICS9) RecName: Full=ATP synthase subunit beta; EC=3.... 123 2e-26
(A8EV70) RecName: Full=ATP synthase subunit beta; EC=3.... 123 3e-26
(P37809) RecName: Full=ATP synthase subunit beta; EC=3.... 123 3e-26
AF393838_8(AF393838|pid:none) Lactococcus lactis subsp. lactis t... 123 3e-26
CP000058_2414(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 123 3e-26
(Q5KUJ3) RecName: Full=ATP synthase subunit beta; EC=3.... 122 4e-26
AK317653_1(AK317653|pid:none) Arabidopsis thaliana AT1G78900 mRN... 122 4e-26
CP001638_3001(CP001638|pid:none) Geobacillus sp. WCH70, complete... 122 4e-26
(Q9K6H5) RecName: Full=ATP synthase subunit beta; EC=3.... 122 4e-26
CP001620_1220(CP001620|pid:none) Corynebacterium kroppenstedtii ... 122 4e-26
(Q9LA80) RecName: Full=ATP synthase subunit beta; EC=3.... 122 4e-26
(A6W7G9) RecName: Full=ATP synthase subunit beta; EC=3.... 122 5e-26
(Q8FQ20) RecName: Full=ATP synthase subunit beta; EC=3.... 122 5e-26
(A7I177) RecName: Full=ATP synthase subunit beta; EC=3.... 122 5e-26
(A5VIR1) RecName: Full=ATP synthase subunit beta; EC=3.... 122 5e-26
(Q03EL4) RecName: Full=ATP synthase subunit beta; EC=3.... 122 6e-26
CP001279_303(CP001279|pid:none) Nautilia profundicola AmH, compl... 122 6e-26
(Q6AG58) RecName: Full=ATP synthase subunit beta; EC=3.... 122 6e-26
CP001034_2792(CP001034|pid:none) Natranaerobius thermophilus JW/... 122 6e-26
(A7GV56) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
(A9VSA3) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
AY488175_2(AY488175|pid:none) Bifidobacterium animalis atp opero... 121 8e-26
(B5XKQ1) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
AJ307894_1(AJ307894|pid:none) Kluyveromyces polysporus partial V... 121 8e-26
(B7JGN0) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
AM295250_1597(AM295250|pid:none) Staphylococcus carnosus subsp. ... 121 8e-26
(B7IQV8) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
(B7HFK1) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
(P22478) RecName: Full=ATP synthase subunit beta; EC=3.... 121 8e-26
AJ307902_1(AJ307902|pid:none) Saccharomyces castellii partial VM... 121 1e-25
CP001213_617(CP001213|pid:none) Bifidobacterium animalis subsp. ... 121 1e-25
AY491983_1(AY491983|pid:none) Bifidobacterium animalis strain AT... 121 1e-25
JC5741(JC5741)membrane-bound proton-translocating ATPase (EC 3.6... 120 1e-25
(P12698) RecName: Full=ATP synthase subunit beta; EC=3.... 120 1e-25
CP001357_200(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 120 1e-25
(A9NGW2) RecName: Full=ATP synthase subunit beta; EC=3.... 120 2e-25
(Q5WB78) RecName: Full=ATP synthase subunit beta; EC=3.... 120 2e-25
(P07677) RecName: Full=ATP synthase subunit beta; EC=3.... 120 2e-25
CP001275_1178(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 120 2e-25
(Q6KI82) RecName: Full=ATP synthase subunit beta; EC=3.... 120 2e-25
(A6QB59) RecName: Full=ATP synthase subunit beta; EC=3.... 120 2e-25
CP000771_738(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 120 2e-25
AF533147_8(AF533147|pid:none) Bacillus sp. TA2.A1 ATP synthase s... 120 2e-25
