Contig-U16285-1 [Dicty_cDB - Dictyostelium discoideum cDNA Contig Overview]

Contig-U16285-1
Contig ID	Contig-U16285-1
Contig update	2004. 6.11
Contig sequence	>Contig-U16285-1 (Contig-U16285-1Q) /CSM_Contig/Contig-U16285-1Q.Seq.d AAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAGCAAACTGC GATAATTAACTTGAATTGCAGCCTACTGGGATAGTTGAAATGTTGAACGC ACATGATGACATCGGTCCTTTCGGATTAGGTGTTATACTTGGGTGAGAGT GGTCATTACATAGTTTTTATAAAAAAGGAAAAAAATGAGATTCATCTTAT TCTTTGTTTTAATGTTAACAGCCTTGGCTGCTGGTAGAAGATTATCAGTT GAGGAAAGTCAATTCATTGCCTTCCAAAATAAATATAATAAAATTTATTC AGCTGAAGAATATTTAGTTAAATTTGAAACCTTCAAATCAAATTTATTAA ATATTGATGCCTTAAACAAACAAGCCACCACCATTGGATCTGATACTAAA TTTGGTGTCAACAAATTTGCTGATCTCTCAAAAGAAGAATTCAAAAAATA TTACTTAAGCAGCAAAGAAGCCCGTTTAACTGATGACCTCCCAATGTTAC CAAACTTATCAGACGATATCATTTCAGCAACCCCAGCCGCTTTCGATTGG AGAAATACTGGTGGTTCAACTAAATTCCCACAAGGTACTCCAGGTTACCG CTGTTAAAAACCAAGGGTCAATGTGGTTCATGTTGGTCATTCTCTACCAC TGGTAACGTCGAAGGTCAACACTATTTATCAACTGGTACATTAGTTGGTC TCTCTGAACAAAATTTAGTCGATTGTGATCATACTTGTATGACCTACGAA AACGAAAATGTTTGCAATGCTGGTTGTGATGGTGGTCTCCAACCAAATGC CTACAACTACATCATCAAAAACGGAGGTATCCAAACCGAAGCTACCTATC CATACACTGCTGTTGATGGAGAATGTAAATTTAACTCTGCCCAAGTTGGT GCTAAAATTTCATCTTTCACTATGGTTCCACAAAATGAAACTCAAATTGC TTCCTACTTATTCAACAATGGTCCATTAGCTATTGCAGCTGATGCTGAAG AATGGCAATTCTATATGGGAGGTGTTTTCGATTTCCCATGTGGTCAAACT TTAGATCACGGTATCTTAATTGTTGGTTATGGTGCTCAAGATACCATCGT CGGTAAAAATACTCCATACTGGATCATTAAAAACTCATGGGGTGCCGATT GGGGTGAAGCTGGTTACTTAAAAGTTGAAAGAAATACTGATAAATGTGGT GTTGCCAATTTCGTTTCTTCATCAATTGTTGGTTCATCAAACTAAAAACA ATAAATAAAATTTTATTAAATTTTTAATTTTATTTTTTTATATAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAA
Gap	no gap
Contig length	1368
Chromosome number (1..6, M)	5
Chromosome length	5062330
Start point	5025262
End point	5024118
Strand (PLUS/MINUS)	MINUS
Number of clones	127
Number of EST	155
Link to clone list	U16285
List of clone(s)	est1=VFB115F,1,574 est2=VSF738F,86,193 est3=VFA692E,90,1271 est4=VFC390F,138,537 est5=VFC481F,138,495 est6=VFH765F,138,667 est7=VFL510E,138,1333 est8=VFL621E,138,1285 est9=VFC433F,139,493 est10=VFC318F,140,538 est11=VFL555F,146,682 est12=VFI156F,149,692 est13=VFN103F,149,494 est14=VFE201F,152,696 est15=VFJ645E,153,1279 est16=VFL486E,154,1308 est17=VFA158E,155,1245 est18=VFA543E,155,1243 est19=VFA561E,155,1279 est20=VFA579E,155,1244 est21=VFA880F,155,695 est22=VFB411E,155,1307 est23=VFB636F,155,659 est24=VFB791E,155,1290 est25=VFD317E,155,1294 est26=VFD806E,155,1299 est27=VFE190E,155,1299 est28=VFE439E,155,1333 est29=VFE770F,155,589 est30=VFE847E,155,1345 est31=VFG264F,155,600 est32=VFH270F,155,794 est33=VFH454F,155,717 est34=VFI436E,155,1312 est35=VFI675E,155,1299 est36=VFJ181E,155,1277 est37=VFJ449F,155,577 est38=VFK149E,155,1279 est39=VFK692E,155,1292 est40=VFL786E,155,1292 est41=VFM847E,155,1292 est42=VFO238F,155,375 est43=VFO433F,155,736 est44=VFO638E,155,1292 est45=VFO675E,155,1246 est46=VFO892E,155,1292 est47=VFJ218E,156,1281 est48=VFM117E,156,1301 est49=VFO273F,157,652 est50=VFB445E,158,1287 est51=VFD464E,158,1310 est52=VFF501E,158,1307 est53=VFF763E,158,1309 est54=VFG266E,158,1285 est55=VFG302F,158,788 est56=VFI486E,158,1345 est57=VFI586E,158,1286 est58=VFK701E,158,1293 est59=VFL771E,158,1299 est60=VFN261E,158,1284 est61=VFN663F,158,793 est62=VFO806E,158,1287 est63=VFF204E,160,1338 est64=VFG680E,160,1286 est65=VFI426F,160,688 est66=VFJ140E,160,1310 est67=VFJ824E,160,1289 est68=VFN529E,160,1199 est69=VFO290F,160,565 est70=VFK581E,161,1293 est71=VFL429F,161,833 est72=VFA313E,162,1262 est73=VFA891E,162,1244 est74=VFB410E,162,1294 est75=VFE285E,162,1295 est76=VFI443E,162,1282 est77=VFI748E,162,1293 est78=VHN634F,163,817 est79=VFF565E,165,1307 est80=VFM763E,166,1292 est81=VFC668E,169,1298 est82=VFC735E,169,1333 est83=VFF171E,169,1290 est84=VFK826E,169,1275 est85=VFD657F,170,795 est86=SSJ549F,172,821 est87=VSG875F,173,736 est88=SLE446E,174,1300 est89=VFG234E,175,1293 est90=VFM871F,175,691 est91=SLB555F,179,649 est92=VFK896F,195,514 est93=VFL170F,200,618 est94=FC-AH21E,238,1341 est95=VFK596F,321,661 est96=SSL246F,427,785 est97=CFI804Z,542,1288 est98=VHM173Z,560,1257 est99=VFB115Z,566,1269 est100=VFO290Z,571,1268 est101=VFG264Z,576,1294 est102=VFJ449Z,580,1309 est103=CFI404Z,617,972 est104=VFL170Z,622,1298 est105=SSI721Z,623,1304 est106=FC-BO12Z,624,1346 est107=VFK896Z,631,1293 est108=SSM624Z,634,1285 est109=SLA140Z,658,1298 est110=FC-BF05Z,663,1341 est111=VFA737Z,669,1307 est112=VFH765Z,669,1310 est113=VFI426Z,669,1279 est114=VFN103Z,669,1288 est115=VFE201Z,672,1308 est116=VFL268Z,673,1206 est117=VFI374Z,675,1205 est118=VFH454Z,691,1327 est119=FC-BB17Z,710,1296 est120=VFO273Z,719,1306 est121=SSL610E,724,1303 est122=VFC390Z,731,1273 est123=VFM871Z,733,1276 est124=VFC318Z,735,1295 est125=SLF133Z,741,1309 est126=VFM647Z,747,1195 est127=FC-BE09Z,753,1283 est128=SLI841Z,760,1316 est129=VFN663Z,760,1264 est130=VFL555Z,768,1277 est131=VFO238Z,771,1307 est132=VFG302Z,788,1296 est133=SLB847Z,810,1302 est134=FC-AZ06Z,813,1341 est135=SSD694Z,820,1314 est136=VFH270Z,825,1282 est137=VSB747Z,833,1347 est138=VFC481Z,858,1273 est139=SLA318E,860,1285 est140=VFO809Z,869,983 est141=VFK596Z,874,1071 est142=VFE149Z,882,1236 est143=SSJ549Z,886,1311 est144=VFC433Z,940,1327 est145=FC-BS05Z,954,1293 est146=VSH323F,958,1322 est147=VSH323Z,958,1309 est148=VSG861F,959,1323 est149=VFD657Z,1005,1308 est150=VFB636Z,1006,1294 est151=VSA863E,1042,1304 est152=VSB604Z,1048,1368 est153=VFE770Z,1065,1319 est154=VFF404Z,1138,1318 est155=VFB132Z,1196,1308
Translated Amino Acid sequence	kriprllnrrpqtaiinlncsllglkcthmmtsvlsdvlylgesghyivfikke kneihlilcfnvnslgcwkiisgksihclpkinlfsrifsinlqikfikyc lkqtshhhwiyiwcqqicslkrriqkillkqqrspfn*ppnvtklirryhfsnpsr frlekywwfnIPTRYSRLPLLKTKGQCGSCWSFSTTGNVEGQHYLSTGTLVGLSEQNLV DCDHTCMTYENENVCNAGCDGGLQPNAYNYIIKNGGIQTEATYPYTAVDGECKFNSAQVG AKISSFTMVPQNETQIASYLFNNGPLAIAADAEEWQFYMGGVFDFPCGQTLDHGILIVGY GAQDTIVGKNTPYWIIKNSWGADWGEAGYLKVERNTDKCGVANFVSSSIVGSSNkqik fy*ifnfiflykkkkkkkkkkkkkkkkkkkkkkkkk
Translated Amino Acid sequence (All Frames)	Frame A: kriprllnrrpqtaiinlncsllglkcthmmtsvlsdvlylgesghyivfikke kneihlilcfnvnslgcwkiisgksihclpkinlfsrifsinlqikfikyc lkqtshhhwiyiwcqqicslkrriqkillkqqrspfn*ppnvtklirryhfsnpsr frlekywwfnIPTRYSRLPLLKTKGQCGSCWSFSTTGNVEGQHYLSTGTLVGLSEQNLV DCDHTCMTYENENVCNAGCDGGLQPNAYNYIIKNGGIQTEATYPYTAVDGECKFNSAQVG AKISSFTMVPQNETQIASYLFNNGPLAIAADAEEWQFYMGGVFDFPCGQTLDHGILIVGY GAQDTIVGKNTPYWIIKNSWGADWGEAGYLKVERNTDKCGVANFVSSSIVGSSNkqik fyifnfiflykkkkkkkkkkkkkkkkkkkkkkkkk Frame B: ngeyldsidedrsklrltiaaywdsnverthrsfrircytwvrvvitflkrk kmrfilffvlmltalaagrrlsveesqfiafqnkynkiysaeeylvkfetfksnllnida lnkqattigsdtkfgvnkfadlskeefkkyylsskearltddlpmlpnlsddiisatpaa fdwrntggstkfpqgtpgyrckprvnvvhvghslplvtskvntiyqlvhlvslnkis iviilvptktkmfamlvvmvvsnqmptttssktevskpklpihtlllmenvnltlpklv lkfhlslwfhkmklkllptystmvhllqlmlkngnsiwevfsishvvklitvsllvm vlkipssvkilhtgslkthgvpigvklvtklkeilinvvlpisflhqllvhqtknnkn fikflilffyikkkkkkkkkkkkkkkkkkkkkkkk Frame C: tvntstpksmktvancdnlelqptgivemlnahddigpfglgvilgewslhsfykkgk kdssyslfcqpwllvedyqlrkvnslpskiniikfiqlknilnlkpsnqiyilmp tnkpppldlilnlvstnllisqkknsknitaakkpvlmtsqcyqtyqtisfqqpqpl sigeilvvqlnshkvlqvtavknqgsmwfmlvilyhwrrrstlfinwyiswsltkfsr lsylydlrkrkclqcwlwwsptkclqlhhqkrrypnrsylsihccwrmilcpswc nfifhygstknsncflliqqwsisycscrmailygrcfrfpmwsnfrsrylncwlw csryhrrkysildhklmgcrlgswllkskkymwccqfrffincwfiklktinki llnffyffi*kkkkkkkkkkkkkkkkkkkkkkkk
own update	2004. 6.23
Homology vs CSM-cDNA	Query= Contig-U16285-1 (Contig-U16285-1Q) /CSM_Contig/Contig-U16285-1Q.Seq.d (1368 letters) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U16285-1 (Contig-U16285-1Q) /CSM_Contig/Conti... 2196 0.0 Contig-U16445-1 (Contig-U16445-1Q) /CSM_Contig/Conti... 313 4e-85 Contig-U12091-1 (Contig-U12091-1Q) /CSM_Contig/Conti... 305 1e-82 Contig-U16419-1 (Contig-U16419-1Q) /CSM_Contig/Conti... 303 4e-82 Contig-U16256-1 (Contig-U16256-1Q) /CSM_Contig/Conti... 303 4e-82 Contig-U15579-1 (Contig-U15579-1Q) /CSM_Contig/Conti... 303 4e-82 Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Conti... 303 4e-82 Contig-U15306-1 (Contig-U15306-1Q) /CSM_Contig/Conti... 303 4e-82 Contig-U11413-1 (Contig-U11413-1Q) /CSM_Contig/Conti... 303 4e-82 Contig-U11252-1 (Contig-U11252-1Q) /CSM_Contig/Conti... 303 4e-82 >Contig-U16285-1 (Contig-U16285-1Q) /CSM_Contig/Contig-U16285-1Q.Seq.d Length = 1368 Score = 2196 bits (1108), Expect = 0.0 Identities = 1108/1108 (100%) Strand = Plus / Plus Query: 186 tgagattcatcttattctttgttttaatgttaacagccttggctgctggtagaagattat 245 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 186 tgagattcatcttattctttgttttaatgttaacagccttggctgctggtagaagattat 245 Query: 246 cagttgaggaaagtcaattcattgccttccaaaataaatataataaaatttattcagctg 305 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 246 cagttgaggaaagtcaattcattgccttccaaaataaatataataaaatttattcagctg 305 Query: 306 aagaatatttagttaaatttgaaaccttcaaatcaaatttattaaatattgatgccttaa 365 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 306 aagaatatttagttaaatttgaaaccttcaaatcaaatttattaaatattgatgccttaa 365 Query: 366 acaaacaagccaccaccattggatctgatactaaatttggtgtcaacaaatttgctgatc 425 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 366 acaaacaagccaccaccattggatctgatactaaatttggtgtcaacaaatttgctgatc 425 Query: 426 tctcaaaagaagaattcaaaaaatattacttaagcagcaaagaagcccgtttaactgatg 485 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 426 tctcaaaagaagaattcaaaaaatattacttaagcagcaaagaagcccgtttaactgatg 485 Query: 486 acctcccaatgttaccaaacttatcagacgatatcatttcagcaaccccagccgctttcg 545 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 486 acctcccaatgttaccaaacttatcagacgatatcatttcagcaaccccagccgctttcg 545 Query: 546 attggagaaatactggtggttcaactaaattcccacaaggtactccaggttaccgctgtt 605 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 546 attggagaaatactggtggttcaactaaattcccacaaggtactccaggttaccgctgtt 605 Query: 606 aaaaaccaagggtcaatgtggttcatgttggtcattctctaccactggtaacgtcgaagg 665 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 606 aaaaaccaagggtcaatgtggttcatgttggtcattctctaccactggtaacgtcgaagg 665 Query: 666 tcaacactatttatcaactggtacattagttggtctctctgaacaaaatttagtcgattg 725 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 666 tcaacactatttatcaactggtacattagttggtctctctgaacaaaatttagtcgattg 725 Query: 726 tgatcatacttgtatgacctacgaaaacgaaaatgtttgcaatgctggttgtgatggtgg 785 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 726 tgatcatacttgtatgacctacgaaaacgaaaatgtttgcaatgctggttgtgatggtgg 785 Query: 786 tctccaaccaaatgcctacaactacatcatcaaaaacggaggtatccaaaccgaagctac 845 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 786 tctccaaccaaatgcctacaactacatcatcaaaaacggaggtatccaaaccgaagctac 845 Query: 846 ctatccatacactgctgttgatggagaatgtaaatttaactctgcccaagttggtgctaa 905 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 846 ctatccatacactgctgttgatggagaatgtaaatttaactctgcccaagttggtgctaa 905 Query: 906 aatttcatctttcactatggttccacaaaatgaaactcaaattgcttcctacttattcaa 965 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 906 aatttcatctttcactatggttccacaaaatgaaactcaaattgcttcctacttattcaa 965 Query: 966 caatggtccattagctattgcagctgatgctgaagaatggcaattctatatgggaggtgt 1025 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 966 caatggtccattagctattgcagctgatgctgaagaatggcaattctatatgggaggtgt 1025 Query: 1026 tttcgatttcccatgtggtcaaactttagatcacggtatcttaattgttggttatggtgc 1085 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 1026 tttcgatttcccatgtggtcaaactttagatcacggtatcttaattgttggttatggtgc 1085 Query: 1086 tcaagataccatcgtcggtaaaaatactccatactggatcattaaaaactcatggggtgc 1145 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 1086 tcaagataccatcgtcggtaaaaatactccatactggatcattaaaaactcatggggtgc 1145 Query: 1146 cgattggggtgaagctggttacttaaaagttgaaagaaatactgataaatgtggtgttgc 1205 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 1146 cgattggggtgaagctggttacttaaaagttgaaagaaatactgataaatgtggtgttgc 1205 Query: 1206 caatttcgtttcttcatcaattgttggttcatcaaactaaaaacaataaataaaatttta 1265 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 1206 caatttcgtttcttcatcaattgttggttcatcaaactaaaaacaataaataaaatttta 1265 Query: 1266 ttaaatttttaattttatttttttatat 1293 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 1266 ttaaatttttaattttatttttttatat 1293 Score = 337 bits (170), Expect = 3e-92 Identities = 170/170 (100%) Strand = Plus / Plus Query: 1 aaacggtgaatacctcgactcctaaatcgatgaagaccgtagcaaactgcgataattaac 60 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 