AY459458_1(AY459458|pid:none) Chrysogrammitis musgraveana vouche... 120 2e-25
(B3DTV0) RecName: Full=ATP synthase subunit beta; EC=3.... 119 3e-25
EU372980_1(EU372980|pid:none) Bifidobacterium longum ATP synthas... 119 3e-25
(P42006) RecName: Full=ATP synthase subunit beta; EC=3.... 119 3e-25
(B0Z4U4) RecName: Full=ATP synthase subunit beta, chloroplastic;... 119 3e-25
CP001108_50(CP001108|pid:none) Prosthecochloris aestuarii DSM 27... 119 4e-25
CP001047_42(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, c... 119 4e-25
(B1KSS8) RecName: Full=ATP synthase subunit beta; EC=3.... 119 4e-25
AY487160_1(AY487160|pid:none) Lactobacillus gallinarum strain AT... 119 4e-25
CP001581_158(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 119 4e-25
AY487147_1(AY487147|pid:none) Bifidobacterium coryneforme strain... 119 4e-25
(Q03V29) RecName: Full=ATP synthase subunit beta; EC=3.... 119 5e-25
(A7G9Q9) RecName: Full=ATP synthase subunit beta; EC=3.... 119 5e-25
(B2UZK0) RecName: Full=ATP synthase subunit beta; EC=3.... 119 5e-25
AY459483_1(AY459483|pid:none) Lellingeria schenckei voucher Sali... 119 5e-25
(B2TK00) RecName: Full=ATP synthase subunit beta; EC=3.... 119 5e-25
(P33253) RecName: Full=ATP synthase subunit beta; EC=3.... 119 5e-25
CP000916_467(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 118 7e-25
AP009153_716(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 118 7e-25
(Q03QY8) RecName: Full=ATP synthase subunit beta; EC=3.... 118 7e-25
AB233732_1(AB233732|pid:none) Ionidium commune chloroplast atpB ... 118 7e-25
AF209700_1(AF209700|pid:none) Zostera noltii ATP synthase beta s... 118 7e-25
(A1A3C5) RecName: Full=ATP synthase subunit beta; EC=3.... 118 7e-25
AY487145_1(AY487145|pid:none) Bifidobacterium bifidum strain ATC... 118 7e-25
(O50292) RecName: Full=ATP synthase subunit beta; EC=3.... 118 7e-25
(Q2RFX9) RecName: Full=ATP synthase subunit beta; EC=3.... 118 7e-25
(P41009) RecName: Full=ATP synthase subunit beta; EC=3.... 118 7e-25
AY487144_1(AY487144|pid:none) Bifidobacterium adolescentis strai... 118 7e-25
(Q0SQZ5) RecName: Full=ATP synthase subunit beta; EC=3.... 118 9e-25
EF463331_1(EF463331|pid:none) Asplenium formosae ATP synthase be... 118 9e-25
(Q0TNC4) RecName: Full=ATP synthase subunit beta; EC=3.... 118 9e-25
BA000031_1668(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 118 9e-25
EF463512_1(EF463512|pid:none) Pyrrosia serpens ATP synthase beta... 118 9e-25
EF463535_1(EF463535|pid:none) Pseudophegopteris cruciata ATP syn... 117 1e-24
D89556_1(D89556|pid:none) Amborella trichopoda chloroplast atpB ... 117 1e-24
AY487150_1(AY487150|pid:none) Bifidobacterium longum bv. Infanti... 117 2e-24
CP001053_1539(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 117 2e-24
AF213785_1(AF213785|pid:none) Primula palinuri ATP synthase beta... 117 2e-24
(O67828) RecName: Full=ATP synthase subunit beta; EC=3.... 117 2e-24
AY100805_1(AY100805|pid:none) Breweria rotundifolia ATP synthase... 117 2e-24
AJ504823_1(AJ504823|pid:none) Hydrophyllum canadense partial atp... 117 2e-24
B64244(B64244)H+-transporting two-sector ATPase (EC 3.6.3.14) be... 117 2e-24