1 aaacggtgaatacctcgactcctaaatcgatgaagaccgtagcaaactgcgataattaac 60 Query: 61 ttgaattgcagcctactgggatagttgaaatgttgaacgcacatgatgacatcggtcctt 120 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 61 ttgaattgcagcctactgggatagttgaaatgttgaacgcacatgatgacatcggtcctt 120 Query: 121 tcggattaggtgttatacttgggtgagagtggtcattacatagtttttat 170 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 121 tcggattaggtgttatacttgggtgagagtggtcattacatagtttttat 170 >Contig-U16445-1 (Contig-U16445-1Q) /CSM_Contig/Contig-U16445-1Q.Seq.d Length = 1347 Score = 313 bits (158), Expect = 4e-85 Identities = 161/162 (99%) Strand = Plus / Plus Query: 1 aaacggtgaatacctcgactcctaaatcgatgaagaccgtagcaaactgcgataattaac 60 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\| Sbjct: 21 aaacggtgaatacctcgactcctaaatcgatgaagaccgtagcaaactgcgataattcac 80 Query: 61 ttgaattgcagcctactgggatagttgaaatgttgaacgcacatgatgacatcggtcctt 120 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 81 ttgaattgcagcctactgggatagttgaaatgttgaacgcacatgatgacatcggtcctt 140 Query: 121 tcggattaggtgttatacttgggtgagagtggtcattacata 162 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 141 tcggattaggtgttatacttgggtgagagtggtcattacata 182 >Contig-U12091-1 (Contig-U12091-1Q) /CSM_Contig/Contig-U12091-1Q.Seq.d Length = 1546 Score = 305 bits (154), Expect = 1e-82 Identities = 157/158 (99%) Strand = Plus / Plus Query: 1 aaacggtgaatacctcgactcctaaatcgatgaagaccgtagcaaactgcgataattaac 60 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| \|\| Sbjct: 163 aaacggtgaatacctcgactcctaaatcgatgaagaccgtagcaaactgcgataattcac 222 Query: 61 ttgaattgcagcctactgggatagttgaaatgttgaacgcacatgatgacatcggtcctt 120 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 223 ttgaattgcagcctactgggatagttgaaatgttgaacgcacatgatgacatcggtcctt 282 Query: 121 tcggattaggtgttatacttgggtgagagtggtcatta 158 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 283 tcggattaggtgttatacttgggtgagagtggtcatta 320 Database: CSM Posted date: Jun 21, 2004 1:35 PM Number of letters in database: 8,075,542 Number of sequences in database: 8402 Lambda K H 1.37 0.711 1.31 Gapped Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Gap Penalties: Existence: 5, Extension: 2 Number of Hits to DB: 33,612 Number of Sequences: 8402 Number of extensions: 33612 Number of successful extensions: 6167 Number of sequences better than 10.0: 1238 length of query: 1368 length of database: 8,075,542 effective HSP length: 16 effective length of query: 1352 effective length of database: 7,941,110 effective search space: 10736380720 effective search space used: 10736380720 T: 0 A: 40 X1: 6 (11.9 bits) X2: 15 (29.7 bits) S1: 12 (24.3 bits) S2: 15 (30.2 bits)
dna update	2009. 3.24
Homology vs DNA	Query= Contig-U16285-1 (Contig-U16285-1Q) /CSM_Contig/Contig-U16285-1Q.Seq.d (1368 letters) Database: ddbj_B 98,226,423 sequences; 98,766,808,389 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value N (BJ430364) Dictyostelium discoideum cDNA clone:ddv7b05, 3' e... 1403 0.0 2 (BJ375269) Dictyostelium discoideum cDNA clone:ddc18h02, 3' ... 1390 0.0 1 (BJ431097) Dictyostelium discoideum cDNA clone:ddv9i22, 3' e... 1346 0.0 1 (BJ428638) Dictyostelium discoideum cDNA clone:ddv12n15, 3' ... 1346 0.0 1 (BJ435591) Dictyostelium discoideum cDNA clone:ddv27i16, 3' ... 1344 0.0 1 (BJ432474) Dictyostelium discoideum cDNA clone:ddv18e20, 3' ... 1336 0.0 1 (BJ430975) Dictyostelium discoideum cDNA clone:ddv9n10, 3' e... 1330 0.0 1 (BJ432505) Dictyostelium discoideum cDNA clone:ddv18k21, 3' ... 1287 0.0 2 (BJ431068) Dictyostelium discoideum cDNA clone:ddv9c23, 3' e... 1287 0.0 2 (BJ430246) Dictyostelium discoideum cDNA clone:ddv6g18, 3' e... 1287 0.0 2 (BJ428365) Dictyostelium discoideum cDNA clone:ddv11m17, 3' ... 1279 0.0 2 (BJ431216) Dictyostelium discoideum cDNA clone:ddv13c10, 3' ... 1267 0.0 1 (BJ432691) Dictyostelium discoideum cDNA clone:ddv19o09, 3' ... 1265 0.0 1 (BJ429316) Dictyostelium discoideum cDNA clone:ddv3f04, 3' e... 1259 0.0 1 (BJ436322) Dictyostelium discoideum cDNA clone:ddv30e20, 3' ... 1247 0.0 2 (BJ435214) Dictyostelium discoideum cDNA clone:ddv26n12, 3' ... 1243 0.0 1 (BJ434107) Dictyostelium discoideum cDNA clone:ddv23l22, 3' ... 1243 0.0 3 (BJ433564) Dictyostelium discoideum cDNA clone:ddv22d08, 3' ... 1243 0.0 1 (BJ432705) Dictyostelium discoideum cDNA clone:ddv19b14, 3' ... 1243 0.0 3 (BJ431308) Dictyostelium discoideum cDNA clone:ddv13o16, 3' ... 1243 0.0 3 (BJ431264) Dictyostelium discoideum cDNA clone:ddv13c18, 3' ... 1243 0.0 3 (BJ430560) Dictyostelium discoideum cDNA clone:ddv7p16, 3' e... 1243 0.0 3 (BJ428581) Dictyostelium discoideum cDNA clone:ddv12a17, 3' ... 1243 0.0 2 (BJ428447) Dictyostelium discoideum cDNA clone:ddv12a01, 3' ... 1241 0.0 1 (BJ434792) Dictyostelium discoideum cDNA clone:ddv25a05, 3' ... 1239 0.0 1 (C22775) Dictyostelium discoideum gamete cDNA, clone FC-AH21. 1235 0.0 3 (BJ432550) Dictyostelium discoideum cDNA clone:ddv19c06, 3' ... 1235 0.0 3 (BJ436152) Dictyostelium discoideum cDNA clone:ddv30l02, 3' ... 1233 0.0 1 (BJ430653) Dictyostelium discoideum cDNA clone:ddv8l02, 3' e... 1233 0.0 1 (AU284884) Dictyostelium discoideum gamete cDNA clone:FC-BO1... 1223 0.0 1 (BJ431640) Dictyostelium discoideum cDNA clone:ddv14o20, 3' ... 1223 0.0 1 (BJ434693) Dictyostelium discoideum cDNA clone:ddv24n17, 3' ... 1219 0.0 1 (C90558) Dictyostelium discoideum slug cDNA, clone SSI721. 1217 0.0 1 (BJ436337) Dictyostelium discoideum cDNA clone:ddv30h24, 3' ... 1217 0.0 3 (BJ436209) Dictyostelium discoideum cDNA clone:ddv30k10, 3' ... 1217 0.0 3 (BJ436070) Dictyostelium discoideum cDNA clone:ddv29c24, 3' ... 1217 0.0 3 (BJ432009) Dictyostelium discoideum cDNA clone:ddv17f12, 3' ... 1217 0.0 3 (BJ429768) Dictyostelium discoideum cDNA clone:ddv4f23, 3' e... 1217 0.0 3 (BJ429176) Dictyostelium discoideum cDNA clone:ddv2i15, 3' e... 1213 0.0 2 (C93323) Dictyostelium discoideum slug cDNA, clone SSM624. 1203 0.0 1 (BJ433800) Dictyostelium discoideum cDNA clone:ddv22p24, 3' ... 1199 0.0 1 (BJ432764) Dictyostelium discoideum cDNA clone:ddv19a21, 3' ... 1189 0.0 1 (AU034984) Dictyostelium discoideum slug cDNA, clone SLE446. 1174 0.0 1 (BJ428011) Dictyostelium discoideum cDNA clone:ddv10n12, 3' ... 1158 0.0 1 (AU052161) Dictyostelium discoideum slug cDNA, clone SLA140. 1156 0.0 1 (BJ432963) Dictyostelium discoideum cDNA clone:ddv20i12, 3' ... 1156 0.0 3 (BJ429344) Dictyostelium discoideum cDNA clone:ddv3m03, 3' e... 1156 0.0 3 (BJ434017) Dictyostelium discoideum cDNA clone:ddv23k17, 3' ... 1152 0.0 2 (BJ433751) Dictyostelium discoideum cDNA clone:ddv22g24, 3' ... 1152 0.0 2 (BJ433716) Dictyostelium discoideum cDNA clone:ddv22a21, 3' ... 1152 0.0 2 (BJ432361) Dictyostelium discoideum cDNA clone:ddv18p11, 3' ... 1152 0.0 2 (BJ432016) Dictyostelium discoideum cDNA clone:ddv17h10, 3' ... 1148 0.0 2 (AU284620) Dictyostelium discoideum gamete cDNA clone:FC-BF0... 1146 0.0 1 (BJ428196) Dictyostelium discoideum cDNA clone:ddv11g02, 3' ... 1146 0.0 1 (BJ435408) Dictyostelium discoideum cDNA clone:ddv27e01, 3' ... 1144 0.0 1 (BJ433470) Dictyostelium discoideum cDNA clone:ddv22b01, 3' ... 1144 0.0 2 (BJ432172) Dictyostelium discoideum cDNA clone:ddv17l22, 3' ... 1142 0.0 1 (BJ430168) Dictyostelium discoideum cDNA clone:ddv6f09, 3' e... 1130 0.0 1 (BJ429103) Dictyostelium discoideum cDNA clone:ddv2j09, 3' e... 1126 0.0 1 (BJ428754) Dictyostelium discoideum cDNA clone:ddv1j03, 3' e... 1126 0.0 2 (BJ435784) Dictyostelium discoideum cDNA clone:ddv28i07, 3' ... 1122 0.0 1 (BJ429080) Dictyostelium discoideum cDNA clone:ddv2e11, 3' e... 1116 0.0 4 (BJ432913) Dictyostelium discoideum cDNA clone:ddv20p06, 3' ... 1112 0.0 4 (BJ428864) Dictyostelium discoideum cDNA clone:ddv1c15, 3' e... 1112 0.0 2 (BJ435291) Dictyostelium discoideum cDNA clone:ddv26n15, 3' ... 1110 0.0 4 (BJ431808) Dictyostelium discoideum cDNA clone:ddv15l14, 3' ... 1110 0.0 1 (BJ444238) Dictyostelium discoideum cDNA clone:ddv55a19, 3' ... 1104 0.0 4 (BJ429407) Dictyostelium discoideum cDNA clone:ddv3j12, 3' e... 1098 0.0 2 (BJ430832) Dictyostelium discoideum cDNA clone:ddv9a02, 3' e... 1082 0.0 2 (BJ429248) Dictyostelium discoideum cDNA clone:ddv2g24, 3' e... 1080 0.0 3 (BJ429243) Dictyostelium discoideum cDNA clone:ddv2f24, 3' e... 1066 0.0 3 (BJ431994) Dictyostelium discoideum cDNA clone:ddv17d08, 3' ... 1019 0.0 2 (BJ434487) Dictyostelium discoideum cDNA clone:ddv24c03, 3' ... 827 0.0 2 (BJ417753) Dictyostelium discoideum cDNA clone:ddv28m16, 5' ... 809 0.0 3 (BJ416873) Dictyostelium discoideum cDNA clone:ddv27i16, 5' ... 809 0.0 3 (BJ416083) Dictyostelium discoideum cDNA clone:ddv24l21, 5' ... 809 0.0 4 (BJ416041) Dictyostelium discoideum cDNA clone:ddv24n17, 5' ... 809 0.0 3 (BJ415902) Dictyostelium discoideum cDNA clone:ddv24i06, 5' ... 809 0.0 4 (BJ415873) Dictyostelium discoideum cDNA clone:ddv24c03, 5' ... 809 0.0 4 (BJ415837) Dictyostelium discoideum cDNA clone:ddv23l22, 5' ... 809 0.0 4 (BJ415685) Dictyostelium discoideum cDNA clone:ddv23j08, 5' ... 809 0.0 3 (BJ415516) Dictyostelium discoideum cDNA clone:ddv22g24, 5' ... 809 0.0 4 (BJ415485) Dictyostelium discoideum cDNA clone:ddv22a21, 5' ... 809 0.0 3 (BJ415347) Dictyostelium discoideum cDNA clone:ddv22d08, 5' ... 809 0.0 3 (BJ415116) Dictyostelium discoideum cDNA clone:ddv21a13, 5' ... 809 0.0 4 (BJ414520) Dictyostelium discoideum cDNA clone:ddv19o09, 5' ... 809 0.0 3 (BJ414354) Dictyostelium discoideum cDNA clone:ddv18k21, 5' ... 809 0.0 3 (BJ413902) Dictyostelium discoideum cDNA clone:ddv17h10, 5' ... 809 0.0 4 (BJ413894) Dictyostelium discoideum cDNA clone:ddv17f12, 5' ... 809 0.0 3 (BJ413458) Dictyostelium discoideum cDNA clone:ddv15k18, 5' ... 809 0.0 4 (BJ413285) Dictyostelium discoideum cDNA clone:ddv14o20, 5' ... 809 0.0 3 (BJ412943) Dictyostelium discoideum cDNA clone:ddv13c18, 5' ... 809 0.0 3 (BJ412832) Dictyostelium discoideum cDNA clone:ddv13d01, 5' ... 809 0.0 3 (BJ412760) Dictyostelium discoideum cDNA clone:ddv9c23, 5' e... 809 0.0 4 (BJ412670) Dictyostelium discoideum cDNA clone:ddv9n10, 5' e... 809 0.0 4 (BJ412444) Dictyostelium discoideum cDNA clone:ddv8a16, 5' e... 809 0.0 3 (BJ412368) Dictyostelium discoideum cDNA clone:ddv8l02, 5' e... 809 0.0 4 (BJ412286) Dictyostelium discoideum cDNA clone:ddv7p16, 5' e... 809 0.0 3 (BJ412112) Dictyostelium discoideum cDNA clone:ddv7b05, 5' e... 809 0.0 4 (BJ411992) Dictyostelium discoideum cDNA clone:ddv6g18, 5' e... 809 0.0 3 (BJ411918) Dictyostelium discoideum cDNA clone:ddv6f09, 5' e... 809 0.0 3 (BJ410424) Dictyostelium discoideum cDNA clone:ddv12a17, 5' ... 809 0.0 3 (BJ410296) Dictyostelium discoideum cDNA clone:ddv12a01, 5' ... 809 0.0 3 (BJ410218) Dictyostelium discoideum cDNA clone:ddv11m17, 5' ... 809 0.0 3 (BJ410063) Dictyostelium discoideum cDNA clone:ddv11g02, 5' ... 809 0.0 4 (AU061496) Dictyostelium discoideum slug cDNA, clone SLE446. 803 0.0 3 (BJ414770) Dictyostelium discoideum cDNA clone:ddv20i12, 5' ... 803 0.0 4 (BJ414587) Dictyostelium discoideum cDNA clone:ddv19a21, 5' ... 803 0.0 3 (BJ414393) Dictyostelium discoideum cDNA clone:ddv19c06, 5' ... 803 0.0 3 (BJ411052) Dictyostelium discoideum cDNA clone:ddv2f24, 5' e... 803 0.0 3 (BJ410908) Dictyostelium discoideum cDNA clone:ddv2e11, 5' e... 803 0.0 4 (BJ410696) Dictyostelium discoideum cDNA clone:ddv1c15, 5' e... 803 0.0 5 (BJ434520) Dictyostelium discoideum cDNA clone:ddv24i06, 3' ... 801 0.0 3 (BJ416520) Dictyostelium discoideum cDNA clone:ddv26n15, 5' ... 801 0.0 3 (BJ412788) Dictyostelium discoideum cDNA clone:ddv9i22, 5' e... 801 0.0 3 (BJ410474) Dictyostelium discoideum cDNA clone:ddv12n15, 5' ... 801 0.0 3 (BJ426214) Dictyostelium discoideum cDNA clone:ddv58c10, 5' ... 741 0.0 4 (BJ429310) Dictyostelium discoideum cDNA clone:ddv3d04, 3' e... 670 0.0 3 (BJ411076) Dictyostelium discoideum cDNA clone:ddv2m19, 5' e... 660 0.0 5 (BJ410588) Dictyostelium discoideum cDNA clone:ddv1j03, 5' e... 660 0.0 4 (BJ414723) Dictyostelium discoideum cDNA clone:ddv20p06, 5' ... 593 0.0 4 (BJ415256) Dictyostelium discoideum cDNA clone:ddv22b01, 5' ... 519 0.0 4 (BJ411116) Dictyostelium discoideum cDNA clone:ddv3f04, 5' e... 803 0.0 4 (BJ411110) Dictyostelium discoideum cDNA clone:ddv3d04, 5' e... 809 0.0 3 (BJ411144) Dictyostelium discoideum cDNA clone:ddv3m03, 5' e... 765 0.0 2 (BJ411057) Dictyostelium discoideum cDNA clone:ddv2g24, 5' e... 809 0.0 4 (BJ434311) Dictyostelium discoideum cDNA clone:ddv16b17, 3' ... 801 0.0 5 (BJ409895) Dictyostelium discoideum cDNA clone:ddv10n12, 5' ... 801 0.0 4 (BJ410989) Dictyostelium discoideum cDNA clone:ddv2i15, 5' e... 809 0.0 3 (BJ416109) Dictyostelium discoideum cDNA clone:ddv25a05, 5' ... 795 0.0 3 (BJ429274) Dictyostelium discoideum cDNA clone:ddv2m19, 3' e... 1013 0.0 2 (BJ436059) Dictyostelium discoideum cDNA clone:ddv29a20, 3' ... 1057 0.0 1 (AU284535) Dictyostelium discoideum gamete cDNA clone:FC-BB1... 1053 0.0 1 (BJ417050) Dictyostelium discoideum cDNA clone:ddv29b10, 5' ... 809 0.0 4 (BJ434763) Dictyostelium discoideum cDNA clone:ddv24l21, 3' ... 1043 0.0 1 (BJ433998) Dictyostelium discoideum cDNA clone:ddv23g18, 3' ... 1037 0.0 1 (AU266889) Dictyostelium discoideum vegetative cDNA clone:VS... 809 0.0 3 (BJ430022) Dictyostelium discoideum cDNA clone:ddv5d23, 3' e... 1033 0.0 1 (BJ414053) Dictyostelium discoideum cDNA clone:ddv17l22, 5' ... 809 0.0 3 (BJ417660) Dictyostelium discoideum cDNA clone:ddv28i07, 5' ... 809 0.0 3 (BJ429834) Dictyostelium discoideum cDNA clone:ddv5d05, 3' e... 1025 0.0 1 (BJ413460) Dictyostelium discoideum cDNA clone:ddv15l14, 5' ... 809 0.0 4 (AU052807) Dictyostelium discoideum slug cDNA, clone SLF133. 991 0.0 1 (BJ411192) Dictyostelium discoideum cDNA clone:ddv3j12, 5' e... 803 0.0 3 (BJ433332) Dictyostelium discoideum cDNA clone:ddv21a13, 3' ... 912 0.0 2 (BJ432138) Dictyostelium discoideum cDNA clone:ddv17d19, 3' ... 977 0.0 1 (BJ414330) Dictyostelium discoideum cDNA clone:ddv18e20, 5' ... 809 0.0 4 (BJ412542) Dictyostelium discoideum cDNA clone:ddv9a02, 5' e... 809 0.0 4 (BJ413997) Dictyostelium discoideum cDNA clone:ddv17o13, 5' ... 809 0.0 4 (AU053527) Dictyostelium discoideum slug cDNA, clone SLI841. 955 0.0 1 (BJ417373) Dictyostelium discoideum cDNA clone:ddv30k10, 5' ... 809 0.0 4 (BJ416441) Dictyostelium discoideum cDNA clone:ddv26n12, 5' ... 831 0.0 3 (BJ435853) Dictyostelium discoideum cDNA clone:ddv28m16, 3' ... 940 0.0 2 (BJ411090) Dictyostelium discoideum cDNA clone:ddv2p20, 5' e... 795 0.0 4 (BJ417509) Dictyostelium discoideum cDNA clone:ddv30h24, 5' ... 809 0.0 4 (AU284596) Dictyostelium discoideum gamete cDNA clone:FC-BE0... 952 0.0 1 (BJ414230) Dictyostelium discoideum cDNA clone:ddv18p11, 5' ... 809 0.0 3 (BJ413882) Dictyostelium discoideum cDNA clone:ddv17d08, 5' ... 809 0.0 3 (BJ412893) Dictyostelium discoideum cDNA clone:ddv13c10, 5' ... 809 0.0 3 (BJ416523) Dictyostelium discoideum cDNA clone:ddv26n18, 5' ... 823 0.0 2 (BJ431148) Dictyostelium discoideum cDNA clone:ddv13d01, 3' ... 914 0.0 1 (BJ411535) Dictyostelium discoideum cDNA clone:ddv4f23, 5' e... 809 0.0 4 (BJ411416) Dictyostelium discoideum cDNA clone:ddv4g10, 5' e... 809 0.0 4 (BJ435293) Dictyostelium discoideum cDNA clone:ddv26n18, 3' ... 896 0.0 1 (C93688) Dictyostelium discoideum slug cDNA, clone SSL610. 603 0.0 6 (BJ413647) Dictyostelium discoideum cDNA clone:ddv16b17, 5' ... 801 0.0 4 (BJ417302) Dictyostelium discoideum cDNA clone:ddv30l02, 5' ... 809 0.0 3 (BJ417492) Dictyostelium discoideum cDNA clone:ddv30e20, 5' ... 809 0.0 4 (BJ435997) Dictyostelium discoideum cDNA clone:ddv29k10, 3' ... 775 0.0 2 (BJ417174) Dictyostelium discoideum cDNA clone:ddv29a20, 5' ... 809 0.0 4 (AU060806) Dictyostelium discoideum slug cDNA, clone SLB555. 793 0.0 3 (AU034046) Dictyostelium discoideum slug cDNA, clone SLB847. 862 0.0 1 (BJ416035) Dictyostelium discoideum cDNA clone:ddv24m13, 5' ... 795 0.0 3 (BJ431806) Dictyostelium discoideum cDNA clone:ddv15k18, 3' ... 850 0.0 1 (AU284488) Dictyostelium discoideum gamete cDNA clone:FC-AZ0... 848 0.0 1 (AU037487) Dictyostelium discoideum slug cDNA, clone SSD694. 837 0.0 1 (AU262219) Dictyostelium discoideum vegetative cDNA clone:VS... 835 0.0 1 (BJ412981) Dictyostelium discoideum cDNA clone:ddv13o16, 5' ... 809 0.0 2 (BJ434686) Dictyostelium discoideum cDNA clone:ddv24m13, 3' ... 809 0.0 1 (BJ409948) Dictyostelium discoideum cDNA clone:ddv10l17, 5' ... 787 0.0 2 (BJ414531) Dictyostelium discoideum cDNA clone:ddv19b14, 5' ... 771 0.0 2 (BJ430012) Dictyostelium discoideum cDNA clone:ddv5b22, 3' e... 737 0.0 2 (BJ417186) Dictyostelium discoideum cDNA clone:ddv29c24, 5' ... 739 0.0 1 (BJ415762) Dictyostelium discoideum cDNA clone:ddv23k17, 5' ... 702 0.0 2 (BJ411596) Dictyostelium discoideum cDNA clone:ddv5d05, 5' e... 696 0.0 2 (AU040049) Dictyostelium discoideum slug cDNA, clone SLA318. 620 0.0 4 (BJ411781) Dictyostelium discoideum cDNA clone:ddv5d23, 5' e... 686 0.0 2 (C90999) Dictyostelium discoideum slug cDNA, clone SSJ549. 690 0.0 1 (BJ435208) Dictyostelium discoideum cDNA clone:ddv26m12, 3' ... 680 0.0 1 (BJ430987) Dictyostelium discoideum cDNA clone:ddv9a13, 3' e... 674 0.0 1 (BJ415556) Dictyostelium discoideum cDNA clone:ddv22o23, 5' ... 545 e-176 3 (BJ411771) Dictyostelium discoideum cDNA clone:ddv5b22, 5' e... 611 e-173 2 (BJ416707) Dictyostelium discoideum cDNA clone:ddv27e01, 5' ... 609 e-169 1 (BJ429887) Dictyostelium discoideum cDNA clone:ddv5b10, 3' e... 525 e-169 2 (BJ411649) Dictyostelium discoideum cDNA clone:ddv5b10, 5' e... 500 e-167 3 (BJ415562) Dictyostelium discoideum cDNA clone:ddv22p24, 5' ... 597 e-166 1 (AU267261) Dictyostelium discoideum vegetative cDNA clone:VS... 591 e-164 1 (AU266877) Dictyostelium discoideum vegetative cDNA clone:VS... 589 e-163 1 (AU267260) Dictyostelium discoideum vegetative cDNA clone:VS... 551 e-156 2 (AU284980) Dictyostelium discoideum gamete cDNA clone:FC-BS0... 545 e-150 1 (BJ429638) Dictyostelium discoideum cDNA clone:ddv4g10, 3' e... 478 e-130 1 (BJ430728) Dictyostelium discoideum cDNA clone:ddv8a16, 3' e... 456 e-128 2 (AU074116) Dictyostelium discoideum slug cDNA, clone SSJ549. 448 e-121 1 (AU074548) Dictyostelium discoideum slug cDNA, clone SSL246. 331 e-119 3 (AU261793) Dictyostelium discoideum vegetative cDNA clone:VS... 434 e-117 1 (AU262127) Dictyostelium discoideum vegetative cDNA clone:VS... 385 e-102 1 (BJ417090) Dictyostelium discoideum cDNA clone:ddv29k10, 5' ... 373 e-102 2 (BJ433794) Dictyostelium discoideum cDNA clone:ddv22o23, 3' ... 377 e-100 1 (BJ428071) Dictyostelium discoideum cDNA clone:ddv10l17, 3' ... 377 e-100 1 (BJ390424) Dictyostelium discoideum cDNA clone:dds22j10, 5' ... 313 1e-80 1 (BJ415820) Dictyostelium discoideum cDNA clone:ddv23i19, 5' ... 305 1e-78 2 (BJ411494) Dictyostelium discoideum cDNA clone:ddv4l18, 5' e... 305 2e-78 1 (BJ369474) Dictyostelium discoideum cDNA clone:ddc50o17, 5' ... 305 2e-78 1 (BJ336078) Dictyostelium discoideum cDNA clone:dda52m17, 5' ... 305 2e-78 1 (BJ331234) Dictyostelium discoideum cDNA clone:dda34a15, 5' ... 305 2e-78 1 (BJ363795) Dictyostelium discoideum cDNA clone:ddc28f17, 5' ... 299 5e-78 2 (BJ425283) Dictyostelium discoideum cDNA clone:ddv55a10, 5' ... 303 9e-78 1 (BJ421169) Dictyostelium discoideum cDNA clone:ddv41o19, 5' ... 303 9e-78 1 (BJ419549) Dictyostelium discoideum cDNA clone:ddv36o07, 5' ... 303 9e-78 1 (BJ418236) Dictyostelium discoideum cDNA clone:ddv32h05, 5' ... 303 9e-78 1 (BJ396385) Dictyostelium discoideum cDNA clone:dds42b20, 5' ... 303 9e-78 1 (BJ393272) Dictyostelium discoideum cDNA clone:dds30b21, 5' ... 303 9e-78 1 (BJ393077) Dictyostelium discoideum cDNA clone:dds30c05, 5' ... 303 9e-78 1 (BJ390732) Dictyostelium discoideum cDNA clone:dds23d15, 5' ... 303 9e-78 1 (BJ370451) Dictyostelium discoideum cDNA clone:ddc54n02, 5' ... 303 9e-78 1 (BJ367373) Dictyostelium discoideum cDNA clone:ddc42p12, 5' ... 303 9e-78 1 (BJ366498) Dictyostelium discoideum cDNA clone:ddc39n03, 5' ... 303 9e-78 1 (BJ363632) Dictyostelium discoideum cDNA clone:ddc27m13, 5' ... 303 9e-78 1 (BJ362463) Dictyostelium discoideum cDNA clone:ddc21k21, 5' ... 303 9e-78 1 (BJ361142) Dictyostelium discoideum cDNA clone:ddc9f04, 5' e... 303 9e-78 1 (BJ360612) Dictyostelium discoideum cDNA clone:ddc7a02, 5' e... 303 9e-78 1 (BJ358858) Dictyostelium discoideum cDNA clone:ddc11m13, 5' ... 303 9e-78 1 (BJ338443) Dictyostelium discoideum cDNA clone:dda61e16, 5' ... 303 9e-78 1 (BJ338325) Dictyostelium discoideum cDNA clone:dda60m24, 5' ... 303 9e-78 1 (BJ338142) Dictyostelium discoideum cDNA clone:dda60c07, 5' ... 303 9e-78 1 (BJ333553) Dictyostelium discoideum cDNA clone:dda43l04, 5' ... 303 9e-78 1 (BJ332764) Dictyostelium discoideum cDNA clone:dda40b22, 5' ... 303 9e-78 1 (BJ331689) Dictyostelium discoideum cDNA clone:dda36l18, 5' ... 303 9e-78 1 (BJ323878) Dictyostelium discoideum cDNA clone:dda12n17, 5' ... 303 9e-78 1 (BJ361530) Dictyostelium discoideum cDNA clone:ddc17f17, 5' ... 301 2e-77 2 (BJ410044) Dictyostelium discoideum cDNA clone:ddv11b05, 5' ... 299 3e-77 2 (BJ427062) Dictyostelium discoideum cDNA clone:ddv61l04, 5' ... 301 4e-77 1 (BJ422943) Dictyostelium discoideum cDNA clone:ddv47e17, 5' ... 301 4e-77 1 (BJ421666) Dictyostelium discoideum cDNA clone:ddv43n11, 5' ... 301 4e-77 1 (BJ393212) Dictyostelium discoideum cDNA clone:dds30d13, 5' ... 301 4e-77 1 (BJ333892) Dictyostelium discoideum cDNA clone:dda44l10, 5' ... 301 4e-77 1 (BJ333576) Dictyostelium discoideum cDNA clone:dda43a09, 5' ... 301 4e-77 1 (BJ333022) Dictyostelium discoideum cDNA clone:dda41o05, 5' ... 301 4e-77 1 (BJ332389) Dictyostelium discoideum cDNA clone:dda38n24, 5' ... 301 4e-77 1 (BJ331711) Dictyostelium discoideum cDNA clone:dda36c21, 5' ... 301 4e-77 1 (BJ327434) Dictyostelium discoideum cDNA clone:dda20n07, 5' ... 299 6e-77 2 (BJ415357) Dictyostelium discoideum cDNA clone:ddv22f09, 5' ... 299 7e-77 2 (BJ445649) Dictyostelium discoideum cDNA clone:ddv60n02, 3' ... 299 1e-76 1 (BJ426767) Dictyostelium discoideum cDNA clone:ddv60n02, 5' ... 299 1e-76 1 (BJ426201) Dictyostelium discoideum cDNA clone:ddv58p06, 5' ... 299 1e-76 1 (BJ424211) Dictyostelium discoideum cDNA clone:ddv51b20, 5' ... 299 1e-76 1 (BJ423422) Dictyostelium discoideum cDNA clone:ddv49k06, 5' ... 299 1e-76 1 (BJ422613) Dictyostelium discoideum cDNA clone:ddv46c13, 5' ... 299 1e-76 1 (BJ422180) Dictyostelium discoideum cDNA clone:ddv45j03, 5' ... 299 1e-76 1 (BJ421147) Dictyostelium discoideum cDNA clone:ddv41j20, 5' ... 299 1e-76 1 (BJ420688) Dictyostelium discoideum cDNA clone:ddv40i06, 5' ... 299 1e-76 1 (BJ420013) Dictyostelium discoideum cDNA clone:ddv37o21, 5' ... 299 1e-76 1 (BJ419963) Dictyostelium discoideum cDNA clone:ddv37d20, 5' ... 299 1e-76 1 (BJ419855) Dictyostelium discoideum cDNA clone:ddv37n09, 5' ... 299 1e-76 1 (BJ418679) Dictyostelium discoideum cDNA clone:ddv33j16, 5' ... 299 1e-76 1 (BJ418605) Dictyostelium discoideum cDNA clone:ddv33k08, 5' ... 299 1e-76 1 (BJ417250) Dictyostelium discoideum cDNA clone:ddv30a05, 5' ... 299 1e-76 1 (BJ416539) Dictyostelium discoideum cDNA clone:ddv26b19, 5' ... 299 1e-76 1 (BJ415397) Dictyostelium discoideum cDNA clone:ddv22n12, 5' ... 299 1e-76 1 (BJ413988) Dictyostelium discoideum cDNA clone:ddv17l18, 5' ... 299 1e-76 1 (BJ413105) Dictyostelium discoideum cDNA clone:ddv14n06, 5' ... 299 1e-76 1 (BJ411375) Dictyostelium discoideum cDNA clone:ddv4l06, 5' e... 299 1e-76 1 (BJ410963) Dictyostelium discoideum cDNA clone:ddv2b17, 5' e... 299 1e-76 1 (BJ395940) Dictyostelium discoideum cDNA clone:dds40b24, 5' ... 299 1e-76 1 (BJ395747) Dictyostelium discoideum cDNA clone:dds40c03, 5' ... 299 1e-76 1 (BJ395419) Dictyostelium discoideum cDNA clone:dds38e24, 5' ... 299 1e-76 1 (BJ394349) Dictyostelium discoideum cDNA clone:dds34d19, 5' ... 299 1e-76 1 (BJ394340) Dictyostelium discoideum cDNA clone:dds34a22, 5' ... 299 1e-76 1 (BJ393355) Dictyostelium discoideum cDNA clone:dds31d05, 5' ... 299 1e-76 1 (BJ391233) Dictyostelium discoideum cDNA clone:dds15a19, 5' ... 299 1e-76 1 (BJ391015) Dictyostelium discoideum cDNA clone:dds14m15, 5' ... 299 1e-76 1 (BJ390304) Dictyostelium discoideum cDNA clone:dds21n19, 5' ... 299 1e-76 1 (BJ388450) Dictyostelium discoideum cDNA clone:dds9j14, 5' e... 299 1e-76 1 (BJ388083) Dictyostelium discoideum cDNA clone:dds7f24, 5' e... 299 1e-76 1 (BJ387961) Dictyostelium discoideum cDNA clone:dds7k02, 5' e... 299 1e-76 1 (BJ387510) Dictyostelium discoideum cDNA clone:dds3f03, 5' e... 299 1e-76 1 (BJ370514) Dictyostelium discoideum cDNA clone:ddc54k11, 5' ... 299 1e-76 1 (BJ369688) Dictyostelium discoideum cDNA clone:ddc51m09, 5' ... 299 1e-76 1 (BJ368554) Dictyostelium discoideum cDNA clone:ddc47n02, 5' ... 299 1e-76 1 (BJ368340) Dictyostelium discoideum cDNA clone:ddc46f07, 5' ... 