(Q0P3P2) RecName: Full=ATP synthase subunit beta, chloroplastic;... 117 2e-24
AY487146_1(AY487146|pid:none) Bifidobacterium catenulatum strain... 117 2e-24
AF213788_1(AF213788|pid:none) Primula veitchiana ATP synthase be... 117 2e-24
AE017346_61(AE017346|pid:none) Cryptococcus neoformans var. neof... 117 2e-24
CP001349_7065(CP001349|pid:none) Methylobacterium nodulans ORS 2... 117 2e-24
EF463534_1(EF463534|pid:none) Phegopteris hexagonoptera ATP synt... 117 2e-24
CP001628_772(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 117 2e-24
AY459463_1(AY459463|pid:none) Ctenopteris lasiostipes voucher Ho... 117 2e-24
GN102169_1(GN102169|pid:none) Sequence 6950 from Patent WO200903... 117 2e-24
EF463518_1(EF463518|pid:none) Thylacopteris papillosa ATP syntha... 117 2e-24
AY100823_1(AY100823|pid:none) Dipteropeltis poranoides ATP synth... 117 2e-24
AF213784_1(AF213784|pid:none) Primula gaubaeana ATP synthase bet... 117 2e-24
AY459462_1(AY459462|pid:none) Ctenopteris heterophylla voucher P... 117 2e-24
AJ504837_1(AJ504837|pid:none) Phacelia grandiflora partial atpB ... 117 2e-24
AB267992_1(AB267992|pid:none) Elateriospermum tapos chloroplast ... 117 2e-24
AF209582_1(AF209582|pid:none) Epilobium angustifolium ATP syntha... 117 2e-24
CP000879_1331(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 117 2e-24
DQ646084_1(DQ646084|pid:none) Thuidium recognitum ATPase beta su... 117 2e-24
AB233645_1(AB233645|pid:none) Elatine triandra chloroplast atpB ... 117 2e-24
(Q89X74) RecName: Full=ATP synthase subunit beta; EC=3.... 117 2e-24
AF213778_1(AF213778|pid:none) Lysimachia minoricensis ATP syntha... 117 2e-24
AJ235458_1(AJ235458|pid:none) Dischidia lanceolata chloroplast a... 117 2e-24
AF209564_1(AF209564|pid:none) Clarkia xantiana ATP synthase beta... 117 2e-24
AY459461_1(AY459461|pid:none) Ctenopteris heterophylla voucher A... 117 2e-24
AB212687_1(AB212687|pid:none) Oleandra wallichii chloroplast atp... 117 2e-24
AY459464_1(AY459464|pid:none) Ctenopteris nutans voucher Ranker ... 117 2e-24
AY459471_1(AY459471|pid:none) Grammitis deplanchei voucher Hodel... 117 2e-24
EF452052_1(EF452052|pid:none) Polytaenium cajenense ATP synthase... 117 2e-24
GN102053_1(GN102053|pid:none) Sequence 6834 from Patent WO200903... 117 2e-24
AY465537_1(AY465537|pid:none) Flagellaria indica ATP synthase be... 116 3e-24
(P25075) RecName: Full=ATP synthase subunit beta; EC=3.... 116 3e-24
AJ504827_1(AJ504827|pid:none) Lithospermum arvense partial atpB ... 116 3e-24
(Q70XZ6) RecName: Full=ATP synthase subunit beta, chloroplastic;... 116 3e-24
EU002166_1(EU002166|pid:none) Plumbago auriculata ATP synthase C... 116 3e-24
EF463392_1(EF463392|pid:none) Dryopteris goldiana ATP synthase b... 116 3e-24
AJ235565_1(AJ235565|pid:none) Plumbago zeylanica chloroplast atp... 116 3e-24
CP000910_1424(CP000910|pid:none) Renibacterium salmoninarum ATCC... 116 3e-24
AF035911_1(AF035911|pid:none) Pelargonium cotyledonis ATP syntha... 116 3e-24
EU717528_1(EU717528|pid:none) Clitoria ternatea isolate 127 memb... 116 3e-24
EF452011_1(EF452011|pid:none) Adiantum malesianum ATP synthase b... 116 3e-24