299 1e-76 1 (BJ367708) Dictyostelium discoideum cDNA clone:ddc43o17, 5' ... 299 1e-76 1 (BJ366490) Dictyostelium discoideum cDNA clone:ddc39l02, 5' ... 299 1e-76 1 (BJ365366) Dictyostelium discoideum cDNA clone:ddc35i05, 5' ... 299 1e-76 1 (BJ364981) Dictyostelium discoideum cDNA clone:ddc33o17, 5' ... 299 1e-76 1 (BJ363762) Dictyostelium discoideum cDNA clone:ddc28j12, 5' ... 299 1e-76 1 (BJ362902) Dictyostelium discoideum cDNA clone:ddc24a01, 5' ... 299 1e-76 1 (BJ359760) Dictyostelium discoideum cDNA clone:ddc2k09, 5' e... 299 1e-76 1 (BJ358551) Dictyostelium discoideum cDNA clone:ddc10i06, 5' ... 299 1e-76 1 (BJ351734) Dictyostelium discoideum cDNA clone:dda44n09, 3' ... 299 1e-76 1 (BJ350974) Dictyostelium discoideum cDNA clone:dda41i18, 3' ... 299 1e-76 1 (BJ339138) Dictyostelium discoideum cDNA clone:dda64d10, 5' ... 299 1e-76 1 (BJ339006) Dictyostelium discoideum cDNA clone:dda63e22, 5' ... 299 1e-76 1 (BJ337400) Dictyostelium discoideum cDNA clone:dda57e11, 5' ... 299 1e-76 1 (BJ334179) Dictyostelium discoideum cDNA clone:dda45m09, 5' ... 299 1e-76 1 (BJ334117) Dictyostelium discoideum cDNA clone:dda45o01, 5' ... 299 1e-76 1 (BJ333899) Dictyostelium discoideum cDNA clone:dda44n09, 5' ... 299 1e-76 1 (BJ333150) Dictyostelium discoideum cDNA clone:dda41i18, 5' ... 299 1e-76 1 (BJ332644) Dictyostelium discoideum cDNA clone:dda39g21, 5' ... 299 1e-76 1 (BJ332414) Dictyostelium discoideum cDNA clone:dda39d01, 5' ... 299 1e-76 1 (BJ332097) Dictyostelium discoideum cDNA clone:dda37p02, 5' ... 299 1e-76 1 (BJ331987) Dictyostelium discoideum cDNA clone:dda37g20, 5' ... 299 1e-76 1 (BJ324807) Dictyostelium discoideum cDNA clone:dda8j05, 5' e... 299 1e-76 1 (BJ324600) Dictyostelium discoideum cDNA clone:dda7h01, 5' e... 299 1e-76 1 (BJ323656) Dictyostelium discoideum cDNA clone:dda11h18, 5' ... 299 1e-76 1 (X00601) Dictyostelium discoideum ribosomal RNA gene. 297 6e-76 1 (AY171066) Dictyostelium discoideum extrachromosomal palindr... 297 6e-76 1 (AU272380) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 297 6e-76 1 (BJ425067) Dictyostelium discoideum cDNA clone:ddv54c18, 5' ... 297 6e-76 1 (BJ424674) Dictyostelium discoideum cDNA clone:ddv53n05, 5' ... 297 6e-76 1 (BJ423783) Dictyostelium discoideum cDNA clone:ddv50l08, 5' ... 297 6e-76 1 (BJ423397) Dictyostelium discoideum cDNA clone:ddv49g01, 5' ... 297 6e-76 1 (BJ420801) Dictyostelium discoideum cDNA clone:ddv40a14, 5' ... 297 6e-76 1 (BJ416543) Dictyostelium discoideum cDNA clone:ddv26b24, 5' ... 297 6e-76 1 (BJ416183) Dictyostelium discoideum cDNA clone:ddv25p04, 5' ... 297 6e-76 1 (BJ414970) Dictyostelium discoideum cDNA clone:ddv21d04, 5' ... 297 6e-76 1 (BJ410612) Dictyostelium discoideum cDNA clone:ddv1p01, 5' e... 297 6e-76 1 (BJ409876) Dictyostelium discoideum cDNA clone:ddv10i12, 5' ... 297 6e-76 1 (BJ396145) Dictyostelium discoideum cDNA clone:dds41d18, 5' ... 297 6e-76 1 (BJ392897) Dictyostelium discoideum cDNA clone:dds29h12, 5' ... 297 6e-76 1 (BJ390041) Dictyostelium discoideum cDNA clone:dds21a02, 5' ... 297 6e-76 1 (BJ367368) Dictyostelium discoideum cDNA clone:ddc42o08, 5' ... 297 6e-76 1 (BJ358951) Dictyostelium discoideum cDNA clone:ddc12g02, 5' ... 297 6e-76 1 (BJ351025) Dictyostelium discoideum cDNA clone:dda41d20, 3' ... 297 6e-76 1 (BJ336003) Dictyostelium discoideum cDNA clone:dda52i09, 5' ... 297 6e-76 1 (BJ334219) Dictyostelium discoideum cDNA clone:dda45e17, 5' ... 297 6e-76 1 (BJ328892) Dictyostelium discoideum cDNA clone:dda30a05, 5' ... 297 6e-76 1 (BJ327541) Dictyostelium discoideum cDNA clone:dda20f23, 5' ... 297 6e-76 1 (BJ323688) Dictyostelium discoideum cDNA clone:dda11d24, 5' ... 297 6e-76 1 (BJ423860) Dictyostelium discoideum cDNA clone:ddv50k15, 5' ... 295 2e-75 1 (BJ411221) Dictyostelium discoideum cDNA clone:ddv3a13, 5' e... 295 2e-75 1 (BJ387385) Dictyostelium discoideum cDNA clone:dds2o01, 5' e... 295 2e-75 1 (BJ424747) Dictyostelium discoideum cDNA clone:ddv53o08, 5' ... 293 9e-75 1 (BJ413550) Dictyostelium discoideum cDNA clone:ddv16n01, 5' ... 293 9e-75 1 (BJ368639) Dictyostelium discoideum cDNA clone:ddc47c15, 5' ... 293 9e-75 1 (BJ368025) Dictyostelium discoideum cDNA clone:ddc45a04, 5' ... 293 9e-75 1 (BJ366464) Dictyostelium discoideum cDNA clone:ddc39f05, 5' ... 293 9e-75 1 (BJ365046) Dictyostelium discoideum cDNA clone:ddc33o23, 5' ... 293 9e-75 1 (BJ359166) Dictyostelium discoideum cDNA clone:ddc13j06, 5' ... 293 9e-75 1 (BJ328130) Dictyostelium discoideum cDNA clone:dda23f02, 5' ... 293 9e-75 1 (AU272381) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 291 3e-74 1 (BJ417698) Dictyostelium discoideum cDNA clone:ddv28a16, 5' ... 291 3e-74 1 (BJ416103) Dictyostelium discoideum cDNA clone:ddv24p22, 5' ... 291 3e-74 1 (BJ412538) Dictyostelium discoideum cDNA clone:ddv8p19, 5' e... 291 3e-74 1 (BJ412314) Dictyostelium discoideum cDNA clone:ddv7h23, 5' e... 291 3e-74 1 (BJ368153) Dictyostelium discoideum cDNA clone:ddc45b17, 5' ... 291 3e-74 1 (BJ330823) Dictyostelium discoideum cDNA clone:dda32k19, 5' ... 291 3e-74 1 (BJ414725) Dictyostelium discoideum cDNA clone:ddv20a08, 5' ... 196 5e-74 2 (DQ340385) Dictyostelium citrinum 17S ribosomal RNA, 5.8S ri... 289 1e-73 1 (BJ335912) Dictyostelium discoideum cDNA clone:dda52c05, 5' ... 289 1e-73 1 (BJ354146) Dictyostelium discoideum cDNA clone:dda52m17, 3' ... 287 5e-73 1 (BJ425964) Dictyostelium discoideum cDNA clone:ddv57m14, 5' ... 192 8e-73 2 (BJ382666) Dictyostelium discoideum cDNA clone:ddc45b17, 3' ... 283 9e-72 1 (BJ368161) Dictyostelium discoideum cDNA clone:ddc45d17, 5' ... 283 9e-72 1 (V00192) Dictyostelium discoideum 5.8S ribosomal RNA. 281 3e-71 1 (BJ379078) Dictyostelium discoideum cDNA clone:ddc33o17, 3' ... 281 3e-71 1 (BJ368352) Dictyostelium discoideum cDNA clone:ddc46i07, 5' ... 278 5e-71 2 (BJ393940) Dictyostelium discoideum cDNA clone:dds33p02, 5' ... 230 2e-70 2 (AU263685) Dictyostelium discoideum vegetative cDNA clone:VS... 276 2e-69 1 (BJ331775) Dictyostelium discoideum cDNA clone:dda36d05, 5' ... 260 3e-69 2 (BJ393976) Dictyostelium discoideum cDNA clone:dds33i09, 5' ... 230 1e-68 2 (AU272241) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 272 3e-68 1 (BJ395729) Dictyostelium discoideum cDNA clone:dds39o19, 5' ... 151 4e-68 2 (EF066487) Dictyostelium mucoroides strain Dmc1 internal tra... 270 1e-67 1 (AM282599) Dictyostelium mucoroides 18S rRNA gene (partial),... 270 1e-67 1 (AM282598) Dictyostelium mucoroides 18S rRNA gene (partial),... 270 1e-67 1 (AM282595) Dictyostelium mucoroides 18S rRNA gene (partial),... 270 1e-67 1 (BJ440918) Dictyostelium discoideum cDNA clone:ddv45j03, 3' ... 266 2e-66 1 (AM282597) Dictyostelium mucoroides 18S rRNA gene (partial),... 262 3e-65 1 (AM282596) Dictyostelium mucoroides 18S rRNA gene (partial),... 262 3e-65 1 (BJ382936) Dictyostelium discoideum cDNA clone:ddc46i07, 3' ... 258 7e-65 2 (AU261782) Dictyostelium discoideum vegetative cDNA clone:VS... 260 1e-64 1 (AU271133) Dictyostelium discoideum vegetative cDNA clone:VS... 256 2e-63 1 (FJ424828) Dictyostelium purpureum strain QSpu36 17S ribosom... 254 8e-63 1 (FJ424827) Dictyostelium purpureum strain QSpu37 17S ribosom... 254 8e-63 1 (EF066486) Dictyostelium giganteum strain Dg3E internal tran... 254 8e-63 1 (AM282592) Dictyostelium giganteum 18S rRNA gene (partial), ... 254 8e-63 1 (AF219103) Dictyostelium purpureum 18S ribosomal RNA gene, p... 254 8e-63 1 (AF219102) Dictyostelium giganteum 18S ribosomal RNA gene, p... 254 8e-63 1 (AF219101) Dictyostelium dimigraformum 18S ribosomal RNA gen... 252 3e-62 1 (AF219107) Polysphondylium violaceum 18S ribosomal RNA gene,... 248 5e-61 1 (EF066488) Dictyostelium sphaerocephalum strain DsppCal1 int... 246 2e-60 1 (DQ463371) Dictyostelium macrocephalum 18S ribosomal RNA gen... 246 2e-60 1 (DQ463370) Dictyostelium mucoroides 18S ribosomal RNA gene, ... 246 2e-60 1 (AY330646) Dictyostelium clavatum 18S ribosomal RNA gene, pa... 246 2e-60 1 (AM282605) Dictyostelium sphaerocephalum 18S rRNA gene (part... 246 2e-60 1 (AM282603) Dictyostelium sphaerocephalum 18S rRNA gene (part... 246 2e-60 1 (AM282602) Dictyostelium sphaerocephalum 18S rRNA gene (part... 246 2e-60 1 (AM282600) Dictyostelium sphaerocephalum 18S rRNA gene (part... 246 2e-60 1 (AF351199) Dictyostelium sphaerocephalum 18S ribosomal RNA g... 246 2e-60 1 (AF351197) Dictyostelium mucoroides 18S ribosomal RNA gene, ... 246 2e-60 1 (BJ387390) Dictyostelium discoideum cDNA clone:dds2a08, 5' e... 246 2e-60 1 (BJ414922) Dictyostelium discoideum cDNA clone:ddv20i19, 5' ... 244 7e-60 1 (BJ428777) Dictyostelium discoideum cDNA clone:ddv1p01, 3' e... 168 9e-60 2 (FJ424826) Dictyostelium purpureum strain QSpu4 17S ribosoma... 238 5e-58 1 (BJ379156) Dictyostelium discoideum cDNA clone:ddc33o23, 3' ... 238 5e-58 1 (AM282591) Dictyostelium giganteum 18S rRNA gene (partial), ... 147 3e-56 2 (AM282604) Dictyostelium sphaerocephalum 18S rRNA gene (part... 182 3e-56 2 (FJ424862) Dictyostelium purpureum strain QSpu19 17S ribosom... 230 1e-55 1 (FJ424861) Dictyostelium purpureum strain QSpu31 17S ribosom... 230 1e-55 1 (FJ424860) Dictyostelium purpureum strain QSpu35 17S ribosom... 230 1e-55 1 (FJ424859) Dictyostelium purpureum strain QSpu25 17S ribosom... 230 1e-55 1 (FJ424858) Dictyostelium purpureum strain QSpu34 17S ribosom... 230 1e-55 1 (FJ424857) Dictyostelium purpureum strain QSpu32 17S ribosom... 230 1e-55 1 (FJ424856) Dictyostelium purpureum strain QSpu24 17S ribosom... 230 1e-55 1 (FJ424855) Dictyostelium purpureum strain QSpu22 17S ribosom... 230 1e-55 1 (FJ424854) Dictyostelium purpureum strain QSpu20 17S ribosom... 230 1e-55 1 (FJ424853) Dictyostelium purpureum strain QSpu18 17S ribosom... 230 1e-55 1 (FJ424852) Dictyostelium purpureum strain QSpu17 17S ribosom... 230 1e-55 1 (FJ424851) Dictyostelium purpureum strain QSpu16 17S ribosom... 230 1e-55 1 (FJ424850) Dictyostelium purpureum strain QSpu15 17S ribosom... 230 1e-55 1 (FJ424849) Dictyostelium purpureum strain QSpu14 17S ribosom... 230 1e-55 1 (FJ424848) Dictyostelium purpureum strain QSpu13 17S ribosom... 230 1e-55 1 (FJ424847) Dictyostelium purpureum strain QSpu12 17S ribosom... 230 1e-55 1 (FJ424846) Dictyostelium purpureum strain QSpu11 17S ribosom... 230 1e-55 1 (FJ424845) Dictyostelium purpureum strain QSpu10 17S ribosom... 230 1e-55 1 (FJ424844) Dictyostelium purpureum strain QSpu9 17S ribosoma... 230 1e-55 1 (FJ424843) Dictyostelium purpureum strain QSpu8 17S ribosoma... 230 1e-55 1 (FJ424842) Dictyostelium purpureum strain QSpu7 17S ribosoma... 230 1e-55 1 (FJ424841) Dictyostelium purpureum strain QSpu5 17S ribosoma... 230 1e-55 1 (FJ424840) Dictyostelium purpureum strain QSpu3 17S ribosoma... 230 1e-55 1 (FJ424839) Dictyostelium purpureum strain QSpu2 17S ribosoma... 230 1e-55 1 (FJ424838) Dictyostelium purpureum strain QSpu30 17S ribosom... 230 1e-55 1 (FJ424837) Dictyostelium purpureum strain QSpu26 17S ribosom... 230 1e-55 1 (FJ424836) Dictyostelium purpureum strain QSpu28 17S ribosom... 230 1e-55 1 (FJ424835) Dictyostelium purpureum strain QSpu27 17S ribosom... 230 1e-55 1 (FJ424834) Dictyostelium purpureum strain QSpu29 17S ribosom... 230 1e-55 1 (FJ424833) Dictyostelium purpureum strain QSpu33 17S ribosom... 230 1e-55 1 (FJ424832) Dictyostelium purpureum strain QSpu23 17S ribosom... 230 1e-55 1 (FJ424831) Dictyostelium purpureum strain QSpu21 17S ribosom... 230 1e-55 1 (FJ424830) Dictyostelium purpureum strain QSpu6 17S ribosoma... 230 1e-55 1 (FJ424829) Dictyostelium purpureum strain QSpu1 17S ribosoma... 230 1e-55 1 (AM282601) Dictyostelium sphaerocephalum 18S rRNA gene (part... 111 5e-52 3 (BJ428200) Dictyostelium discoideum cDNA clone:ddv11h02, 3' ... 123 1e-49 2 (AU272240) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 206 2e-48 1 (DQ340386) Dictyostelium purpureum 17S ribosomal RNA, 5.8S r... 204 6e-48 1 (BJ388199) Dictyostelium discoideum cDNA clone:dds8l08, 5' e... 202 2e-47 1 (BJ335056) Dictyostelium discoideum cDNA clone:dda48c22, 5' ... 190 9e-44 1 (BJ375007) Dictyostelium discoideum cDNA clone:ddc17h02, 3' ... 165 5e-42 2 (BJ419506) Dictyostelium discoideum cDNA clone:ddv36f12, 5' ... 133 5e-42 2 (BJ333190) Dictyostelium discoideum cDNA clone:dda41d20, 5' ... 184 6e-42 1 (BJ326118) Dictyostelium discoideum cDNA clone:dda15e12, 5' ... 176 1e-39 1 (BJ438389) Dictyostelium discoideum cDNA clone:ddv37d20, 3' ... 