AF035913_1(AF035913|pid:none) Ruta graveolens ATP synthase beta ... 116 3e-24
(A9WNC8) RecName: Full=ATP synthase subunit beta; EC=3.... 116 3e-24
AY788247_1(AY788247|pid:none) Pimelodendron zoanthogyne ATP synt... 116 3e-24
AF213767_1(AF213767|pid:none) Dodecatheon meadia ATP synthase be... 116 3e-24
AJ235480_1(AJ235480|pid:none) Geum sp. 'Chase 2507 K' chloroplas... 116 3e-24
EF463428_1(EF463428|pid:none) Megalastrum biseriale ATP synthase... 116 3e-24
AY788266_1(AY788266|pid:none) Dapania racemosa ATP synthase beta... 116 3e-24
EF452051_1(EF452051|pid:none) Platyzoma microphyllum ATP synthas... 116 3e-24
EF463330_1(EF463330|pid:none) Asplenium forisiense ATP synthase ... 116 3e-24
EU922524_1(EU922524|pid:none) Pelargonium cotyledonis ATP syntha... 116 3e-24
CP000702_697(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 116 3e-24
AY100810_1(AY100810|pid:none) Stylisma patens ATP synthase beta ... 116 3e-24
AF060423_1(AF060423|pid:none) Euplassa inaequalis ATP synthase b... 116 3e-24
AY459465_1(AY459465|pid:none) Ctenopteris aff. repandula Ranker ... 116 3e-24
AY100809_1(AY100809|pid:none) Bonamia thunbergiana ATP synthase ... 116 3e-24
AB233679_1(AB233679|pid:none) Pimelodendron griffithianum chloro... 116 3e-24
EF452060_1(EF452060|pid:none) Pteris vittata ATP synthase beta c... 116 3e-24
AF209589_1(AF209589|pid:none) Flagellaria indica ATP synthase be... 116 3e-24
(A4YKE0) RecName: Full=ATP synthase subunit beta; EC=3.... 116 4e-24
EF422972_1(EF422972|pid:none) Danthonia californica ATP synthase... 116 4e-24
AF093391_1(AF093391|pid:none) Phytolacca americana ATP synthase ... 116 4e-24
AF469775_1(AF469775|pid:none) Adenophorus haalilioanus ATP synth... 116 4e-24
EF463524_1(EF463524|pid:none) Psammiosorus paucivenius ATP synth... 116 4e-24
AJ419676_1(AJ419676|pid:none) Columellia oblonga chloroplast par... 116 4e-24
EF463498_1(EF463498|pid:none) Loxogramme abyssinica ATP synthase... 116 4e-24
AY935861_1(AY935861|pid:none) Oxalis stricta isolate 39 ATP synt... 116 4e-24
AY459519_1(AY459519|pid:none) Pecluma alfredii voucher Kimnach 9... 116 4e-24
CP000679_1198(CP000679|pid:none) Caldicellulosiruptor saccharoly... 116 4e-24
AF469785_1(AF469785|pid:none) Terpsichore eggersii ATP synthase ... 116 4e-24
(B0T335) RecName: Full=ATP synthase subunit beta; EC=3.... 116 4e-24
AF035903_1(AF035903|pid:none) Cupaniopsis anacardioides ATP synt... 116 4e-24
AY459513_1(AY459513|pid:none) Terpsichore sp. Leon 3651 ATP synt... 116 4e-24
EF463383_1(EF463383|pid:none) Ctenitis sloanei ATP synthase beta... 116 4e-24
AY935850_1(AY935850|pid:none) Brunellia sp. Skinner et al. 43 AT... 116 4e-24
AY459476_1(AY459476|pid:none) Grammitis parva voucher Ranker 176... 116 4e-24
AF213789_1(AF213789|pid:none) Samolus repens ATP synthase beta s... 116 4e-24
GN102131_1(GN102131|pid:none) Sequence 6912 from Patent WO200903... 116 4e-24
(Q8RGE2) RecName: Full=ATP synthase subunit beta; EC=3.... 116 4e-24
AF469779_1(AF469779|pid:none) Adenophorus epigaeus ATP synthase ... 116 4e-24
EF463384_1(EF463384|pid:none) Ctenitis submarginalis ATP synthas... 116 4e-24