163 2e-35 1 (BJ419499) Dictyostelium discoideum cDNA clone:ddv36e11, 5' ... 137 7e-35 2 (BJ436109) Dictyostelium discoideum cDNA clone:ddv30b04, 3' ... 159 3e-34 1 (AM282590) Acytostelium sp. DCB6B 18S rRNA gene (partial), 5... 157 1e-33 1 (AM282589) Acytostelium sp. GCE9 18S rRNA gene (partial), 5.... 157 1e-33 1 (AF219110) Polysphondylium candidum 18S ribosomal RNA gene, ... 153 2e-32 1 (AM282613) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (AM282612) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (AM282611) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (AM282610) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (AM282609) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (AM282608) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (AM282606) Polysphondylium candidum 18S rRNA gene (partial),... 151 8e-32 1 (BJ351381) Dictyostelium discoideum cDNA clone:dda43a09, 3' ... 151 8e-32 1 (BJ427870) Dictyostelium discoideum cDNA clone:ddv63j23, 5' ... 149 3e-31 1 (DQ340387) Dictyostelium polycephalum 17S ribosomal RNA, 5.8... 143 2e-29 1 (AF219109) Polysphondylium tenuissimum 18S ribosomal RNA gen... 143 2e-29 1 (AF219108) Polysphondylium pallidum 18S ribosomal RNA gene, ... 143 2e-29 1 (AF219104) Dictyostelium polycephalum 18S ribosomal RNA gene... 143 2e-29 1 (BJ391970) Dictyostelium discoideum cDNA clone:dds25j22, 5' ... 141 8e-29 1 (DQ340388) Polysphondylium pallidum 17S ribosomal RNA, 5.8S ... 137 1e-27 1 (AM282615) Polysphondylium pallidum 18S rRNA gene (partial),... 137 1e-27 1 (AM282614) Polysphondylium pallidum 18S rRNA gene (partial),... 137 1e-27 1 (EC761796) PSE00007316 rw_mgpallid Polysphondylium pallidum ... 137 1e-27 1 (EC761461) PSE00006559 rw_mgpallid Polysphondylium pallidum ... 137 1e-27 1 (BJ429427) Dictyostelium discoideum cDNA clone:ddv3o07, 3' e... 129 3e-25 1 (EC761231) PSE00003782 rw_mgpallid Polysphondylium pallidum ... 127 1e-24 1 (X02407) D.discoideum mRNA for cysteine proteinase 1. 54 3e-24 6 (EC761754) PSE00005638 rw_mgpallid Polysphondylium pallidum ... 125 5e-24 1 (EC760484) PSE00004741 rw_mgpallid Polysphondylium pallidum ... 125 5e-24 1 (EC761168) PSE00005306 rw_mgpallid Polysphondylium pallidum ... 121 7e-23 1 (EC760666) PSE00000143 rw_mgpallid Polysphondylium pallidum ... 121 7e-23 1 (EC761276) PSE00004271 rw_mgpallid Polysphondylium pallidum ... 84 2e-22 2 (EC761944) PSE00007022 rw_mgpallid Polysphondylium pallidum ... 119 3e-22 1 (EC761717) PSE00002953 rw_mgpallid Polysphondylium pallidum ... 119 3e-22 1 (BJ332568) Dictyostelium discoideum cDNA clone:dda39g17, 5' ... 119 3e-22 1 (EC745088) PSE00008026 rw_mgpallid Polysphondylium pallidum ... 117 1e-21 1 (EC762316) PSE00008147 rw_mgpallid Polysphondylium pallidum ... 115 5e-21 1 (AM282607) Polysphondylium candidum 18S rRNA gene (partial),... 100 1e-20 2 (DQ463372) Dictyostelium minutum 18S ribosomal RNA gene, par... 107 1e-18 1 (AF219105) Dictyostelium minutum 18S ribosomal RNA gene, par... 107 1e-18 1 (EC745719) PSE00003771 rw_mgpallid Polysphondylium pallidum ... 107 1e-18 1 (AM282588) Acytostelium leptosomum 18S rRNA gene (partial), ... 101 7e-17 1 (EC762408) PSE00006908 rw_mgpallid Polysphondylium pallidum ... 101 7e-17 1 (BJ416871) Dictyostelium discoideum cDNA clone:ddv27h18, 5' ... 101 7e-17 1 (DQ340389) Dictyostelium fasciculatum 17S ribosomal RNA, 5.8... 72 5e-16 2 (AF219106) Dictyostelium aureostipes 18S ribosomal RNA gene,... 72 5e-16 2 (AY170307) Dictyostelium exiguum 18S ribosomal RNA gene, par... 72 5e-16 2 (EC745578) PSE00002246 rw_mgpallid Polysphondylium pallidum ... 96 4e-15 1 >(BJ430364) Dictyostelium discoideum cDNA clone:ddv7b05, 3' end, single read. Length = 781 Score = 1404 bits (708), Expect(2) = 0.0 Identities = 711/712 (99%) Strand = Plus / Minus Query: 531 ccccagccgctttcgattggagaaatactggtggttcaactaaattcccacaaggtactc 590 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 745 ccccagccgctttcgattggagaaatactggtggttcaactaaattcccacaaggtactc 686 Query: 591 caggttaccgctgttaaaaaccaagggtcaatgtggttcatgttggtcattctctaccac 650 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 685 caggttaccgctgttaaaaaccaagggtcaatgtggttcatgttggtcattctctaccac 626 Query: 651 tggtaacgtcgaaggtcaacactatttatcaactggtacattagttggtctctctgaaca 710 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 625 tggtaacgtcgaaggtcaacactatttatcaactggtacattagttggtctctctgaaca 566 Query: 711 aaatttagtcgattgtgatcatacttgtatgacctacgaaaacgaaaatgtttgcaatgc 770 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 565 aaatttagtcgattgtgatcatacttgtatgacctacgaaaacgaaaatgtttgcaatgc 506 Query: 771 tggttgtgatggtggtctccaaccaaatgcctacaactacatcatcaaaaacggaggtat 830 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 505 tggttgtgatggtggtctccaaccaaatgcctacaactacatcatcaaaaacggaggtat 446 Query: 831 ccaaaccgaagctacctatccatacactgctgttgatggagaatgtaaatttaactctgc 890 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 445 ccaaaccgaagctacctatccatacactgctgttgatggagaatgtaaatttaactctgc 386 Query: 891 ccaagttggtgctaaaatttcatctttcactatggttccacaaaatgaaactcaaattgc 950 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 385 ccaagttggtgctaaaatttcatctttcactatggttccacaaaatgaaactcaaattgc 326 Query: 951 ttcctacttattcaacaatggtccattagctattgcagctgatgctgaagaatggcaatt 1010 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 325 ttcctacttattcaacaatggtccattagctattgcagctgatgctgaagaatggcaatt 266 Query: 1011 ctatatgggaggtgttttcgatttcccatgtggtcaaactttagatcacggtatcttaat 1070 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 265 ctatatgggaggtgttttcgatttcccatgtggtcaaactttagatcacggtatcttaat 206 Query: 1071 tgttggttatggtgctcaagataccatcgtcggtaaaaatactccatactggatcattaa 1130 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 205 tgttggttatggtgctcaagataccatcgtcggtaaaaatactccatactggatcattaa 146 Query: 1131 aaactcatggggtgccgattggggtgaagctggttacttaaaagttgaaagaaatactga 1190 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 145 gaactcatggggtgccgattggggtgaagctggttacttaaaagttgaaagaaatactga 86 Query: 1191 taaatgtggtgttgccaatttcgtttcttcatcaattgttggttcatcaaac 1242 \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 85 taaatgtggtgttgccaatttcgtttcttcatcaattgttggttcatcaaac 34 Score = 69.9 bits (35), Expect(2) = 0.0 Identities = 38/39 (97%) Strand = Plus / Minus Query: 496 gttaccaaacttatcagacgatatcatttcagcaacccc 534 \|\|\|\|\|\|\|\|\|\| \|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\|\| Sbjct: 781 gttaccaaacctatcagacgatatcatttcagcaacccc 743 Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number of Hits to DB: 1,423,460,808 Number of extensions: 82398906 Number of successful extensions: 6831945 Number of sequences better than 10.0: 2351 Length of query: 1368 Length of database: 98,766,808,389 Length adjustment: 24 Effective length of query: 1344 Effective length of database: 96,409,374,237 Effective search space: 129574198974528 Effective search space used: 129574198974528 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
protein update	2009. 8. 2
Homology vs Protein	Query= Contig-U16285-1 (Contig-U16285-1Q) /CSM_Contig/Contig-U16285-1Q.Seq.d (1368 letters) Database: nrp_A 3,268,448 sequences; 1,061,185,681 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value (P04988) RecName: Full=Cysteine proteinase 1; EC=3.4.22... 330 1e-88 U42758_1(U42758\|pid:none) Naegleria fowleri cysteine proteinase ... 250 1e-78 AF411121_1(AF411121\|pid:none) Sandersonia aurantiaca cysteine pr... 226 2e-68 AC149637_11(AC149637\|pid:none) Medicago truncatula clone mth2-18... 227 1e-67 FB844636_1(FB844636\|pid:none) Sequence 63909 from Patent WO20080... 220 2e-66 (P25804) RecName: Full=Cysteine proteinase 15A; EC=3.4.... 224 2e-66 AY161277_1(AY161277\|pid:none) Vicia faba pre-pro cysteine protei... 222 2e-66 U59465_1(U59465\|pid:none) Vicia faba pre-pro-cysteine proteinase... 222 2e-66 S42882(S51818;S42882) cysteine proteinase (EC 3.4.22.-) precurso... 224 3e-66 EF144276_1(EF144276\|pid:none) Populus trichocarpa clone PX0015_D... 219 6e-66 BT071299_1(BT071299\|pid:none) Picea sitchensis clone WS02822_C20... 217 6e-66 FJ475061_1(FJ475061\|pid:none) Arachis hypogaea cysteine protease... 213 1e-65 AY800120_1(AY800120\|pid:none) Populus tomentosa cysteine protein... 219 5e-65 AJ580823_3(AJ580823\|pid:none) Lotus corniculatus var. japonicus ... 223 5e-65 AK175856_1(AK175856\|pid:none) Arabidopsis thaliana mRNA for puta... 216 6e-65 FB844544_1(FB844544\|pid:none) Sequence 63817 from Patent WO20080... 226 8e-65 AJ242994_1(AJ242994\|pid:none) Nicotiana tabacum mRNA for putativ... 216 8e-65 X74359_1(X74359\|pid:none) A.thaliana mRNA for putative thiol pro... 219 8e-65 AJ580823_4(AJ580823\|pid:none) Lotus corniculatus var. japonicus ... 221 2e-64 AM430527_1(AM430527\|pid:none) Vitis vinifera contig VV78X035441.... 212 2e-64 EF144705_1(EF144705\|pid:none) Populus trichocarpa clone WS01117_... 217 2e-64 BT041678_1(BT041678\|pid:none) Zea mays full-length cDNA clone ZM... 220 4e-64 FJ609256_1(FJ609256\|pid:none) Solanum lycopersicum cysteine prot... 223 4e-64 AY017414_1(AY017414\|pid:none) Nicotiana tabacum CPR2-like cystei... 216 4e-64 AJ009878_1(AJ009878\|pid:none) Cicer arietinum mRNA for cysteine ... 218 4e-64 FB844670_1(FB844670\|pid:none) Sequence 63943 from Patent WO20080... 220 5e-64 FB844658_1(FB844658\|pid:none) Sequence 63931 from Patent WO20080... 220 5e-64 AF082181_1(AF082181\|pid:none) Solanum melongena cysteine protein... 218 9e-64 AB267820_1(AB267820\|pid:none) Ipomoea nil In15 mRNA for cysteine... 221 2e-63 S30149(S30149;S24242) cysteine proteinase (EC 3.4.22.-) precurso... 212 2e-63 EU340886_1(EU340886\|pid:none) Robinia pseudoacacia cysteine prot... 213 3e-63 EU280160_1(EU280160\|pid:none) Vitis vinifera cysteine protease (... 214 9e-63 AY841792_1(AY841792\|pid:none) Triticum aestivum cysteine proteas... 216 9e-63 AM941117_1(AM941117\|pid:none) Hordeum vulgare subsp. vulgare mRN... 211 2e-62 AF454959_1(AF454959\|pid:none) Brassica oleracea senescence-assoc... 209 2e-62 AK071907_1(AK071907\|pid:none) Oryza sativa Japonica Group cDNA c... 218 2e-62 CQ974042_1(CQ974042\|pid:none) Sequence 1 from Patent WO2004113520. 216 6e-62 (P43296) RecName: Full=Cysteine proteinase RD19a; Short... 210 8e-62 FB844622_1(FB844622\|pid:none) Sequence 63895 from Patent WO20080... 209 8e-62 EF530143_1(EF530143\|pid:none) Actinidia deliciosa cysteine prote... 213 8e-62 AF138264_1(AF138264\|pid:none) Ipomoea batatas papain-like cystei... 215 1e-61 AB372256_1(AB372256\|pid:none) Capsicum chinense mRNA for putativ... 209 2e-61 AL663007_3(AL663007\|pid:none) Oryza sativa genomic DNA, chromoso... 222 5e-61 AL049655_8(AL049655\|pid:none) Arabidopsis thaliana DNA chromosom... 206 2e-60 AM424734_1(AM424734\|pid:none) Vitis vinifera contig VV78X103090.... 211 5e-60 AB270920_1(AB270920\|pid:none) Phaseolus vulgaris CP2 gene for cy... 233 2e-59 AK063422_1(AK063422\|pid:none) Oryza sativa Japonica Group cDNA c... 198 8e-59 T12040(T12040) cysteine proteinase (EC 3.4.22.-) 2 precursor - k... 230 1e-58 EF538806_1(EF538806\|pid:none) Trypanoplasma borreli cathepsin L ... 209 2e-58 AM941116_1(AM941116\|pid:none) Hordeum vulgare subsp. vulgare mRN... 206 2e-58 AC073906_21(AC073906\|pid:none) Trypanosoma brucei chromosome 6 c... 198 4e-58 AB377534_1(AB377534\|pid:none) Spinacia oleracea SoCP3-41 mRNA fo... 196 8e-58 AJ297265_1(AJ297265\|pid:none) Trypanosoma brucei rhodesiense par... 196 1e-57 AC073906_20(AC073906\|pid:none) Trypanosoma brucei chromosome 6 c... 196 1e-57 AF167986_1(AF167986\|pid:none) Glycine max putative cysteine prot... 225 3e-57 S12099(S12099) cysteine proteinase (EC 3.4.22.-) precursor - Try... 196 3e-57 EU025855_1(EU025855\|pid:none) Dermacentor variabilis cathepsin L... 201 5e-57 AY390282_1(AY390282\|pid:none) Periserrula leucophryna cysteine p... 194 7e-57 AY220615_1(AY220615\|pid:none) Hydra vulgaris cathepsin L precurs... 204 9e-57 DQ294220_1(DQ294220\|pid:none) Glossina morsitans morsitans TC183... 197 3e-56 AY662989_1(AY662989\|pid:none) Petunia x hybrida cysteine protein... 221 4e-56 CR954210_114(CR954210\|pid:none) Ostreococcus tauri strain OTTH05... 206 8e-56 EF538805_1(EF538805\|pid:none) Trypanoplasma borreli cathepsin L ... 202 3e-55 (P54640) RecName: Full=Cysteine proteinase 5; EC=3.4.22... 182 6e-55 AJ583512_1(AJ583512\|pid:none) Diabrotica virgifera virgifera mRN... 177 6e-55 AJ872184_1(AJ872184\|pid:none) Lubomirskia baicalensis mRNA for c... 197 1e-54 AF265226_1(AF265226\|pid:none) Trypanosoma cruzi strain TUL cruzi... 187 2e-54 AY713477_1(AY713477\|pid:none) Cryptobia salmositica cysteine pro... 200 2e-54 (P25779) RecName: Full=Cruzipain; EC=3.4.22.51; AltName... 186 4e-54 AF314929_1(AF314929\|pid:none) Trypanosoma cruzi strain Y cruzipa... 186 4e-54 A45629(A45629)cysteine proteinase cruzipain (EC 3.4.22.-) - Tryp... 184 5e-54 U41454_1(U41454\|pid:none) Trypanosoma cruzi cysteine protease cr... 185 7e-54 L36205_1(L36205\|pid:none) Dictyostelium discoideum cysteine prot... 182 9e-54 (Q9LM66) RecName: Full=Xylem cysteine proteinase 2; Sho... 175 1e-53 AM409328_1(AM409328\|pid:none) Trifolium pratense partial cp8 gen... 185 1e-53 AY192364_1(AY192364\|pid:none) Trifolium repens cysteine protease... 186 2e-53 AY332271_1(AY332271\|pid:none) Tenebrio molitor cathepsin-L-like ... 192 2e-53 EU597229_1(EU597229\|pid:none) Paralichthys olivaceus cathepsin F... 177 2e-53 AB040454_1(AB040454\|pid:none) Astragalus sinicus cysteine protei... 190 2e-53 DQ016549_1(DQ016549\|pid:none) Paragonimus westermani cysteine pr... 184 3e-53 AY207373_1(AY207373\|pid:none) Tenebrio molitor cathepsin L-like ... 191 3e-53 AY336797_1(AY336797\|pid:none) Rhipicephalus haemaphysaloides hae... 185 3e-53 EF622019_1(EF622019\|pid:none) Elaeis guineensis cysteine protein... 183 6e-53 (P04989) RecName: Full=Cysteine proteinase 2; EC=3.4.22... 173 6e-53 AB098627_1(AB098627\|pid:none) Daucus carota DcCysP4 mRNA for cys... 184 8e-53 FJ763762_1(FJ763762\|pid:none) Delia coarctata cathepsin L-like c... 194 8e-53 DQ280314_1(DQ280314\|pid:none) Hymeniacidon perlevis cathepsin L ... 191 8e-53 AJ245868_1(AJ245868\|pid:none) Medicago sativa mRNA for cysteine ... 210 9e-53 AY192361_1(AY192361\|pid:none) Trifolium repens cysteine protease... 175 1e-52 DQ403257_1(DQ403257\|pid:none) Pachysandra terminalis papain-like... 210 1e-52 AY192363_1(AY192363\|pid:none) Trifolium repens cysteine protease... 191 1e-52 U41444_1(U41444\|pid:none) Trypanosoma cruzi cysteine protease cr... 180 2e-52 (Q95029) RecName: Full=Cathepsin L; EC=3.4.22.15; AltNa... 196 2e-52 AY192366_1(AY192366\|pid:none) Trifolium repens cysteine protease... 191 2e-52 AE013599_1894(AE013599\|pid:none) Drosophila melanogaster chromos... 196 2e-52 EF530146_1(EF530146\|pid:none) Actinidia deliciosa cysteine prote... 185 2e-52 AP008207_3801(AP008207\|pid:none) Oryza sativa (japonica cultivar... 173 2e-52 AK059528_1(AK059528\|pid:none) Oryza sativa Japonica Group cDNA c... 173 2e-52 AC131026_2(AC131026\|pid:none) Medicago truncatula clone mth2-6e1... 173 2e-52 EF066525_1(EF066525\|pid:none) Radix peregra cathepsin-L-like cys... 174 3e-52 AF242373_1(AF242373\|pid:none) Ipomoea batatas cysteine protease ... 208 3e-52 D90407_1(D90407\|pid:none) Oryza sativa Japonica Group mRNA for o... 186 4e-52 BC153363_1(BC153363\|pid:none) Xenopus tropicalis hypothetical pr... 186 4e-52 FB844632_1(FB844632\|pid:none) Sequence 63905 from Patent WO20080... 184 5e-52 AP008210_2224(AP008210\|pid:none) Oryza sativa (japonica cultivar... 186 6e-52 AB008267_6(AB008267\|pid:none) Arabidopsis thaliana genomic DNA, ... 185 6e-52 AM502237_135(AM502237\|pid:none) Leishmania infantum chromosome 19. 190 6e-52 AM941118_1(AM941118\|pid:none) Hordeum vulgare subsp. vulgare mRN... 171 6e-52 AF093243_1(AF093243\|pid:none) Clonorchis sinensis cysteine prote... 174 6e-52 M90067_2(M90067\|pid:none) Trypanosoma cruzi cysteine proteinase ... 177 8e-52 AF242372_1(AF242372\|pid:none) Ipomoea batatas cysteine protease ... 176 1e-51 DQ346210_1(DQ346210\|pid:none) Clonorchis sinensis cysteine prote... 174 1e-51 (Q26534) RecName: Full=Cathepsin L; EC=3.4.22.15; AltNa... 181 1e-51 FN357367_30(FN357367\|pid:none) Schistosoma mansoni genome sequen... 181 1e-51 FN357367_32(FN357367\|pid:none) Schistosoma mansoni genome sequen... 181 1e-51 AB092557_1(AB092557\|pid:none) Glycine max CysP2 mRNA for cystein... 182 1e-51 AF004593_1(AF004593\|pid:none) Leishmania donovani chagasi promas... 189 1e-51 CP000590_119(CP000590\|pid:none) Ostreococcus lucimarinus CCE9901... 206 2e-51 AB109187_1(AB109187\|pid:none) Helianthus annuus scp2 mRNA for cy... 181 2e-51 AY192360_1(AY192360\|pid:none) Trifolium repens cysteine protease... 171 2e-51 AB369066_1(AB369066\|pid:none) Triticum aestivum mRNA for tritica... 181 3e-51 AB098631_1(AB098631\|pid:none) Daucus carota DcCysP8 mRNA for cys... 184 3e-51 U69120_1(U69120\|pid:none) Paragonimus westermani cysteine protei... 174 3e-51 EF530134_1(EF530134\|pid:none) Actinidia deliciosa actinidin Act2... 174 3e-51 AY504966_1(AY504966\|pid:none) Iris hollandica putative cysteine ... 176 3e-51 AC135231_14(AC135231\|pid:none) Medicago truncatula clone mth2-28... 189 4e-51 EU573775_1(EU573775\|pid:none) Mucuna pruriens mucunain mRNA, com... 181 5e-51 AB300460_1(AB300460\|pid:none) Lotus japonicus LjCyp2 mRNA for cy... 175 5e-51 DQ459303_1(DQ459303\|pid:none) Aedes aegypti cathepsin L (CAT-L1)... 190 5e-51 (Q9VN93) RecName: Full=Putative cysteine proteinase CG12163; ... 184 7e-51 AE014297_190(AE014297\|pid:none) Drosophila melanogaster chromoso... 184 7e-51 EF147075_1(EF147075\|pid:none) Populus trichocarpa clone WS01227_... 174 9e-51 DQ909012_1(DQ909012\|pid:none) Clonorchis sinensis cysteine prote... 171 9e-51 S57776(S57776) cysteine proteinase (EC 3.4.22.-) - clove pink (f... 183 1e-50 AY363263_1(AY363263\|pid:none) Triatoma infestans cathepsin L-lik... 179 1e-50 FB844666_1(FB844666\|pid:none) Sequence 63939 from Patent WO20080... 183 2e-50 AB300459_1(AB300459\|pid:none) Lotus japonicus LjCyp1 mRNA for cy... 185 2e-50 AC140034_6(AC140034\|pid:none) Medicago truncatula clone mth2-17g... 189 2e-50 AY192365_1(AY192365\|pid:none) Trifolium repens cysteine protease... 186 2e-50 EU964144_1(EU964144\|pid:none) Zea mays clone 276186 cysteine pro... 177 3e-50 FB844656_1(FB844656\|pid:none) Sequence 63929 from Patent WO20080... 177 3e-50 FN357367_31(FN357367\|pid:none) Schistosoma mansoni genome sequen... 181 3e-50 BT071400_1(BT071400\|pid:none) Picea sitchensis clone WS0287_F07 ... 177 3e-50 AF115280_1(AF115280\|pid:none) Sarcocystis muris thiolproteinase ... 170 3e-50 FJ467290_1(FJ467290\|pid:none) Sphenophorus levis midgut cysteine... 178 3e-50 AF093242_1(AF093242\|pid:none) Clonorchis sinensis cystein protea... 169 3e-50 DQ474246_1(DQ474246\|pid:none) Lygus lineolaris cathepsin-L mRNA,... 187 3e-50 AB098629_1(AB098629\|pid:none) Daucus carota DcCysP6 mRNA for cys... 177 3e-50 FB844668_1(FB844668\|pid:none) Sequence 63941 from Patent WO20080... 177 3e-50 D82884_1(D82884\|pid:none) Sitophilus zeamais mRNA for cysteine p... 188 3e-50 AK153417_1(AK153417\|pid:none) Mus musculus bone marrow macrophag... 192 4e-50 EF622020_1(EF622020\|pid:none) Elaeis guineensis cysteine protein... 182 6e-50 AY171099_1(AY171099\|pid:none) Gossypium hirsutum cysteine protea... 160 6e-50 AM941119_1(AM941119\|pid:none) Hordeum vulgare subsp. vulgare mRN... 170 6e-50 EF053509_1(EF053509\|pid:none) Acanthamoeba castellanii cysteine ... 184 7e-50 AL049659_11(AL049659\|pid:none) Arabidopsis thaliana DNA chromoso... 180 1e-49 AM471605_1(AM471605\|pid:none) Vitis vinifera contig VV78X053392.... 172 1e-49 AK011589_1(AK011589\|pid:none) Mus musculus 10 days embryo whole ... 191 1e-49 JC4848(JC4848) cysteine proteinase (EC 3.4.22.-) - Douglas fir ... 170 1e-49 CR855072_10(CR855072\|pid:none) Oryza sativa genomic DNA, chromos... 176 1e-49 (P06797) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 190 1e-49 AK147142_1(AK147142\|pid:none) Mus musculus cDNA, RIKEN full-leng... 190 1e-49 AY333292_1(AY333292\|pid:none) Branchiostoma lanceolatum isolate ... 189 1e-49 (Q7XR52) RecName: Full=Cysteine protease 1; EC=3.4.22.-... 180 2e-49 CR855078_5(CR855078\|pid:none) Oryza sativa genomic DNA, chromoso... 173 2e-49 AF121837_1(AF121837\|pid:none) Mus musculus cell-line L929 cathep... 190 2e-49 AK161538_1(AK161538\|pid:none) Mus musculus 11 days pregnant adul... 190 2e-49 AY273802_1(AY273802\|pid:none) Clonorchis sinensis cysteine prote... 167 2e-49 EF084924_1(EF084924\|pid:none) Picea sitchensis clone WS02718_H19... 172 3e-49 AB092555_1(AB092555\|pid:none) Glycine max CysP1 mRNA for cystein... 179 3e-49 AF542132_1(AF542132\|pid:none) Theromyzon tessulatum cathepsin L ... 183 3e-49 AL606590_11(AL606590\|pid:none) Oryza sativa genomic DNA, chromos... 173 3e-49 AY333297_1(AY333297\|pid:none) Branchiostoma lanceolatum isolate ... 189 3e-49 AF194426_1(AF194426\|pid:none) Myxine glutinosa clone hicl20 cyst... 182 3e-49 DQ346205_1(DQ346205\|pid:none) Clonorchis sinensis cysteine prote... 165 3e-49 AJ420285_1(AJ420285\|pid:none) Leishmania infantum cpa gene for c... 185 4e-49 AY604196_1(AY604196\|pid:none) Gossypium hirsutum putative cystei... 172 4e-49 AK165397_1(AK165397\|pid:none) Mus musculus adult male kidney cDN... 189 4e-49 DQ459304_1(DQ459304\|pid:none) Aedes aegypti cathepsin L (CAT-L2)... 173 4e-49 AF194427_1(AF194427\|pid:none) Myxine glutinosa clone hicl22 cyst... 182 4e-49 EF530135_1(EF530135\|pid:none) Actinidia eriantha actinidin Act2b... 168 5e-49 BT052642_1(BT052642\|pid:none) Medicago truncatula clone MTYFD_FE... 175 5e-49 AC135231_17(AC135231\|pid:none) Medicago truncatula clone mth2-28... 185 5e-49 EF134218_1(EF134218\|pid:none) Noctiluca scintillans isolate Nsc-... 171 5e-49 AY333293_1(AY333293\|pid:none) Branchiostoma lanceolatum isolate ... 187 5e-49 AY850168_1(AY850168\|pid:none) Cloning vector pQ-CPB recombinant ... 173 5e-49 AY336798_1(AY336798\|pid:none) Rhipicephalus haemaphysaloides hae... 197 6e-49 AM494945_81(AM494945\|pid:none) Leishmania braziliensis chromosom... 172 6e-49 AY333294_1(AY333294\|pid:none) Branchiostoma lanceolatum isolate ... 187 6e-49 T08845(T08845) cysteine proteinase (EC 3.4.22.-) isoform A - soy... 197 7e-49 FN314156_1(FN314156\|pid:none) Schistosoma japonicum isolate Anhu... 179 8e-49 EF530144_1(EF530144\|pid:none) Actinidia deliciosa cysteine prote... 178 1e-48 AM494945_83(AM494945\|pid:none) Leishmania braziliensis chromosom... 172 1e-48 AM494945_82(AM494945\|pid:none) Leishmania braziliensis chromosom... 172 1e-48 KHRTL(S07098;S00155;S02445;A41550;S02446)cathepsin L (EC 3.4.22.... 187 1e-48 Y00697_1(Y00697\|pid:none) Rat mRNA for cathepsin L (EC 3.4.22.15). 186 1e-48 DQ016548_1(DQ016548\|pid:none) Paragonimus westermani cysteine pr... 173 1e-48 AF019147_1(AF019147\|pid:none) Zea mays cysteine proteinase Mir3 ... 177 1e-48 BT059194_1(BT059194\|pid:none) Salmo salar clone ssal-rgf-531-315... 173 1e-48 AY814043_1(AY814043\|pid:none) Schistosoma japonicum SJCHGC00511 ... 178 1e-48 BC165744_1(BC165744\|pid:none) Danio rerio cathepsin F, mRNA (cDN... 173 2e-48 BC124243_1(BC124243\|pid:none) Danio rerio cathepsin F, mRNA (cDN... 173 2e-48 BC120003_1(BC120003\|pid:none) Bos taurus cathepsin F, mRNA (cDNA... 169 2e-48 (O65039) RecName: Full=Vignain; EC=3.4.22.-; AltName: F... 178 2e-48 AF538038_1(AF538038\|pid:none) Leishmania mexicana amazonensis cy... 179 2e-48 AF454960_1(AF454960\|pid:none) Brassica oleracea senescence-assoc... 169 2e-48 AB081844_1(AB081844\|pid:none) Engraulis japonicus aCat2 mRNA for... 183 2e-48 AF510740_1(AF510740\|pid:none) Schistosoma japonicum cathepsin L1... 177 2e-48 AY192362_1(AY192362\|pid:none) Trifolium repens cysteine protease... 183 2e-48 D31970_1(D31970\|pid:none) Fruitfly DNA for cysteine proteinase-1... 195 3e-48 S67481(S67481)cathepsin L-like cysteine proteinase (EC 3.4.22.-)... 195 3e-48 AF016448_1(AF016448\|pid:none) Caenorhabditis elegans cosmid F41E... 175 3e-48 AF454956_1(AF454956\|pid:none) Brassica oleracea senescence-assoc... 176 3e-48 DQ209288_1(DQ209288\|pid:none) Brassica napus cysteine protease m... 169 3e-48 BT082380_1(BT082380\|pid:none) Anoplopoma fimbria clone afim-evh-... 182 4e-48 U70537_1(U70537\|pid:none) Paragonimus westermani pre-procathepsi... 164 4e-48 JX0366(JX0366;S13208) cysteine endopeptidase (EC 3.4.22.-) precu... 194 5e-48 L25130_1(L25130\|pid:none) Trypanosoma congolense cysteine protea... 167 5e-48 EF147908_1(EF147908\|pid:none) Populus trichocarpa clone WS0125_O... 164 7e-48 EF530142_1(EF530142\|pid:none) Actinidia deliciosa cysteine prote... 173 7e-48 FB844624_1(FB844624\|pid:none) Sequence 63897 from Patent WO20080... 169 7e-48 (P80884) RecName: Full=Ananain; EC=3.4.22.31; Flags: Pr... 161 7e-48 BT082794_1(BT082794\|pid:none) Anoplopoma fimbria clone afim-evh-... 181 7e-48 S37048(S37048)cysteine proteinase - Trypanosoma congolense 166 9e-48 Z25813_1(Z25813\|pid:none) T.congolense mRNA for (prepro) cystein... 166 9e-48 AF099203_1(AF099203\|pid:none) Oryza sativa cysteine endopeptidas... 175 9e-48 (P12412) RecName: Full=Vignain; EC=3.4.22.-; AltName: F... 175 9e-48 DQ346206_1(DQ346206\|pid:none) Clonorchis sinensis cysteine prote... 160 9e-48 EF428205_1(EF428205\|pid:none) Ixodes ricinus cathepsin L-like cy... 193 1e-47 AY973616_1(AY973616\|pid:none) Manihot esculenta cysteine proteas... 169 1e-47 EF068256_1(EF068256\|pid:none) Spodoptera exigua cathepsin L-like... 193 1e-47 BT084384_1(BT084384\|pid:none) Zea mays full-length cDNA clone ZM... 177 1e-47 AB098625_1(AB098625\|pid:none) Daucus carota DcCysP2 mRNA for cys... 167 1e-47 (Q8RWQ9) RecName: Full=Thiol protease aleurain-like; EC... 166 1e-47 AY373973_1(AY373973\|pid:none) Helicoverpa armigera cathepsin L-l... 192 2e-47 AC130601_2(AC130601\|pid:none) Oryza sativa (japonica cultivar-gr... 174 2e-47 CT005258_153(CT005258\|pid:none) Leishmania major strain Friedlin... 175 2e-47 EU143709_1(EU143709\|pid:none) Stichopus japonicus cathepsin L mR... 183 2e-47 (P25803) RecName: Full=Vignain; EC=3.4.22.-; AltName: F... 172 3e-47 AY277910_1(AY277910\|pid:none) Branchiostoma belcheri tsingtaunes... 178 3e-47 AF182079_1(AF182079\|pid:none) Matricaria chamomilla thiol protea... 167 3e-47 BT042091_1(BT042091\|pid:none) Zea mays full-length cDNA clone ZM... 176 3e-47 AB267407_1(AB267407\|pid:none) Triticum aestivum mRNA for tritica... 162 3e-47 AM941122_1(AM941122\|pid:none) Hordeum vulgare subsp. vulgare mRN... 169 3e-47 S22502(S22502;S77955;S16251)cysteine proteinase (EC 3.4.22.-) - ... 172 3e-47 (Q91CL9) RecName: Full=Viral cathepsin; Short=V-cath; ... 166 3e-47 AF157961_1(AF157961\|pid:none) Hypera postica cysteine proteinase... 163 3e-47 AY208822_1(AY208822\|pid:none) Rhipicephalus appendiculatus midgu... 191 4e-47 AY208824_1(AY208824\|pid:none) Rhipicephalus appendiculatus midgu... 177 4e-47 AY273803_1(AY273803\|pid:none) Clonorchis sinensis cysteine prote... 154 4e-47 DQ016553_1(DQ016553\|pid:none) Paragonimus westermani cysteine pr... 164 4e-47 (P25776) RecName: Full=Oryzain alpha chain; EC=3.4.22.-... 168 6e-47 EF530132_1(EF530132\|pid:none) Actinidia arguta actinidin Act1b m... 170 6e-47 AB163417_1(AB163417\|pid:none) Brugia malayi mRNA for cahepsin L-... 171 6e-47 FJ040840_1(FJ040840\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 191 7e-47 (Q9UBX1) RecName: Full=Cathepsin F; Short=CATSF; ... 168 7e-47 GQ180933_1(GQ180933\|pid:none) Leishmania guyanensis cysteine pro... 170 7e-47 T03941(T03941) cysteine proteinase (EC 3.4.22.-) precursor - com... 172 7e-47 U49445_1(U49445\|pid:none) Vigna radiata cysteinyl endopeptidase ... 173 7e-47 AK118509_1(AK118509\|pid:none) Arabidopsis thaliana At3g19400 mRN... 172 7e-47 BT000674_1(BT000674\|pid:none) Arabidopsis thaliana clone RAFL05-... 165 7e-47 AC135160_1(AC135160\|pid:none) Medicago truncatula clone mth2-20m... 169 7e-47 AF071748_1(AF071748\|pid:none) Homo sapiens cathepsin F (CATSF) m... 168 7e-47 DQ902586_1(DQ902586\|pid:none) Clonorchis sinensis clone cs007a08... 153 7e-47 BT019598_1(BT019598\|pid:none) Synthetic construct Homo sapiens c... 167 9e-47 BT042417_1(BT042417\|pid:none) Zea mays full-length cDNA clone ZM... 177 1e-46 EU106630_1(EU106630\|pid:none) Tyrophagus putrescentiae cathepsin... 175 1e-46 AF197480_1(AF197480\|pid:none) Mus musculus strain C57BL/6 cathep... 169 1e-46 AY504967_1(AY504967\|pid:none) Iris hollandica putative cysteine ... 169 1e-46 DQ909015_1(DQ909015\|pid:none) Clonorchis sinensis cysteine prote... 154 1e-46 AM494956_169(AM494956\|pid:none) Leishmania braziliensis chromoso... 189 2e-46 BC099780_1(BC099780\|pid:none) Rattus norvegicus cathepsin F, mRN... 167 2e-46 (Q05094) RecName: Full=Cysteine proteinase 2; EC=3.4.22... 174 2e-46 DQ356054_1(DQ356054\|pid:none) Tenebrio molitor clone AM4-22 puta... 176 2e-46 AP009046_29(AP009046\|pid:none) Hyphantria cunea nucleopolyhedrov... 163 2e-46 AF136279_1(AF136279\|pid:none) Homo sapiens cathepsin F precursor... 166 2e-46 AK072235_1(AK072235\|pid:none) Oryza sativa Japonica Group cDNA c... 177 2e-46 EF213115_1(EF213115\|pid:none) Penaeus monodon cathepsin L mRNA, ... 189 3e-46 EF530145_1(EF530145\|pid:none) Actinidia deliciosa cysteine prote... 166 3e-46 (P36400) RecName: Full=Cysteine proteinase B; EC=3.4.22... 173 3e-46 EF530139_1(EF530139\|pid:none) Actinidia eriantha actinidin Act4a... 164 3e-46 (A5HII1) RecName: Full=Actinidain; Short=Actinidin; ... 165 3e-46 DQ016550_1(DQ016550\|pid:none) Paragonimus westermani cysteine pr... 159 3e-46 DQ016552_1(DQ016552\|pid:none) Paragonimus westermani cysteine pr... 162 3e-46 AF019146_1(AF019146\|pid:none) Zea mays cysteine proteinase Mir2 ... 172 4e-46 L36204_1(L36204\|pid:none) Dictyostelium discoideum cysteine prot... 152 4e-46 AB109189_1(AB109189\|pid:none) Helianthus annuus scp4 mRNA for cy... 156 4e-46 (P43156) RecName: Full=Thiol protease SEN102; EC=3.4.22... 171 5e-46 AJ319727_1(AJ319727\|pid:none) Leishmania mexicana cpb2 gene. 172 5e-46 CR541680_1(CR541680\|pid:none) Homo sapiens full open reading fra... 165 5e-46 (Q9WGE0) RecName: Full=Viral cathepsin; Short=V-cath; ... 161 5e-46 AY821800_1(AY821800\|pid:none) Opisthorchis viverrini cysteine pr... 159 5e-46 AB363729_1(AB363729\|pid:none) Platycodon grandiflorus PgCP2 mRNA... 164 6e-46 (Q9GKL8) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 178 6e-46 AJ784223_1(AJ784223\|pid:none) Suberites domuncula mRNA for cathe... 157 6e-46 S47432(S47432;A48398) cathepsin L (EC 3.4.22.15) - Norway lobste... 174 6e-46 DQ667143_1(DQ667143\|pid:none) Diaprepes abbreviatus cathepsin L ... 163 6e-46 AJ489298_1(AJ489298\|pid:none) Aphis gossypii mRNA for putative c... 187 8e-46 FJ917405_1(FJ917405\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 187 8e-46 FJ040835_1(FJ040835\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 187 8e-46 FJ917408_1(FJ917408\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 187 8e-46 M38422_1(M38422\|pid:none) Actinidia deliciosa actinidin gene, co... 164 8e-46 BC080004_1(BC080004\|pid:none) Xenopus laevis MGC81823 protein, m... 175 8e-46 (P13277) RecName: Full=Digestive cysteine proteinase 1; ... 176 8e-46 DQ459306_1(DQ459306\|pid:none) Aedes aegypti cathepsin L (CAT-L4)... 184 8e-46 AY522332_31(AY522332\|pid:none) Agrotis segetum granulovirus, com... 153 1e-45 FJ917406_1(FJ917406\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 186 2e-45 AL132953_7(AL132953\|pid:none) Arabidopsis thaliana DNA chromosom... 159 2e-45 AY004155_1(AY004155\|pid:none) Haemonchus contortus cathepsin L c... 173 2e-45 (Q40143) RecName: Full=Cysteine proteinase 3; EC=3.4.22... 164 2e-45 DQ356053_1(DQ356053\|pid:none) Tenebrio molitor clone AM3-32 puta... 174 2e-45 AF271091_1(AF271091\|pid:none) Clonorchis sinensis cysteine prote... 149 2e-45 FB844650_1(FB844650\|pid:none) Sequence 63923 from Patent WO20080... 172 2e-45 AF190653_1(AF190653\|pid:none) Diabrotica virgifera virgifera cat... 167 2e-45 FJ040836_1(FJ040836\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 185 3e-45 FJ917404_1(FJ917404\|pid:none) Trypanosoma cruzi isolate MHOM/CO/... 185 3e-45 EF087762_1(EF087762\|pid:none) Picea sitchensis clone WS02745_M21... 160 3e-45 AB032168_1(AB032168\|pid:none) Nicotiana tabacum NTCP-23 mRNA for... 162 3e-45 AF136272_1(AF136272\|pid:none) Mus musculus cathepsin J precursor... 169 3e-45 AB331915_1(AB331915\|pid:none) Brassica oleracea var. italica BoC... 160 3e-45 AF309626_1(AF309626\|pid:none) Leishmania donovani clone Ld-A cys... 169 4e-45 (Q10717) RecName: Full=Cysteine proteinase 2; EC=3.4.22... 165 4e-45 JC7787(JC7787)carrot seed cysteine proteinase (EC 3.4.-.-), CSCP... 168 4e-45 T31871(T31871)hypothetical protein F41E6.6 - Caenorhabditis eleg... 164 5e-45 AL606692_8(AL606692\|pid:none) Oryza sativa genomic DNA, chromoso... 161 5e-45 S29245(S29245;S61559;S25003) cysteine proteinase (EC 3.4.22.-) p... 169 5e-45 Y09958_1(Y09958\|pid:none) L.mexicana cpb18 gene. 169 5e-45 BT033703_1(BT033703\|pid:none) Zea mays full-length cDNA clone ZM... 165 5e-45 AC002341_11(AC002341\|pid:none) Arabidopsis thaliana chromosome 2... 165 5e-45 BT057383_1(BT057383\|pid:none) Salmo salar clone ssal-evf-519-083... 160 5e-45 DQ084022_1(DQ084022\|pid:none) Nicotiana benthamiana cysteine pro... 162 7e-45 AF412313_1(AF412313\|pid:none) Haemonchus contortus cathepsin L c... 173 7e-45 (P14080) RecName: Full=Chymopapain; EC=3.4.22.6; AltNam... 149 7e-45 AY893779_1(AY893779\|pid:none) Synthetic construct Homo sapiens c... 175 7e-45 (P07711) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 175 7e-45 AB010923_1(AB010923\|pid:none) Fasciola gigantica FhCL gene for c... 173 7e-45 AF239265_1(AF239265\|pid:none) Fasciola gigantica cathepsin L (ca... 166 7e-45 AJ496197_1(AJ496197\|pid:none) Myzus persicae mRNA for putative c... 184 9e-45 EU961973_1(EU961973\|pid:none) Zea mays clone 239400 thiol protea... 164 9e-45 FB844524_1(FB844524\|pid:none) Sequence 63797 from Patent WO20080... 158 9e-45 AY890446_1(AY890446\|pid:none) Synthetic construct Homo sapiens c... 175 9e-45 EF536899_1(EF536899\|pid:none) Fasciola gigantica cathepsin (cat-... 169 9e-45 EF488012_1(EF488012\|pid:none) Dermestes frischii digestive cyste... 183 1e-44 FB844652_1(FB844652\|pid:none) Sequence 63925 from Patent WO20080... 170 1e-44 BT058408_1(BT058408\|pid:none) Salmo salar clone Contig454 Cathep... 159 1e-44 AY277628_1(AY277628\|pid:none) Fasciola hepatica cathepsin L mRNA... 169 1e-44 DQ016547_1(DQ016547\|pid:none) Paragonimus westermani cysteine pr... 156 1e-44 AP008218_648(AP008218\|pid:none) Oryza sativa (japonica cultivar-... 160 1e-44 AY126713_1(AY126713\|pid:none) Metapenaeus ensis cathepsin L prec... 183 1e-44 AY126712_1(AY126712\|pid:none) Metapenaeus ensis cathepsin L prec... 183 1e-44 AB248269_1(AB248269\|pid:none) Echinococcus multilocularis EmCLP1... 174 1e-44 BT081306_1(BT081306\|pid:none) Caligus clemensi clone ccle-evs-50... 157 1e-44 EU965926_1(EU965926\|pid:none) Zea mays clone 290066 vignain prec... 169 2e-44 BC074718_1(BC074718\|pid:none) Xenopus tropicalis MGC69486 protei... 169 2e-44 DQ904526_1(DQ904526\|pid:none) Neobenedenia melleni cathepsin L-l... 166 2e-44 AF510856_1(AF510856\|pid:none) Fasciola gigantica cathepsin L2 mR... 168 2e-44 EU835857_1(EU835857\|pid:none) Fasciola hepatica clone 22e06 cath... 167 2e-44 Z34895_1(Z34895\|pid:none) V.sativa L. (PROT A) mRNA for cysteine... 164 2e-44 AF239264_1(AF239264\|pid:none) Fasciola gigantica cathepsin L (ca... 169 2e-44 AY251055_1(AY251055\|pid:none) Anthurium andraeanum senescence-as... 169 3e-44 AJ628942_2(AJ628942\|pid:none) Leishmania infantum hd gene for hi... 166 3e-44 FB844540_1(FB844540\|pid:none) Sequence 63813 from Patent WO20080... 160 3e-44 AF358668_1(AF358668\|pid:none) Oncorhynchus mykiss procathepsin L... 158 3e-44 EU835858_1(EU835858\|pid:none) Fasciola hepatica clone 21e10 cath... 167 3e-44 AY519971_1(AY519971\|pid:none) Fasciola hepatica clone Porto 1 ca... 167 3e-44 EU966324_1(EU966324\|pid:none) Zea mays clone 293605 cysteine pro... 182 3e-44 AY700587_1(AY700587\|pid:none) Zingiber officinale cysteine prote... 164 4e-44 U31094_1(U31094\|pid:none) Petunia hybrida thiol protease homolog... 160 4e-44 AB109188_1(AB109188\|pid:none) Helianthus annuus scp3 mRNA for cy... 169 4e-44 AB081845_1(AB081845\|pid:none) Engraulis japonicus aCatL mRNA for... 162 4e-44 BC152236_1(BC152236\|pid:none) Danio rerio similar to cathepsin L... 161 4e-44 AB331922_1(AB331922\|pid:none) Brassica rapa var. perviridis BrCP... 181 4e-44 EF070511_1(EF070511\|pid:none) Maconellicoccus hirsutus clone WHM... 181 4e-44 BT083851_1(BT083851\|pid:none) Zea mays full-length cDNA clone ZM... 181 4e-44 AJ004958_1(AJ004958\|pid:none) Pisum sativum mRNA for TPE4A thiol... 160 5e-44 AM488912_1(AM488912\|pid:none) Vitis vinifera contig VV78X019368.... 158 5e-44 BT033743_1(BT033743\|pid:none) Zea mays full-length cDNA clone ZM... 171 5e-44 AJ278699_1(AJ278699\|pid:none) Pisum sativum mRNA for protease (e... 160 5e-44 AF493233_1(AF493233\|pid:none) Lycopersicon pennellii cysteine pr... 155 5e-44 AF309627_1(AF309627\|pid:none) Leishmania donovani clone Ld-F cys... 164 7e-44 AY815453_1(AY815453\|pid:none) Schistosoma japonicum SJCHGC06231 ... 174 7e-44 FB844508_1(FB844508\|pid:none) Sequence 63781 from Patent WO20080... 163 7e-44 (Q9PYY5) RecName: Full=Viral cathepsin; Short=V-cath; ... 157 7e-44 FB844530_1(FB844530\|pid:none) Sequence 63803 from Patent WO20080... 169 9e-44 FB844594_1(FB844594\|pid:none) Sequence 63867 from Patent WO20080... 169 9e-44 EF530141_1(EF530141\|pid:none) Actinidia deliciosa cysteine prote... 160 9e-44 CT005247_102(CT005247\|pid:none) Leishmania major strain Friedlin... 164 9e-44 EU965545_1(EU965545\|pid:none) Zea mays clone 286773 thiol protea... 148 9e-44 AC140545_20(AC140545\|pid:none) Medicago truncatula clone mth2-11... 162 9e-44 FJ772427_1(FJ772427\|pid:none) Lutjanus argentimaculatus cathepsi... 163 9e-44 BC075887_1(BC075887\|pid:none) Danio rerio cathepsin L.1, mRNA (c... 180 9e-44 (P25784) RecName: Full=Digestive cysteine proteinase 3; ... 180 9e-44 AB004648_1(AB004648\|pid:none) Oryza sativa Japonica Group RepA g... 180 9e-44 S24602(S24602) cysteine proteinase tpp (EC 3.4.22.-) - garden pe... 161 1e-43 DQ071678_1(DQ071678\|pid:none) Leishmania aethiopica cysteine pro... 163 1e-43 AK228746_1(AK228746\|pid:none) Arabidopsis thaliana mRNA for puta... 160 1e-43 AF089849_1(AF089849\|pid:none) Brassica napus senescence-specific... 155 1e-43 AB331921_1(AB331921\|pid:none) Brassica rapa var. perviridis BrCy... 155 1e-43 CT005247_104(CT005247\|pid:none) Leishmania major strain Friedlin... 162 2e-43 DQ909016_1(DQ909016\|pid:none) Clonorchis sinensis cathepsin L-li... 167 2e-43 EU958268_1(EU958268\|pid:none) Zea mays clone 1682434 thiol prote... 155 2e-43 FB844660_1(FB844660\|pid:none) Sequence 63933 from Patent WO20080... 150 2e-43 DQ667144_1(DQ667144\|pid:none) Diaprepes abbreviatus cathepsin L ... 179 2e-43 FN357489_8(FN357489\|pid:none) Schistosoma mansoni genome sequenc... 173 2e-43 BC152284_1(BC152284\|pid:none) Danio rerio similar to cathepsin L... 161 2e-43 (Q8B9D5) RecName: Full=Viral cathepsin; Short=V-cath; ... 157 2e-43 AB306512_1(AB306512\|pid:none) Plautia stali mRNA for cathepsin L... 179 2e-43 Y13924_1(Y13924\|pid:none) Penaeus vannamei cathepsin L gene. 179 2e-43 CT005247_107(CT005247\|pid:none) Leishmania major strain Friedlin... 162 3e-43 AY394490_74(AY394490\|pid:none) Leucania separata nuclear polyhed... 156 3e-43 CT005247_105(CT005247\|pid:none) Leishmania major strain Friedlin... 162 3e-43 CT005247_106(CT005247\|pid:none) Leishmania major strain Friedlin... 162 3e-43 DQ631808_1(DQ631808\|pid:none) Lycopersicon esculentum phytophtho... 151 3e-43 EF015467_1(EF015467\|pid:none) Hippoglossus hippoglossus cathepsi... 162 3e-43 BC152283_1(BC152283\|pid:none) Danio rerio wu:fa26c03, mRNA (cDNA... 159 3e-43 AB091670_1(AB091670\|pid:none) Pandalus borealis PbCtL mRNA for c... 179 3e-43 (Q94504) RecName: Full=Cysteine proteinase 7; EC=3.4.22... 144 3e-43 BC153504_1(BC153504\|pid:none) Danio rerio similar to cathepsin L... 159 4e-43 U85983_1(U85983\|pid:none) Clonorchis sinensis cysteine proteinas... 167 4e-43 AF410881_1(AF410881\|pid:none) Frankliniella occidentalis cystein... 178 4e-43 AF147207_1(AF147207\|pid:none) Artemia franciscana cathepsin L-li... 178 4e-43 AY795054_1(AY795054\|pid:none) Artemia franciscana cathepsin L pr... 178 4e-43 EU659123_1(EU659123\|pid:none) Bursaphelenchus xylophilus catheps... 178 4e-43 AY528230_1(AY528230\|pid:none) Leptinotarsa decemlineata clone In... 158 5e-43 D38533_1(D38533\|pid:none) Ananas comosus mRNA for FB22 precursor... 178 5e-43 AF410883_1(AF410883\|pid:none) Frankliniella occidentalis cystein... 178 5e-43 (Q3T0I2) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 147 6e-43 (Q24940) RecName: Full=Cathepsin L-like proteinase; EC=... 162 6e-43 L33772_1(L33772\|pid:none) Fasciola hepatica cathepsin L-like pro... 162 6e-43 D14058_1(D14058\|pid:none) Ananas comosus mRNA for bromelain, com... 177 6e-43 D14057_1(D14057\|pid:none) Ananas comosus mRNA for bromelain, com... 177 6e-43 CT005247_108(CT005247\|pid:none) Leishmania major strain Friedlin... 161 8e-43 EU915299_1(EU915299\|pid:none) Ictalurus punctatus cathepsin L mR... 165 8e-43 AY662991_1(AY662991\|pid:none) Petunia x hybrida cysteine protein... 177 8e-43 AF454958_1(AF454958\|pid:none) Brassica oleracea senescence-assoc... 177 8e-43 DQ286773_1(DQ286773\|pid:none) Leishmania tropica cysteine protea... 160 1e-42 EU022371_1(EU022371\|pid:none) Schistosoma mansoni cathepsin L3 p... 171 1e-42 BC066490_1(BC066490\|pid:none) Danio rerio cathepsin L, a, mRNA (... 158 1e-42 FJ654709_1(FJ654709\|pid:none) Chrysomela tremulae cysteine prote... 149 1e-42 KHCHL(S00081;A25654;A26818;B25654)cathepsin L (EC 3.4.22.15) - c... 177 1e-42 U38475_1(U38475\|pid:none) Schistosoma japonicum cathepsin L mRNA... 177 1e-42 BT080951_1(BT080951\|pid:none) Caligus clemensi clone ccle-evs-50... 177 1e-42 AP005312_1(AP005312\|pid:none) Oryza sativa Japonica Group genomi... 153 1e-42 AY126275_28(AY126275\|pid:none) Mamestra configurata nucleopolyhe... 159 1e-42 CT025745_2(CT025745\|pid:none) Zebrafish DNA sequence from clone ... 158 1e-42 BC093339_1(BC093339\|pid:none) Danio rerio cathepsin S, b.2, mRNA... 176 1e-42 AK226753_1(AK226753\|pid:none) Arabidopsis thaliana mRNA for papa... 167 2e-42 EU839994_23(EU839994\|pid:none) Agrotis ipsilon multiple nucleopo... 165 2e-42 EU953276_1(EU953276\|pid:none) Zea mays clone 1395613 thiol prote... 146 2e-42 EF035042_19(EF035042\|pid:none) Spodoptera frugiperda MNPV isolat... 162 2e-42 EU258200_19(EU258200\|pid:none) Spodoptera frugiperda MNPV isolat... 162 2e-42 AK312806_1(AK312806\|pid:none) Homo sapiens cDNA, FLJ93235, highl... 169 2e-42 AY428949_1(AY428949\|pid:none) Fasciola gigantica cathepsin L (ca... 161 2e-42 AF388175_1(AF388175\|pid:none) Arabidopsis thaliana papain-like c... 166 3e-42 BC108031_1(BC108031\|pid:none) Danio rerio cathepsin L, 1 b, mRNA... 157 3e-42 (Q8HY81) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 175 3e-42 AK075100_1(AK075100\|pid:none) Homo sapiens cDNA FLJ90619 fis, cl... 175 3e-42 AB098630_1(AB098630\|pid:none) Daucus carota DcCysP7 mRNA for cys... 175 3e-42 BT047054_1(BT047054\|pid:none) Salmo salar clone ssal-evf-540-233... 151 3e-42 EF144889_1(EF144889\|pid:none) Populus trichocarpa clone WS01119_... 158 4e-42 (P00786) RecName: Full=Cathepsin H; EC=3.4.22.16; AltNa... 149 4e-42 EU287918_1(EU287918\|pid:none) Fasciola hepatica cathepsin L6 (CL... 155 4e-42 (P09648) RecName: Full=Cathepsin L1; EC=3.4.22.15; Cont... 175 4e-42 EF670319_1(EF670319\|pid:none) Artemia persimilis cathepsin L-1 (... 175 4e-42 AY057110_1(AY057110\|pid:none) Dictyocaulus viviparus cathepsin L... 175 4e-42 (P25975) RecName: Full=Cathepsin L1; EC=3.4.22.15; Cont... 175 4e-42 AC149578_26(AC149578\|pid:none) Medicago truncatula clone mth2-94... 143 5e-42 AC079022_10(AC079022\|pid:none) Oryza sativa chromosome 5 clone P... 174 5e-42 AJ249847_1(AJ249847\|pid:none) Lolium multiflorum mRNA for cystei... 154 6e-42 EF535003_1(EF535003\|pid:none) Misgurnus mizolepis cathepsin L mR... 159 6e-42 U62289_1(U62289\|pid:none) Fasciola hepatica secreted cathepsin L... 161 6e-42 AY333299_1(AY333299\|pid:none) Petromyzon marinus isolate Pema-ca... 174 7e-42 AJ130942_1(AJ130942\|pid:none) Leishmania major (MRHO/IR/75/ER), ... 174 7e-42 EF576485_1(EF576485\|pid:none) Oryza sativa (indica cultivar-grou... 159 8e-42 AC021043_21(AC021043\|pid:none) Arabidopsis thaliana chromosome I... 156 8e-42 AB016870_9(AB016870\|pid:none) Arabidopsis thaliana genomic DNA, ... 147 8e-42 FM201283_1(FM201283\|pid:none) Gomphocarpus fruticosus subsp. fru... 143 8e-42 DQ842221_1(DQ842221\|pid:none) Ichthyophthirius multifiliis cathe... 158 8e-42 EU287916_1(EU287916\|pid:none) Fasciola hepatica cathepsin L4 (CL... 164 8e-42 (P43297) RecName: Full=Cysteine proteinase RD21a; Short... 174 9e-42 AY039606_1(AY039606\|pid:none) Arabidopsis thaliana F2G19.31/F2G1... 174 9e-42 BT071384_1(BT071384\|pid:none) Picea sitchensis clone WS0285_P02 ... 159 1e-41 EU287917_1(EU287917\|pid:none) Fasciola hepatica cathepsin L4 (CL... 160 1e-41 EF611824_1(EF611824\|pid:none) Fasciola hepatica secreted catheps... 160 1e-41 AY573569_1(AY573569\|pid:none) Fasciola hepatica strain Firat cat... 159 1e-41 Y14734_1(Y14734\|pid:none) Homo sapiens mRNA for cathepsin L2. 173 2e-41 AJ002386_1(AJ002386\|pid:none) Mus musculus mRNA for cathepsin S. 173 2e-41 AF038546_1(AF038546\|pid:none) Mus musculus cathepsin S precursor... 173 2e-41 AF071801_1(AF071801\|pid:none) Paragonimus westermani cysteine pr... 173 2e-41 BC142983_1(BC142983\|pid:none) Homo sapiens cathepsin L1, mRNA (c... 173 2e-41 AK153540_1(AK153540\|pid:none) Mus musculus bone marrow macrophag... 173 2e-41 AM941123_1(AM941123\|pid:none) Hordeum vulgare subsp. vulgare mRN... 157 2e-41 EU591746_49(EU591746\|pid:none) Adoxophyes orana nucleopolyhedrov... 155 2e-41 AB009306_1(AB009306\|pid:none) Fasciola hepatica mRNA for catheps... 162 2e-41 (O70370) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 172 2e-41 AK028366_1(AK028366\|pid:none) Mus musculus 18 days pregnant adul... 172 2e-41 AM941124_1(AM941124\|pid:none) Hordeum vulgare subsp. vulgare mRN... 161 2e-41 AY891889_1(AY891889\|pid:none) Synthetic construct Homo sapiens c... 145 2e-41 AY893780_1(AY893780\|pid:none) Synthetic construct Homo sapiens c... 145 2e-41 (P09668) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 145 2e-41 >(P04988) RecName: Full=Cysteine proteinase 1; EC=3.4.22.-; Flags: Precursor; Length = 343 Score = 330 bits (845), Expect = 1e-88 Identities = 153/230 (66%), Positives = 183/230 (79%), Gaps = 7/230 (3%) Frame = +1 Query: 562 WFN*IPTRYS-----RLPLLKTKGQCGSCWSFSTTGNVEGQHYLSTGTLVGLSEQNLVDC 726 + N IPT + + +K +GQCGSCWSFSTTGNVEGQH++S LV LSEQNLVDC Sbjct: 114 FINSIPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDC 173 Query: 727 DHTCMTYENENVCNAGCDGGLQPNAYNYIIKNGGIQTEATYPYTAVDG-ECKFNSAQVGA 903 DH CM YE E C+ GC+GGLQPNAYNYIIKNGGIQTE++YPYTA G +C FNSA +GA Sbjct: 174 DHECMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYTAETGTQCNFNSANIGA 233 Query: 904 KISSFTMVPQNETQIASYLFNNGPLAIAADAEEWQFYMGGVFDFPCG-QTLDHGILIVGY 1080 KIS+FTM+P+NET +A Y+ + GPLAIAADA EWQFY+GGVFD PC +LDHGILIVGY Sbjct: 234 KISNFTMIPKNETVMAGYIVSTGPLAIAADAVEWQFYIGGVFDIPCNPNSLDHGILIVGY 293 Query: 1081 GAQDTIVGKNTPYWIIKNSWGADWGEAGYLKVERNTDKCGVANFVSSSIV 1230 A++TI KN PYWI+KNSWGADWGE GY+ + R + CGV+NFVS+SI+ Sbjct: 294 SAKNTIFRKNMPYWIVKNSWGADWGEQGYIYLRRGKNTCGVSNFVSTSII 343 Score = 137 bits (345), Expect = 9e-31 Identities = 73/131 (55%), Positives = 91/131 (69%), Gaps = 2/131 (1%) Frame = +2 Query: 185 MRFILFFVL-MLTALAAGRRLSVEE-SQFIAFQNKYNKIYSAEEYLVKFETFKSNLLNID 358 M+ IL FVL + T + R + +EE SQF+ FQ+K+NK YS EEYL +FE FKSNL I+ Sbjct: 1 MKVILLFVLAVFTVFVSSRGIPLEEQSQFLEFQDKFNKKYSHEEYLERFEIFKSNLGKIE 60 Query: 359 ALNKQATTIGSDTKFGVNKFADLSKEEFKKYYLSSKEARLTDDLPMLPNLSDDIISATPA 538 LN A +DTKFGVNKFADLS +EFK YYL++KEA TDDLP+ L D+ I++ P Sbjct: 61 ELNLIAINHKADTKFGVNKFADLSSDEFKNYYLNNKEAIFTDDLPVADYLDDEFINSIPT 120 Query: 539 AFDWRNTGGST 571 AFDWR G T Sbjct: 121 AFDWRTRGAVT 131 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3268448 Number of Hits to DB: 2,302,841,653 Number of extensions: 48867508 Number of successful extensions: 132670 Number of sequences better than 10.0: 1718 Number of HSP's gapped: 128450 Number of HSP's successfully gapped: 2532 Length of query: 456 Length of database: 1,061,185,681 Length adjustment: 132 Effective length of query: 324 Effective length of database: 629,750,545 Effective search space: 204039176580 Effective search space used: 204039176580 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
PSORT	psg: 0.68 gvh: 0.49 alm: 0.45 top: 0.53 tms: 0.00 mit: 0.41 mip: 0.03 nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00 act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00 dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: mitochondrial 28.0 %: cytoplasmic 16.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for Contig-U16285-1 is mit
VS (DIR, S)	7
VH (FL, L)	2
VF (FL, S)	96
AH (FL, L)	0
AF (FL, S)	0
SL (DIR, L)	7
SS (DIR, S)	6
SH (FL, L)	0
SF (FL, S)	0
CH (FL, L)	0
CF (FL, S)	2
FCL (DIR, L)	0
FC (DIR, S)	7
FC-IC (SUB)	0

Dicty_cDB - Dictyostelium discoideum cDNA Contig Overview

Dicty_cDB

Atlas

Dicty_cDB - Dictyostelium discoideum cDNA Contig Overview

Dicty_cDB

Atlas