AB212686_1(AB212686|pid:none) Arthropteris backleri chloroplast ... 116 4e-24
AY459503_1(AY459503|pid:none) Terpsichore hanekeana voucher Rank... 116 4e-24
AY968428_1(AY968428|pid:none) Combretocarpus rotundatus ATP synt... 116 4e-24
AY459468_1(AY459468|pid:none) Enterosora percrassa voucher Morag... 116 4e-24
AF469773_1(AF469773|pid:none) Grammitis tenella ATP synthase bet... 116 4e-24
(A4QLK1) RecName: Full=ATP synthase subunit beta, chloroplastic;... 116 4e-24
AF213775_1(AF213775|pid:none) Androsace sp. Anderberg s.n. ATP s... 116 4e-24
AY459501_1(AY459501|pid:none) Terpsichore anfractuosa voucher A.... 116 4e-24
AF168929_1(AF168929|pid:none) Mayaca aubletii ATP synthase beta ... 116 4e-24
(Q8DLG8) RecName: Full=ATP synthase subunit beta; EC=3.... 116 4e-24
AY459509_1(AY459509|pid:none) Terpsichore semihirsuta voucher B.... 116 4e-24
EF463533_1(EF463533|pid:none) Macrothelypteris torresiana ATP sy... 116 4e-24
AB233705_1(AB233705|pid:none) Piriqueta cistoides chloroplast at... 116 4e-24
EF452017_1(EF452017|pid:none) Anetium citrifolium ATP synthase b... 116 4e-24
EF463503_1(EF463503|pid:none) Niphidium crassifolium ATP synthas... 116 4e-24
AY459504_1(AY459504|pid:none) Terpsichore lanigera voucher A. Ro... 116 4e-24
AY459488_1(AY459488|pid:none) Melpomene flabelliformis voucher P... 116 4e-24
AF469774_1(AF469774|pid:none) Adenophorus periens ATP synthase b... 116 4e-24
AJ235392_1(AJ235392|pid:none) Androsace spinulifera chloroplast ... 116 4e-24
EU717516_1(EU717516|pid:none) Lespedeza bicolor isolate 99 membr... 116 4e-24
AF469777_1(AF469777|pid:none) Adenophorus pinnatifidus ATP synth... 116 4e-24
AY459512_1(AY459512|pid:none) Terpsichore subtilis voucher M. Mo... 116 4e-24
EU717517_1(EU717517|pid:none) Lespedeza cuneata isolate 139 memb... 116 4e-24
AY459510_1(AY459510|pid:none) Terpsichore senilis voucher A. Roj... 116 4e-24
AJ419148_1(AJ419148|pid:none) Mayaca fluviatilis partial chlorop... 116 4e-24
DQ780975_1(DQ780975|pid:none) Cynosurus cristatus ATP synthase b... 116 4e-24
(A5E950) RecName: Full=ATP synthase subunit beta 1; EC=... 116 4e-24
(B7IG44) RecName: Full=ATP synthase subunit beta; EC=3.... 111 4e-24
DQ447209_1(DQ447209|pid:none) Candida glabrata mitochondrial F-A... 115 5e-24
EF463411_1(EF463411|pid:none) Elaphoglossum lingua ATP synthase ... 115 5e-24
CP001472_981(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 115 5e-24
(Q2JX57) RecName: Full=ATP synthase subunit beta; EC=3.... 115 5e-24
EF463502_1(EF463502|pid:none) Neocheiropteris palmatopedata ATP ... 115 5e-24
CP001341_2300(CP001341|pid:none) Arthrobacter chlorophenolicus A... 115 5e-24
AF209696_1(AF209696|pid:none) Viviania marifolia ATP synthase be... 115 5e-24
>(P54647) RecName: Full=V-type proton ATPase catalytic subunit A;
Short=V-ATPase subunit A; EC=3.6.3.14;
AltName: Full=Vacuolar proton pump subunit alpha;
AltName: Full=V-ATPase 69 kDa subunit;
&U49169_1(U49169|pid:none)
Length = 618
Score = 772 bits (1994), Expect(2) = 0.0
Identities = 383/383 (100%), Positives = 383/383 (100%)
Frame = +3
Query: 762 DSLFPCVQGGTCAIPGAFGCGKTVISQSLSKFSNSDAIVYVGCGERGNEMAEVLMEFPEL 941
DSLFPCVQGGTCAIPGAFGCGKTVISQSLSKFSNSDAIVYVGCGERGNEMAEVLMEFPEL
Sbjct: 236 DSLFPCVQGGTCAIPGAFGCGKTVISQSLSKFSNSDAIVYVGCGERGNEMAEVLMEFPEL 295
Query: 942 HTKVGDKEEPIMQRTCLVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRW 1121
HTKVGDKEEPIMQRTCLVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRW
Sbjct: 296 HTKVGDKEEPIMQRTCLVANTSNMPVAAREASIYTGITLAEYFRDMGLNVAMMADSTSRW 355
Query: 1122 AEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVSCIGHPTRIGSVTIVGAVSPPG 1301
AEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVSCIGHPTRIGSVTIVGAVSPPG
Sbjct: 356 AEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVSCIGHPTRIGSVTIVGAVSPPG 415
Query: 1302 GDFADPVTAATLGIVQVFWGLDKKLAQRKHFPSINWLISFSKYMQALDTHYDQMDPEFVP 1481
GDFADPVTAATLGIVQVFWGLDKKLAQRKHFPSINWLISFSKYMQALDTHYDQMDPEFVP
Sbjct: 416 GDFADPVTAATLGIVQVFWGLDKKLAQRKHFPSINWLISFSKYMQALDTHYDQMDPEFVP 475
Query: 1482 LRTRAKEILQMEEDLSEIVQLVGQDSLGESEKITIEVARIIRDDFLQQNGFSPYDKCCPF 1661
LRTRAKEILQMEEDLSEIVQLVGQDSLGESEKITIEVARIIRDDFLQQNGFSPYDKCCPF
Sbjct: 476 LRTRAKEILQMEEDLSEIVQLVGQDSLGESEKITIEVARIIRDDFLQQNGFSPYDKCCPF 535
Query: 1662 FKTVWMLKNMMTFYNLAQKAVESSTADNKVTWNQIKNELKEIIHRITSMKFQDPTDGEQT 1841
FKTVWMLKNMMTFYNLAQKAVESSTADNKVTWNQIKNELKEIIHRITSMKFQDPTDGEQT
Sbjct: 536 FKTVWMLKNMMTFYNLAQKAVESSTADNKVTWNQIKNELKEIIHRITSMKFQDPTDGEQT 595
Query: 1842 LTAHFSTLNEDIITAFRNFSDLV 1910
LTAHFSTLNEDIITAFRNFSDLV
Sbjct: 596 LTAHFSTLNEDIITAFRNFSDLV 618
Score = 474 bits (1219), Expect(2) = 0.0
Identities = 237/240 (98%), Positives = 237/240 (98%)
Frame = +2
Query: 56 MSKNSGLPSFASTEADNSQGFVLSVSGPVVIANQLAGAAMYELVRVGHNQLVGEIIRLEE 235
MSKNSGLPSFASTEADNSQGFVLSVSGPVVIANQLAGAAMYELVRVGHNQLVGEIIRLEE
Sbjct: 1 MSKNSGLPSFASTEADNSQGFVLSVSGPVVIANQLAGAAMYELVRVGHNQLVGEIIRLEE 60
Query: 236 DTATIQVYEETSGLTVGDPVLRTHKPLTVELGPGIMNNIFDGIQRPLNAIAEITKGIYIP 415
DTATIQVYEETSGLTVGDPVLRTHKPLTVELGPGIMNNIFDGIQRPLNAIAEITKGIYIP
Sbjct: 61 DTATIQVYEETSGLTVGDPVLRTHKPLTVELGPGIMNNIFDGIQRPLNAIAEITKGIYIP 120
Query: 416 RGINTPSLNRTIKWPYQPDTKLKVGDNVSGGDIFGQVVENNLIIHKIMVPPKEMGTIVEI 595
RGINTPSLNRTIKWPYQPDTKLKVGDNVSGGDIFGQVVENNLIIHKIMVPPKEMGTIVEI
Sbjct: 121 RGINTPSLNRTIKWPYQPDTKLKVGDNVSGGDIFGQVVENNLIIHKIMVPPKEMGTIVEI 180
Query: 596 APAGEYTLDHALLTIEFDGKRKQLTMVHNWPVRSARPVIEKLPCNYPLLTGQRVL*FTFP 775
APAGEYTLDHALLTIEFDGKRKQLTMVHNWPVRSARPVIEKLPCNYPLLTGQRVL FP
Sbjct: 181 APAGEYTLDHALLTIEFDGKRKQLTMVHNWPVRSARPVIEKLPCNYPLLTGQRVLDSLFP 240
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 3,337,731,343
Number of extensions: 70742522
Number of successful extensions: 207281
Number of sequences better than 10.0: 6324
Number of HSP's gapped: 194968
Number of HSP's successfully gapped: 6826
Length of query: 669
Length of database: 1,061,185,681
Length adjustment: 135
Effective length of query: 534
Effective length of database: 619,945,201
Effective search space: 331050737334
Effective search space used: 331050737334
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
3 |
| VH (FL, L) |
32 |
| VF (FL, S) |
23 |
| AH (FL, L) |
2 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
6 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
3 |
| CF (FL, S) |
2 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |