| Contig-U16283-1 |
| Contig ID |
Contig-U16283-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
2327 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
3849887 |
| End point |
3852056 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
111 |
| Number of EST |
182 |
| Link to clone list |
U16283 |
| List of clone(s) |
est1=AHE349F,1,617
est2=VHJ562F,18,568
est3=VHN462F,25,628
est4=VHO660F,143,796
est5=VHH247F,144,720
est6=VFL849F,161,539
est7=VHB431F,166,394
est8=VHL470F,169,607
est9=VHF364F,171,762
est10=VFN313F,172,825
est11=VFE475F,173,684
est12=VFI720F,173,777
est13=VHD650F,173,721
est14=VHE330F,173,809
est15=VHE338F,173,796
est16=VHE453F,173,813
est17=VFJ215F,174,796
est18=VHI585F,174,767
est19=VHL561F,174,814
est20=SHC505F,175,783
est21=VFE737F,175,646
est22=VHB751F,175,719
est23=VHJ443F,175,803
est24=VHK118F,175,817
est25=VHN470F,175,800
est26=VFM582F,176,826
est27=VHA518F,177,813
est28=VHE445F,177,768
est29=VHE627F,177,823
est30=VFB790F,178,809
est31=VFM828F,178,826
est32=VFO507F,178,765
est33=VHA544F,178,798
est34=VHB847F,178,808
est35=VHC201F,178,774
est36=VHC289F,178,825
est37=VHF235F,178,739
est38=VHG325F,178,801
est39=VHI543F,178,822
est40=VHI695F,178,716
est41=VHJ196F,178,808
est42=VHK507F,178,808
est43=VHL148F,178,809
est44=VHL614F,178,803
est45=VHO536F,178,805
est46=VHO537F,178,795
est47=VHO580F,178,804
est48=VHQ261F,178,825
est49=AFA803F,179,813
est50=AHE838F,179,762
est51=SFD120F,179,806
est52=SFK675F,179,795
est53=VHA449F,179,813
est54=VHG646F,179,824
est55=VHH181F,179,808
est56=VHH771F,179,767
est57=VHK609F,179,804
est58=VHM150F,179,808
est59=VHM337F,179,804
est60=VHM626F,179,810
est61=VHM838F,179,810
est62=VHO862F,179,805
est63=AHB641F,180,717
est64=AHC515F,180,796
est65=SFL178F,180,719
est66=VFE852F,180,674
est67=VHJ481F,180,693
est68=AFI605F,181,778
est69=VFG613F,181,722
est70=VFH333F,181,743
est71=VHL816F,181,805
est72=VHM464F,181,810
est73=VFN305F,182,797
est74=VHH453F,182,798
est75=VHK519F,182,790
est76=VHF626F,183,794
est77=VHF777F,184,647
est78=AHH682F,185,646
est79=VHO377F,185,760
est80=AHF618F,187,823
est81=FC-AO07F,187,787
est82=SLC873F,187,879
est83=VHA739F,187,802
est84=VHL257F,187,802
est85=VFO818F,194,806
est86=VHE793F,194,824
est87=VHB774F,196,825
est88=VHP271F,196,804
est89=VHF643F,231,648
est90=VHF766F,231,646
est91=CFF685F,255,948
est92=SFK505F,276,947
est93=SFK727F,338,717
est94=VHF742F,395,646
est95=AFA714F,610,1215
est96=VFE105F,1125,1608
est97=VFG613Z,1198,1938
est98=VFI720Z,1221,1939
est99=VFJ215Z,1221,1939
est100=SFK505Z,1224,1928
est101=CFF685Z,1381,2151
est102=VHA449Z,1412,2213
est103=VHO862Z,1412,2167
est104=VHA544Z,1416,2213
est105=VHI585Z,1416,2190
est106=VHO660Z,1426,2212
est107=VHK118Z,1440,2212
est108=AHB641Z,1441,2210
est109=VHE338Z,1444,2213
est110=AHF618Z,1445,2209
est111=VHE445Z,1447,2213
est112=VHI695Z,1447,2212
est113=VHC289Z,1450,2212
est114=VFL849Z,1465,2191
est115=VFO818Z,1465,2191
est116=VHK519Z,1465,2212
est117=VHK609Z,1465,2212
est118=VHL561Z,1474,2189
est119=VFM582Z,1476,2200
est120=VFN313Z,1476,2213
est121=VHM838Z,1476,2190
est122=SFK675Z,1478,2208
est123=VFB790Z,1480,2192
est124=VHM464Z,1480,2190
est125=SLH827Z,1481,2221
est126=VHL257Z,1482,2186
est127=VHA518Z,1483,2212
est128=VHJ481Z,1497,2209
est129=VHL470Z,1497,2189
est130=AFI605Z,1498,2190
est131=VFK817Z,1517,2191
est132=VHL816Z,1517,2212
est133=VHJ196Z,1518,2191
est134=AFA714Z,1532,2184
est135=VHE627Z,1532,2201
est136=VHF777Z,1532,2189
est137=VHF766Z,1534,2189
est138=SLC873Z,1541,2217
est139=SHC505Z,1544,2209
est140=SFL178Z,1548,2184
est141=SLC880Z,1548,2217
est142=VHE453Z,1549,2213
est143=VHG646Z,1553,2212
est144=VHB431Z,1556,2228
est145=VFE737Z,1566,1897
est146=SLE461E,1572,2322
est147=VHH181Z,1578,2209
est148=FC-BQ10Z,1588,2279
est149=SLB713Z,1591,2282
est150=FC-BS10Z,1592,2312
est151=AFA803Z,1605,2212
est152=VFE475Z,1608,2214
est153=VFH333Z,1613,2197
est154=VFE105Z,1616,2214
est155=VHO377Z,1623,2201
est156=VHH247Z,1628,2211
est157=VHO580Z,1628,2206
est158=VHB751Z,1630,2201
est159=FC-IC0487F,1635,2196
est160=VHE330Z,1637,2213
est161=FC-BR17Z,1638,2303
est162=VFE852Z,1648,2214
est163=VHM150Z,1664,2181
est164=VFM828Z,1679,2199
est165=FC-BR10Z,1702,2303
est166=FC-AO07Z,1720,2279
est167=VHF235Z,1820,1966
est168=VFN182Z,1887,2131
est169=VHH771Z,1888,2039
est170=SLF679E,1901,2215
est171=VSI636F,1955,2228
est172=VSI636Z,1955,2195
est173=VHF364Z,2045,2182
est174=VSI895F,2076,2247
est175=AHC515Z,2123,2306
est176=VSI895Z,2141,2302
est177=VHD650Z,2143,2270
est178=SFD120Z,2149,2256
est179=VHG325Z,2179,2306
est180=VHI543Z,2179,2298
est181=VHC201Z,2213,2318
est182=VHK507Z,2215,2327
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.24 |
| Homology vs DNA |
Query= Contig-U16283-1 (Contig-U16283-1Q) /CSM_Contig/Contig-U16283-1Q.Seq.d
(2327 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ439082) Dictyostelium discoideum cDNA clone:ddv39j12, 3' ... 1413 0.0 1
(BJ442128) Dictyostelium discoideum cDNA clone:ddv48m24, 3' ... 1411 0.0 1
(BJ348750) Dictyostelium discoideum cDNA clone:dda34a12, 3' ... 1400 0.0 1
(BJ359114) Dictyostelium discoideum cDNA clone:ddc12i22, 5' ... 1376 0.0 1
(BJ445790) Dictyostelium discoideum cDNA clone:ddv60l16, 3' ... 1356 0.0 2
(BJ445767) Dictyostelium discoideum cDNA clone:ddv60g16, 3' ... 1356 0.0 2
(BJ443147) Dictyostelium discoideum cDNA clone:ddv52e05, 3' ... 1356 0.0 1
(BJ443127) Dictyostelium discoideum cDNA clone:ddv52a04, 3' ... 1356 0.0 1
(BJ436819) Dictyostelium discoideum cDNA clone:ddv32g11, 3' ... 1356 0.0 2
(BJ351091) Dictyostelium discoideum cDNA clone:dda42c06, 3' ... 1356 0.0 2
(BJ435437) Dictyostelium discoideum cDNA clone:ddv27j03, 3' ... 1352 0.0 1
(BJ437905) Dictyostelium discoideum cDNA clone:ddv35a24, 3' ... 1350 0.0 2
(BJ436545) Dictyostelium discoideum cDNA clone:ddv31b14, 3' ... 1348 0.0 3
(BJ401296) Dictyostelium discoideum cDNA clone:dds22e20, 3' ... 1348 0.0 1
(BJ346960) Dictyostelium discoideum cDNA clone:dda25n13, 3' ... 1344 0.0 1
(AU039460) Dictyostelium discoideum slug cDNA, clone SLH827. 1342 0.0 1
(BJ436713) Dictyostelium discoideum cDNA clone:ddv32c05, 3' ... 1342 0.0 1
(BJ429760) Dictyostelium discoideum cDNA clone:ddv4d23, 3' e... 1330 0.0 1
(BJ347524) Dictyostelium discoideum cDNA clone:dda27i09, 3' ... 1308 0.0 1
(BJ434635) Dictyostelium discoideum cDNA clone:ddv24b14, 3' ... 1306 0.0 2
(BJ442397) Dictyostelium discoideum cDNA clone:ddv49b22, 3' ... 1304 0.0 1
(BJ344315) Dictyostelium discoideum cDNA clone:dda18i02, 3' ... 1304 0.0 1
(BJ435318) Dictyostelium discoideum cDNA clone:ddv26c21, 3' ... 1302 0.0 2
(BJ390351) Dictyostelium discoideum cDNA clone:dds22i01, 5' ... 1283 0.0 1
(BJ427789) Dictyostelium discoideum cDNA clone:ddv63i16, 5' ... 1281 0.0 1
(BJ419322) Dictyostelium discoideum cDNA clone:ddv35a24, 5' ... 1281 0.0 1
(BJ421962) Dictyostelium discoideum cDNA clone:ddv44k12, 5' ... 1279 0.0 1
(BJ416546) Dictyostelium discoideum cDNA clone:ddv26c21, 5' ... 1279 0.0 1
(BJ416404) Dictyostelium discoideum cDNA clone:ddv26h08, 5' ... 1279 0.0 1
(BJ420743) Dictyostelium discoideum cDNA clone:ddv40e08, 5' ... 1277 0.0 1
(BJ416734) Dictyostelium discoideum cDNA clone:ddv27j03, 5' ... 1277 0.0 1
(BJ423173) Dictyostelium discoideum cDNA clone:ddv48e11, 5' ... 1275 0.0 1
(BJ436121) Dictyostelium discoideum cDNA clone:ddv30d06, 3' ... 1271 0.0 3
(BJ443921) Dictyostelium discoideum cDNA clone:ddv54i15, 3' ... 1269 0.0 3
(BJ442805) Dictyostelium discoideum cDNA clone:ddv51c05, 3' ... 1269 0.0 3
(BJ442104) Dictyostelium discoideum cDNA clone:ddv48i21, 3' ... 1269 0.0 3
(BJ439088) Dictyostelium discoideum cDNA clone:ddv39l09, 3' ... 1269 0.0 3
(BJ444445) Dictyostelium discoideum cDNA clone:ddv56l10, 3' ... 1265 0.0 3
(BJ423980) Dictyostelium discoideum cDNA clone:ddv51c05, 5' ... 1265 0.0 1
(BJ372495) Dictyostelium discoideum cDNA clone:ddc12i22, 3' ... 1261 0.0 3
(BJ420539) Dictyostelium discoideum cDNA clone:ddv39j14, 5' ... 1257 0.0 1
(BJ325744) Dictyostelium discoideum cDNA clone:dda2f02, 5' e... 1257 0.0 1
(BJ418053) Dictyostelium discoideum cDNA clone:ddv31b14, 5' ... 1255 0.0 1
(BJ443606) Dictyostelium discoideum cDNA clone:ddv53a16, 3' ... 1253 0.0 3
(BJ425648) Dictyostelium discoideum cDNA clone:ddv56l10, 5' ... 1251 0.0 1
(BJ425601) Dictyostelium discoideum cDNA clone:ddv56c08, 5' ... 1251 0.0 1
(BJ425090) Dictyostelium discoideum cDNA clone:ddv54i15, 5' ... 1251 0.0 1
(BJ420925) Dictyostelium discoideum cDNA clone:ddv40j23, 5' ... 1251 0.0 1
(BJ444235) Dictyostelium discoideum cDNA clone:ddv55p16, 3' ... 1249 0.0 3
(BJ420466) Dictyostelium discoideum cDNA clone:ddv39l07, 5' ... 1249 0.0 1
(BJ419019) Dictyostelium discoideum cDNA clone:ddv34d19, 5' ... 1249 0.0 1
(BJ418214) Dictyostelium discoideum cDNA clone:ddv32c05, 5' ... 1249 0.0 1
(BJ425369) Dictyostelium discoideum cDNA clone:ddv55c13, 5' ... 1247 0.0 1
(BJ424351) Dictyostelium discoideum cDNA clone:ddv52m01, 5' ... 1247 0.0 1
(BJ418911) Dictyostelium discoideum cDNA clone:ddv34n12, 5' ... 1247 0.0 1
(BJ411529) Dictyostelium discoideum cDNA clone:ddv4d23, 5' e... 1245 0.0 1
(BJ424749) Dictyostelium discoideum cDNA clone:ddv53o11, 5' ... 1243 0.0 1
(BJ387951) Dictyostelium discoideum cDNA clone:dds7g05, 5' e... 1243 0.0 1
(BJ426908) Dictyostelium discoideum cDNA clone:ddv60l16, 5' ... 1241 0.0 1
(BJ426809) Dictyostelium discoideum cDNA clone:ddv60g09, 5' ... 1241 0.0 1
(BJ426996) Dictyostelium discoideum cDNA clone:ddv60o19, 5' ... 1239 0.0 1
(BJ424977) Dictyostelium discoideum cDNA clone:ddv54p04, 5' ... 1239 0.0 1
(BJ423656) Dictyostelium discoideum cDNA clone:ddv49o23, 5' ... 1239 0.0 1
(BJ422380) Dictyostelium discoideum cDNA clone:ddv45a21, 5' ... 1239 0.0 1
(BJ333256) Dictyostelium discoideum cDNA clone:dda42c06, 5' ... 1239 0.0 1
(BJ424950) Dictyostelium discoideum cDNA clone:ddv54k04, 5' ... 1237 0.0 1
(BJ423470) Dictyostelium discoideum cDNA clone:ddv49f12, 5' ... 1237 0.0 1
(BJ425441) Dictyostelium discoideum cDNA clone:ddv55p16, 5' ... 1235 0.0 1
(BJ424294) Dictyostelium discoideum cDNA clone:ddv52a04, 5' ... 1233 0.0 1
(BJ421607) Dictyostelium discoideum cDNA clone:ddv43b07, 5' ... 1233 0.0 1
(AU061081) Dictyostelium discoideum slug cDNA, clone SLC873. 1231 0.0 2
(BJ425962) Dictyostelium discoideum cDNA clone:ddv57l18, 5' ... 1231 0.0 1
(BJ425326) Dictyostelium discoideum cDNA clone:ddv55j09, 5' ... 1231 0.0 1
(BJ330089) Dictyostelium discoideum cDNA clone:dda27i09, 5' ... 1231 0.0 1
(BJ418311) Dictyostelium discoideum cDNA clone:ddv32g11, 5' ... 1227 0.0 1
(AU034435) Dictyostelium discoideum slug cDNA, clone SLC873. 1223 0.0 1
(BJ422344) Dictyostelium discoideum cDNA clone:ddv45j14, 5' ... 1223 0.0 1
(BJ331811) Dictyostelium discoideum cDNA clone:dda36m03, 5' ... 1223 0.0 1
(BJ426819) Dictyostelium discoideum cDNA clone:ddv60i09, 5' ... 1221 0.0 1
(BJ424758) Dictyostelium discoideum cDNA clone:ddv53a16, 5' ... 1221 0.0 1
(BJ418344) Dictyostelium discoideum cDNA clone:ddv32n09, 5' ... 1221 0.0 1
(BJ414440) Dictyostelium discoideum cDNA clone:ddv19m04, 5' ... 1219 0.0 1
(BJ416732) Dictyostelium discoideum cDNA clone:ddv27j01, 5' ... 1217 0.0 1
(BJ414985) Dictyostelium discoideum cDNA clone:ddv21g02, 5' ... 1217 0.0 1
(BJ420468) Dictyostelium discoideum cDNA clone:ddv39l09, 5' ... 1215 0.0 1
(BJ390540) Dictyostelium discoideum cDNA clone:dds22e20, 5' ... 1213 0.0 1
(BJ332539) Dictyostelium discoideum cDNA clone:dda39b13, 5' ... 1211 0.0 1
(AU034441) Dictyostelium discoideum slug cDNA, clone SLC880. 1209 0.0 1
(BJ427211) Dictyostelium discoideum cDNA clone:ddv61m18, 5' ... 1207 0.0 1
(BJ424315) Dictyostelium discoideum cDNA clone:ddv52e05, 5' ... 1207 0.0 1
(BJ417264) Dictyostelium discoideum cDNA clone:ddv30d06, 5' ... 1203 0.0 1
(BJ325764) Dictyostelium discoideum cDNA clone:dda2l03, 5' e... 1201 0.0 1
(BJ439386) Dictyostelium discoideum cDNA clone:ddv40e08, 3' ... 1195 0.0 1
(C23864) Dictyostelium discoideum gamete cDNA, clone FC-AO07. 1191 0.0 1
(BJ392833) Dictyostelium discoideum cDNA clone:dds29i01, 5' ... 1191 0.0 1
(BJ326810) Dictyostelium discoideum cDNA clone:dda18i02, 5' ... 1185 0.0 1
(BJ443816) Dictyostelium discoideum cDNA clone:ddv54p04, 3' ... 1183 0.0 3
(BJ442465) Dictyostelium discoideum cDNA clone:ddv49o23, 3' ... 1183 0.0 2
(BJ414108) Dictyostelium discoideum cDNA clone:ddv18h05, 5' ... 1181 0.0 1
(BJ419081) Dictyostelium discoideum cDNA clone:ddv35a02, 5' ... 1179 0.0 1
(BJ421330) Dictyostelium discoideum cDNA clone:ddv42c08, 5' ... 1178 0.0 1
(BJ433473) Dictyostelium discoideum cDNA clone:ddv22b06, 3' ... 1176 0.0 2
(BJ426888) Dictyostelium discoideum cDNA clone:ddv60g16, 5' ... 1170 0.0 2
(BJ420461) Dictyostelium discoideum cDNA clone:ddv39j12, 5' ... 1168 0.0 1
(BJ423334) Dictyostelium discoideum cDNA clone:ddv48i21, 5' ... 1166 0.0 1
(BJ422674) Dictyostelium discoideum cDNA clone:ddv46n17, 5' ... 1166 0.0 1
(AU061499) Dictyostelium discoideum slug cDNA, clone SLE461. 1162 0.0 1
(BJ421101) Dictyostelium discoideum cDNA clone:ddv41p15, 5' ... 1156 0.0 1
(BJ340447) Dictyostelium discoideum cDNA clone:dda2l03, 3' e... 1156 0.0 2
(BJ415260) Dictyostelium discoideum cDNA clone:ddv22b06, 5' ... 1154 0.0 1
(BJ441120) Dictyostelium discoideum cDNA clone:ddv45a21, 3' ... 1152 0.0 1
(BJ401627) Dictyostelium discoideum cDNA clone:dds23k19, 3' ... 1140 0.0 2
(BJ332937) Dictyostelium discoideum cDNA clone:dda40l10, 5' ... 1140 0.0 1
(BJ440067) Dictyostelium discoideum cDNA clone:ddv42d17, 3' ... 1136 0.0 1
(BJ404620) Dictyostelium discoideum cDNA clone:dds29i01, 3' ... 1130 0.0 2
(BJ426679) Dictyostelium discoideum cDNA clone:ddv59j19, 5' ... 1126 0.0 1
(AU284932) Dictyostelium discoideum gamete cDNA clone:FC-BQ1... 1124 0.0 1
(BJ439163) Dictyostelium discoideum cDNA clone:ddv39j14, 3' ... 1124 0.0 2
(BJ443654) Dictyostelium discoideum cDNA clone:ddv53l18, 3' ... 1122 0.0 3
(AU284986) Dictyostelium discoideum gamete cDNA clone:FC-BS1... 1116 0.0 1
(BJ417307) Dictyostelium discoideum cDNA clone:ddv30m01, 5' ... 1112 0.0 2
(BJ413361) Dictyostelium discoideum cDNA clone:ddv15b09, 5' ... 1104 0.0 1
(BJ420978) Dictyostelium discoideum cDNA clone:ddv41e10, 5' ... 1102 0.0 1
(BJ340427) Dictyostelium discoideum cDNA clone:dda2f02, 3' e... 1092 0.0 1
(BJ431081) Dictyostelium discoideum cDNA clone:ddv9f20, 3' e... 1090 0.0 1
(BJ440672) Dictyostelium discoideum cDNA clone:ddv44k12, 3' ... 1086 0.0 2
(BJ440173) Dictyostelium discoideum cDNA clone:ddv42j19, 3' ... 989 0.0 2
(BJ432235) Dictyostelium discoideum cDNA clone:ddv18h05, 3' ... 918 0.0 2
(BJ431418) Dictyostelium discoideum cDNA clone:ddv14i04, 3' ... 916 0.0 2
(BJ401087) Dictyostelium discoideum cDNA clone:dds22i01, 3' ... 888 0.0 2
(BJ432601) Dictyostelium discoideum cDNA clone:ddv19m04, 3' ... 821 0.0 3
(AU033999) Dictyostelium discoideum slug cDNA, clone SLB713. 771 0.0 2
(BJ433199) Dictyostelium discoideum cDNA clone:ddv21g02, 3' ... 708 0.0 2
(BJ430870) Dictyostelium discoideum cDNA clone:ddv9i01, 3' e... 1074 0.0 1
(BJ413079) Dictyostelium discoideum cDNA clone:ddv14i04, 5' ... 1070 0.0 1
(BJ390834) Dictyostelium discoideum cDNA clone:dds23k19, 5' ... 1070 0.0 1
(BJ331186) Dictyostelium discoideum cDNA clone:dda34a12, 5' ... 1066 0.0 1
(BJ420187) Dictyostelium discoideum cDNA clone:ddv38c14, 5' ... 1063 0.0 1
(BJ422278) Dictyostelium discoideum cDNA clone:ddv45m12, 5' ... 1035 0.0 2
(BJ418946) Dictyostelium discoideum cDNA clone:ddv34f13, 5' ... 1059 0.0 1
(BJ423358) Dictyostelium discoideum cDNA clone:ddv48m24, 5' ... 1057 0.0 1
(BJ445885) Dictyostelium discoideum cDNA clone:ddv60o19, 3' ... 1053 0.0 1
(BJ441016) Dictyostelium discoideum cDNA clone:ddv45m12, 3' ... 1053 0.0 1
(BJ431718) Dictyostelium discoideum cDNA clone:ddv15b09, 3' ... 1019 0.0 2
(AU271638) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 1039 0.0 1
(BJ445560) Dictyostelium discoideum cDNA clone:ddv59j19, 3' ... 975 0.0 2
(BJ439086) Dictyostelium discoideum cDNA clone:ddv39l07, 3' ... 1031 0.0 1
(BJ412773) Dictyostelium discoideum cDNA clone:ddv9f20, 5' e... 997 0.0 1
(BJ437173) Dictyostelium discoideum cDNA clone:ddv33n08, 3' ... 995 0.0 1
(BJ409930) Dictyostelium discoideum cDNA clone:ddv10h14, 5' ... 977 0.0 1
(AU284966) Dictyostelium discoideum gamete cDNA clone:FC-BR1... 959 0.0 2
(BJ428051) Dictyostelium discoideum cDNA clone:ddv10h14, 3' ... 850 0.0 3
(BJ423592) Dictyostelium discoideum cDNA clone:ddv49b22, 5' ... 769 0.0 2
(BJ437529) Dictyostelium discoideum cDNA clone:ddv34f13, 3' ... 757 0.0 4
(BJ412581) Dictyostelium discoideum cDNA clone:ddv9i01, 5' e... 700 0.0 2
(BJ435180) Dictyostelium discoideum cDNA clone:ddv26h08, 3' ... 938 0.0 1
(BJ421496) Dictyostelium discoideum cDNA clone:ddv42j19, 5' ... 920 0.0 1
(BJ444177) Dictyostelium discoideum cDNA clone:ddv55c13, 3' ... 850 0.0 2
(BJ409878) Dictyostelium discoideum cDNA clone:ddv10j09, 5' ... 900 0.0 2
(BJ334523) Dictyostelium discoideum cDNA clone:dda46c22, 5' ... 898 0.0 1
(BJ425960) Dictyostelium discoideum cDNA clone:ddv57l16, 5' ... 890 0.0 1
(AU284959) Dictyostelium discoideum gamete cDNA clone:FC-BR1... 878 0.0 1
(C23865) Dictyostelium discoideum gamete cDNA, clone FC-AO07. 870 0.0 1
(BJ424809) Dictyostelium discoideum cDNA clone:ddv53l18, 5' ... 846 0.0 1
(BJ329616) Dictyostelium discoideum cDNA clone:dda25n13, 5' ... 817 0.0 1
(BJ421342) Dictyostelium discoideum cDNA clone:ddv42e12, 5' ... 785 0.0 1
(BJ421408) Dictyostelium discoideum cDNA clone:ddv42d17, 5' ... 781 0.0 1
(BJ423860) Dictyostelium discoideum cDNA clone:ddv50k15, 5' ... 771 0.0 1
(BJ390406) Dictyostelium discoideum cDNA clone:dds22f07, 5' ... 722 0.0 1
(BJ416001) Dictyostelium discoideum cDNA clone:ddv24b14, 5' ... 704 0.0 1
(BJ427993) Dictyostelium discoideum cDNA clone:ddv10j09, 3' ... 611 e-170 1
(AR548202) Sequence 3333 from patent US 6747137. 200 e-158 12
(AX109755) Sequence 488 from Patent WO0123604. 258 e-154 7
(AX109756) Sequence 489 from Patent WO0123604. 258 e-151 7
(AX110914) Sequence 1647 from Patent WO0123604. 281 e-145 7
(AX109727) Sequence 460 from Patent WO0123604. 200 e-142 10
(DQ447219) Pichia anomala mitochondrial F-ATPase beta subuni... 258 e-141 5
(AU053099) Dictyostelium discoideum slug cDNA, clone SLF679. 509 e-139 1
(DQ447205) Candida albicans mitochondrial F-ATPase beta subu... 200 e-136 8
(AX109728) Sequence 461 from Patent WO0123604. 180 e-136 10
(AX109742) Sequence 475 from Patent WO0123604. 192 e-135 10
(AX109729) Sequence 462 from Patent WO0123604. 214 e-133 8
(BJ421337) Dictyostelium discoideum cDNA clone:ddv42d11, 5' ... 482 e-131 1
(DY887438) CeleSEQ3762 Cunninghamella elegans pBluescript (E... 198 e-129 6
(DY887879) CeleSEQ4662 Cunninghamella elegans pBluescript (E... 198 e-129 6
(DY886828) CeleSEQ2628 Cunninghamella elegans pBluescript (E... 198 e-129 6
(DY888316) CeleSEQ5175 Cunninghamella elegans pBluescript (E... 190 e-126 6
(U37764) Kluyveromyces lactis F1 ATPase beta subunit (KlATP2... 202 e-126 8
(AX109735) Sequence 468 from Patent WO0123604. 220 e-125 7
(AX109733) Sequence 466 from Patent WO0123604. 200 e-125 8
(DQ447208) Candida famata mitochondrial F-ATPase beta subuni... 214 e-124 6
(AX109738) Sequence 471 from Patent WO0123604. 208 e-123 9
(DQ447222) Candida tropicalis mitochondrial F-ATPase beta su... 192 e-121 8
(DQ447207) Candida dubliniensis mitochondrial F-ATPase beta ... 180 e-120 7
(AX109741) Sequence 474 from Patent WO0123604. 202 e-119 7
(DY888991) CeleSEQ6451 Cunninghamella elegans pBluescript (E... 176 e-118 6
(DQ447212) Candida inconspicua mitochondrial F-ATPase beta s... 200 e-117 7
(DQ447221) Kluyveromyces lactis mitochondrial F-ATPase beta ... 202 e-116 6
(AX109744) Sequence 477 from Patent WO0123604. 182 e-115 9
(CR382138) Debaryomyces hansenii strain CBS767 chromosome F ... 244 e-113 22
(DQ447214) Issatchenkia orientalis mitochondrial F-ATPase be... 220 e-113 6
(AB104883) Zygosaccharomyces rouxii ZrATP2 gene for mitochon... 143 e-112 10
(AX110041) Sequence 774 from Patent WO0123604. 153 e-111 6
(DQ447223) Candida viswanathii mitochondrial F-ATPase beta s... 182 e-111 7
(BJ418620) Dictyostelium discoideum cDNA clone:ddv33n08, 5' ... 414 e-111 1
(AX110038) Sequence 771 from Patent WO0123604. 151 e-110 6
(AX109739) Sequence 472 from Patent WO0123604. 170 e-109 8
(AX109947) Sequence 680 from Patent WO0123604. 168 e-107 6
(DQ447218) Candida parapsilosis mitochondrial F-ATPase beta ... 170 e-107 8
(AX109726) Sequence 459 from Patent WO0123604. 161 e-102 7
(DJ206778) Method for identification of useful proteins deri... 163 e-100 7
(AX109736) Sequence 469 from Patent WO0123604. 176 2e-99 7
(AX110045) Sequence 778 from Patent WO0123604. 161 3e-99 6
(CR382124) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 202 9e-98 17
(EH012423) USDA-FP_185325 Lysiphlebus testaceipes adult whol... 145 3e-97 5
(U46215) Saccharomyces cerevisiae D273-10B F1-ATPase beta-su... 155 2e-94 6
(DQ447215) Pichia fermentans mitochondrial F-ATPase beta sub... 176 2e-92 6
(DQ447213) Kluyveromyces marxianus mitochondrial F-ATPase be... 155 2e-92 6
(CP000498) Pichia stipitis CBS 6054 chromosome 4, complete s... 159 3e-92 18
(EA397068) Sequence 45892 from patent US 7314974. 153 4e-92 6
(AX829536) Sequence 256 from Patent WO03072602. 153 4e-92 6
(AX818506) Sequence 256 from Patent EP1338608. 153 4e-92 6
(AX594966) Sequence 620 from Patent EP1258494. 153 4e-92 6
(AX109734) Sequence 467 from Patent WO0123604. 155 6e-92 6
(Z49621) S.cerevisiae chromosome X reading frame ORF YJR121w. 153 3e-91 6
(DQ447210) Pichia guilliermondii mitochondrial F-ATPase beta... 168 5e-89 5
(AX109731) Sequence 464 from Patent WO0123604. 168 1e-88 5
(DQ447217) Clavispora lusitaniae mitochondrial F-ATPase beta... 155 2e-88 6
(AX109737) Sequence 470 from Patent WO0123604. 155 4e-88 6
(AX109933) Sequence 666 from Patent WO0123604. 145 6e-88 7
(M12082) Yeast (S.cerevisiae) nuclear ATP2 gene encoding mit... 145 2e-87 7
(FC815592) Sr_pAMT7_03j07_T7 S. ratti mixed stage pAMP Stron... 174 3e-86 5
(BJ435640) Dictyostelium discoideum cDNA clone:ddv27c21, 3' ... 226 5e-85 2
(DY894948) CeleSEQ14642 Cunninghamella elegans pBluescript (... 198 8e-85 3
(FC817601) Sr_pAMT7_09g07_T7 S. ratti mixed stage pAMP Stron... 174 8e-85 5
(AX110906) Sequence 1639 from Patent WO0123604. 170 3e-84 3
(AU269001) Dictyostelium discoideum vegetative cDNA clone:VS... 325 4e-84 1
(AU269000) Dictyostelium discoideum vegetative cDNA clone:VS... 325 4e-84 1
(FC816798) Sr_pAMT7_07c04_T7 S. ratti mixed stage pAMP Stron... 174 6e-83 5
(AL422806) T3 end of clone AZ0AA004D12 of library AZ0AA from... 155 7e-82 6
(FE856401) CAFU609.fwd CAFU Pichia stipitis oxygen limited d... 159 1e-81 6
(DQ447211) Candida haemulonii mitochondrial F-ATPase beta su... 180 3e-80 5
(FC819570) Sr_pAMT7_015d10_T7 S. ratti mixed stage pAMP Stro... 167 5e-80 5
(AX109732) Sequence 465 from Patent WO0123604. 180 9e-80 5
(FE850746) CAFP1347.rev CAFP Pichia stipitis aerobic xylose ... 159 1e-79 4
(DJ130857) Method for identification of useful proteins deri... 145 2e-79 8
(DY888315) CeleSEQ5173 Cunninghamella elegans pBluescript (E... 176 4e-78 6
(EE006679) ROE00002853 Rhizopus oryzae Company Rhizopus oryz... 98 9e-78 5
(AL435887) T3 end of clone XBB0AA002A08 of library XBB0AA fr... 153 9e-78 6
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 303 2e-77 1
(BJ415154) Dictyostelium discoideum cDNA clone:ddv21j13, 5' ... 303 2e-77 1
(AX109743) Sequence 476 from Patent WO0123604. 141 2e-77 7
(FC820173) Sr_pAMT7_016p01_T7 S. ratti mixed stage pAMP Stro... 167 2e-76 6
(AL404406) T7 end of clone AT0AA016B06 of library AT0AA from... 157 2e-76 8
(FC820313) Sr_pAMT7_017f11_T7 S. ratti mixed stage pAMP Stro... 167 2e-76 6
(FC820296) Sr_pAMT7_017e17_T7 S. ratti mixed stage pAMP Stro... 167 5e-76 6
(DQ447209) Candida glabrata mitochondrial F-ATPase beta subu... 131 1e-75 7
(AX109730) Sequence 463 from Patent WO0123604. 131 2e-75 7
(DY893805) CeleSEQ13242 Cunninghamella elegans pBluescript (... 176 1e-74 5
(DY890596) CeleSEQ9654 Cunninghamella elegans pBluescript (E... 176 1e-74 6
(DY888910) CeleSEQ6322 Cunninghamella elegans pBluescript (E... 176 1e-74 5
(DJ025878) Genome-wide DNA marker of Saccharomyces cerevisiae. 153 2e-74 11
(AX109761) Sequence 494 from Patent WO0123604. 133 3e-74 7
(FC817186) Sr_pAMT7_08d03_T7 S. ratti mixed stage pAMP Stron... 174 1e-73 5
(DQ416018) Acyrthosiphon pisum putative ATP synthase beta su... 133 2e-73 8
(DY889272) CeleSEQ8322 Cunninghamella elegans pBluescript (E... 176 6e-73 5
(DY886313) CeleSEQ1920 Cunninghamella elegans pBluescript (E... 176 7e-73 5
(AY580230) Nucula proxima ATP synthase beta subunit mRNA, pa... 82 1e-72 10
(EX798683) CAHG6414.fwd CAHG Laccaria bicolor Vegetative myc... 172 1e-72 6
(FC815845) Sr_pAMT7_04f13_T7 S. ratti mixed stage pAMP Stron... 174 2e-72 4
(AX110035) Sequence 768 from Patent WO0123604. 143 1e-71 7
(DY887506) CeleSEQ3880 Cunninghamella elegans pBluescript (E... 176 3e-71 5
(FE855138) CAFT711.rev CAFT Pichia stipitis oxygen limited d... 159 1e-70 5
(FE846140) CAFI572.fwd CAFI Pichia stipitis aerobic dextrose... 159 1e-70 5
(DY887807) CeleSEQ4511 Cunninghamella elegans pBluescript (E... 176 2e-70 6
(DY891157) CeleSEQ7715 Cunninghamella elegans pBluescript (E... 176 4e-70 7
(FE851063) CAFP1517.fwd CAFP Pichia stipitis aerobic xylose ... 147 5e-70 7
(CU436452) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 107 5e-69 9
(EE007758) ROE00007252 Rhizopus oryzae Company Rhizopus oryz... 161 7e-69 4
(DY888615) CeleSEQ5771 Cunninghamella elegans pBluescript (E... 172 8e-69 3
(DY889672) CeleSEQ11636 Cunninghamella elegans pBluescript (... 176 3e-68 5
(EY340073) CAWZ10084.fwd CAWZ Helobdella robusta Primary Lat... 111 1e-67 8
(DY886707) CeleSEQ2460 Cunninghamella elegans pBluescript (E... 176 1e-67 6
(DV616952) EST1219948 Glossina morsitans morsitans Fat body ... 117 2e-67 5
(CD420526) ku88a09.y1 Strongyloides ratti PA female naive pA... 167 4e-67 4
(AX109753) Sequence 486 from Patent WO0123604. 105 7e-67 7
(EE006815) ROE00002856 Rhizopus oryzae Company Rhizopus oryz... 98 6e-66 6
(CN587230) USDA-FP_130302 Acyrthosiphon pisum, Pea Aphid Acy... 133 3e-65 6
(CU329670) Schizosaccharomyces pombe chromosome I. 129 3e-65 23
(AX111113) Sequence 1846 from Patent WO0123604. 147 8e-65 5
(CU437177) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 1e-64 9
(EX453983) RSUA0171 Rhagoletis suavis antennal cDNA library ... 159 2e-64 6
(CA284238) SCSFSD1064H12.g SD1 Saccharum officinarum cDNA cl... 135 3e-64 4
(CR380954) Candida glabrata strain CBS138 chromosome H compl... 123 4e-64 17
(EF092074) Maconellicoccus hirsutus clone WHMH2822 putative ... 182 1e-63 5
(CU438788) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 1e-63 10
(CZ530453) SRAA-aac67a11.b1 Strongyloides ratti whole genome... 119 2e-63 6
(EY353741) CAWZ2282.fwd CAWZ Helobdella robusta Primary Late... 111 2e-63 7
(BI703747) kx17c10.y3 Parastrongyloides trichosuri FL pAMP1 ... 188 2e-63 3
(EB803132) 3472_E09 Botrytis cinerea expressed sequence tags... 121 2e-62 4
(CU440345) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 5e-62 8
(CN582185) USDA-FP_125247 Acyrthosiphon pisum, Pea Aphid Acy... 133 6e-62 7
(DQ674545) Coccidioides posadasii ATP synthase beta chain mR... 119 7e-62 5
(DY888846) CeleSEQ6201 Cunninghamella elegans pBluescript (E... 184 9e-62 5
(BJ439691) Dictyostelium discoideum cDNA clone:ddv41e10, 3' ... 250 2e-61 1
(FC817748) Sr_pAMT7_09m22_T7 S. ratti mixed stage pAMP Stron... 174 3e-61 3
(FC810210) Sr_pASP6_03j07_SP6 S. ratti mixed stage pAMP Stro... 174 3e-61 3
(BI704058) kt86e04.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 174 6e-61 3
(CF822583) EST699965 Coccidioides posadasii saprobic phase c... 119 1e-60 4
(CN592268) TTE00013261 Normalized large Tetrahymena thermoph... 141 1e-60 5
(CO012927) EST801262 Coccidioides posadasii spherule cDNA li... 119 1e-60 4
(CO005724) EST794059 Coccidioides posadasii spherule cDNA li... 119 1e-60 4
(CO017620) EST788002 Coccidioides posadasii saprobic phase c... 119 2e-60 4
(FC669808) CAXW7208.fwd CAXW Lottia gigantea from female gon... 119 2e-60 8
(EB805556) 3481_D20 Botrytis cinerea expressed sequence tags... 121 5e-60 5
(CN758735) ID0AAA23AB09RM1 ApMS Acyrthosiphon pisum cDNA clo... 133 5e-60 5
(CU437169) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 5e-60 8
(CU441612) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 6e-60 8
(CU439634) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 9e-60 8
(CU618615) Theobroma cacao, mRNA sequence (KZ0AAA11YC15FM1). 103 9e-60 5
(DY895639) CeleSEQ15515 Cunninghamella elegans pBluescript (... 141 1e-59 3
(DW118223) CLRY6882.b1_D18.ab1 CLR(XYZ) lettuce serriola Lac... 80 1e-59 9
(DY889540) CeleSEQ11431 Cunninghamella elegans pBluescript (... 176 2e-59 5
(DY895613) CeleSEQ15482 Cunninghamella elegans pBluescript (... 141 2e-59 3
(CU436523) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 2e-59 9
(BI703964) kt45a04.y3 Strongyloides ratti L1 pAMP1 v3 Chiape... 139 4e-59 4
(EY347177) CAWZ15475.fwd CAWZ Helobdella robusta Primary Lat... 111 4e-59 7
(EC758716) PPE00003191 Agencourt Biosciences Agen-0020 Non-n... 145 5e-59 3
(EY085175) CAZI16730.fwd CAZI Artemisia annua normalized lea... 82 6e-59 7
(EY351946) CAWZ18386.fwd CAWZ Helobdella robusta Primary Lat... 111 7e-59 7
(FC810437) Sr_pASP6_04f13_SP6 S. ratti mixed stage pAMP Stro... 174 7e-59 3
(EA376961) Sequence 25784 from patent US 7314974. 129 8e-59 7
(AM753499) Clytia hemisphaerica EST, 5' end sequence, clone ... 115 1e-58 8
(EC270531) TT1C318TH Tetrahymena thermophila SB210 cDNA libr... 127 2e-58 5
(EY345031) CAWZ13629.fwd CAWZ Helobdella robusta Primary Lat... 111 3e-58 7
(FC703445) CAXY1997.fwd CAXY Lottia gigantea from male gonad... 119 4e-58 7
(DQ447224) Candida zeylanoides mitochondrial F-ATPase beta s... 123 6e-58 5
(AX109640) Sequence 373 from Patent WO0123604. 94 1e-57 5
(AX109639) Sequence 372 from Patent WO0123604. 94 1e-57 5
(BU059473) Fgr-C_02_J10_T3 Carbon-starved mycelia Gibberella... 133 1e-57 4
(AX109745) Sequence 478 from Patent WO0123604. 123 2e-57 5
(FC704941) CAXY2866.fwd CAXY Lottia gigantea from male gonad... 119 2e-57 7
(FC699940) CAXX7986.fwd CAXX Lottia gigantea from male gonad... 119 5e-57 8
(CN811702) Fg11_01h01_T3 Fg11_AAFC_ECORC_Fusarium_graminearu... 129 7e-57 6
(EX805411) CAPI638.fwd CAPI Laccaria bicolor Mycelium intera... 129 9e-57 5
(EF067921) Thalassiosira pseudonana chloroplast, complete ge... 78 1e-56 11
(DR921197) EST1112736 Aquilegia cDNA library Aquilegia formo... 68 1e-56 8
(DT766416) EST1200265 Aquilegia cDNA library Aquilegia formo... 68 2e-56 8
(AJ296764) Pterocomma populeum partial atpD gene for ATPase ... 127 3e-56 4
(EY360071) CAWZ6837.fwd CAWZ Helobdella robusta Primary Late... 111 4e-56 7
(EY347229) CAWZ15502.fwd CAWZ Helobdella robusta Primary Lat... 111 5e-56 7
(X72497) O.sinensis atpB and atpE genes. 84 6e-56 9
(K00560) yeast (s.cerevisiae) mitochondrial atpase beta subu... 123 1e-55 7
(EX861423) CBNF5968.fwd CBNF Phycomyces blakesleeanus NRRL15... 92 1e-55 6
(CN593232) TTE00012431 Normalized large Tetrahymena thermoph... 141 2e-55 5
(CU440285) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 115 2e-55 7
(FC577499) CAXP12886.fwd CAXP Lottia gigantea from head, foo... 119 2e-55 7
(FC664102) CAXW3630.fwd CAXW Lottia gigantea from female gon... 119 2e-55 7
(CZ538826) SRAA-aad22b01.g1 Strongyloides ratti whole genome... 70 2e-55 8
(FC672912) CAXW9101.fwd CAXW Lottia gigantea from female gon... 119 3e-55 7
(EH774082) CNSM6463.b1_N08.ab1 CNS(LMS) yellow starthistle C... 139 3e-55 3
(FC671051) CAXW7889.fwd CAXW Lottia gigantea from female gon... 119 3e-55 7
(AX109749) Sequence 482 from Patent WO0123604. 123 3e-55 5
(DW123713) CLSX10143.b1_N15.ab1 CLS(XYZ) lettuce sativa Lact... 84 4e-55 8
(EA077742) Sequence 2 from patent US 7186513. 111 5e-55 7
(AR670501) Sequence 2 from patent US 6902887. 111 5e-55 7
(M13704) Chlamydomonas reinhardtii unknown protein and ATP s... 74 5e-55 8
(DQ440233) Aedes aegypti clone AET-272 F0F1-type ATP synthas... 139 6e-55 5
(CN597326) TTE00006737 Normalized large Tetrahymena thermoph... 141 7e-55 4
(CN598906) TTE00009418 Normalized large Tetrahymena thermoph... 141 8e-55 4
(CN598896) TTE00010653 Normalized large Tetrahymena thermoph... 141 8e-55 4
(FF566425) TTBA170TG Tetrahymena thermophila CU428 log phase... 141 1e-54 4
(EC829937) TDE00000233 Advantage polymerase (lib1_td_adv) Ta... 80 1e-54 5
(EH213077) USDA-FP_175873 WHMH (pink hibiscus mealybug) Maco... 182 1e-54 4
(CU440615) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 107 2e-54 8
(DY890228) CeleSEQ8754 Cunninghamella elegans pBluescript (E... 163 2e-54 4
(EY100632) CAZI24861.fwd CAZI Artemisia annua normalized lea... 72 3e-54 7
(EX415030) GQ03701.B7_E24 GQ037 - Shoot tip - Dormant Picea ... 92 3e-54 6
(BP505414) Hydra magnipapillata cDNA, clone:hm_03174. 145 3e-54 5
(CN592212) TTE00015353 Normalized large Tetrahymena thermoph... 141 4e-54 3
(CU437587) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 4e-54 8
(CN593584) TTE00010916 Normalized large Tetrahymena thermoph... 141 4e-54 3
(BX251688) Pinus pinaster xylem EST, clone PP054A02 similar ... 92 6e-54 5
(EH217162) USDA-FP_179959 WHMH (pink hibiscus mealybug) Maco... 182 7e-54 4
(BI703984) kt49e07.y4 Strongyloides ratti L1 pAMP1 v3 Chiape... 174 1e-53 2
(BQ091158) ku13f03.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 174 1e-53 2
(DY853146) ApulSEQ1400 Aureobasidium pullulans pBluescript (... 127 2e-53 5
(U96497) Nicotiana sylvestris ATPase beta subunit (nsatp2.2.... 64 2e-53 10
(EY342136) CAWZ11572.fwd CAWZ Helobdella robusta Primary Lat... 111 2e-53 6
(EY360326) CAWZ7020.fwd CAWZ Helobdella robusta Primary Late... 111 3e-53 6
(CT788186) Paramecium tetraurelia 5-PRIME EST from clone LK0... 96 3e-53 7
(DY845996) CcinSEQ7448 Coprinus cinereus pBluescript (EcoRI-... 113 5e-53 3
(DY845976) CcinSEQ7400 Coprinus cinereus pBluescript (EcoRI-... 113 6e-53 3
(EE993913) EST65420 Larval Stage 1 Aedes aegypti cDNA clone ... 139 6e-53 4
(CN498248) F04_02142.AB1 Diabrotica virgifera virgifera midg... 133 6e-53 3
(EF085070) Picea sitchensis clone WS02728_O12 unknown mRNA. 92 6e-53 6
(DV987277) GQ0206.B3_N14 GQ020: Clean ROOTS systems -Diurnal... 92 6e-53 5
(DY849229) CcinSEQ16145 Coprinus cinereus pBluescript (EcoRI... 113 7e-53 3
(DB917363) Idiosepius paradoxus cDNA, clone:Ip_aB_029_C11, 5... 105 8e-53 7
(DB916929) Idiosepius paradoxus cDNA, clone:Ip_aB_027_O01, 5... 105 8e-53 6
(CN596338) TTE00007474 Normalized large Tetrahymena thermoph... 101 1e-52 6
(CN596324) TTE00007360 Normalized large Tetrahymena thermoph... 101 1e-52 6
(EF113531) Pseudoschroederia antillarum strain SAG 15.86 Atp... 64 1e-52 8
(FK125698) XABT165265.b1 Gateway compatible cien cDNA librar... 80 1e-52 6
(DQ087492) Nereis vexillosa ATP synthase beta subunit mRNA, ... 109 2e-52 5
(EY102997) CAZI26046.fwd CAZI Artemisia annua normalized lea... 76 2e-52 5
(CN599258) TTE00008341 Normalized large Tetrahymena thermoph... 141 2e-52 4
(FF781983) XABT80870.fwd Gateway compatible cien cDNA librar... 72 3e-52 7
(AK114749) Ciona intestinalis cDNA, clone:cieg015f17, full i... 74 4e-52 7
(M90060) Streptococcus faecalis H+ ATPase a (atpB),b (atpF),... 115 4e-52 5
(DY875694) AresSEQ3043 Amorphotheca resinae pBluescript (Eco... 96 6e-52 4
(FC649100) CAXW10504.fwd CAXW Lottia gigantea from female go... 119 1e-51 8
(AK113457) Ciona intestinalis cDNA, clone:ciad058g18, full i... 74 1e-51 7
(EX819513) CBNA6609.fwd CBNA Phycomyces blakesleeanus NRRL15... 92 2e-51 5
(FC651555) CAXW1199.fwd CAXW Lottia gigantea from female gon... 119 2e-51 8
(AY580277) Saccoglossus kowalevskii ATP synthase beta subuni... 109 2e-51 7
(FE855128) CAFT706.rev CAFT Pichia stipitis oxygen limited d... 74 2e-51 6
(CU434525) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 107 3e-51 7
(DB915184) Idiosepius paradoxus cDNA, clone:Ip_aB_018_I24, 5... 105 4e-51 6
(EX856654) CBNF3568.fwd CBNF Phycomyces blakesleeanus NRRL15... 92 5e-51 5
(CN584894) USDA-FP_127963 Acyrthosiphon pisum, Pea Aphid Acy... 133 6e-51 4
(DY878164) AresSEQ6137 Amorphotheca resinae pBluescript (Eco... 92 7e-51 4
(EX812639) CBNA3046.fwd CBNA Phycomyces blakesleeanus NRRL15... 92 7e-51 5
(AY580168) Antedon mediterranea ATP synthase beta subunit mR... 86 1e-50 6
(DR941937) EST1133476 Aquilegia cDNA library Aquilegia formo... 62 1e-50 8
(EX813244) CBNA3386.fwd CBNA Phycomyces blakesleeanus NRRL15... 84 2e-50 6
(CX832651) ACAC-aaa03a10.g1 Hydra EST UCI 7 Hydra magnipapil... 145 2e-50 5
(DB915475) Idiosepius paradoxus cDNA, clone:Ip_aB_019_H14, 5... 105 2e-50 6
(FE855260) CAFT778.fwd CAFT Pichia stipitis oxygen limited d... 147 2e-50 6
(AL420139) T3 end of clone AY0AA003E04 of library AY0AA from... 103 2e-50 5
(DY951385) CHPY7652.b1_H18.ab1 CHP(XYZ) plains sunflower Hel... 90 2e-50 6
(CN134516) OX1_26_G10.g1_A002 Oxidatively-stressed leaves an... 141 2e-50 5
(FE849515) CAFO548.fwd CAFO Pichia stipitis aerobic xylose M... 147 2e-50 6
(FE845486) CAFH989.fwd CAFH Pichia stipitis aerobic dextrose... 147 2e-50 6
(FE855139) CAFT711.fwd CAFT Pichia stipitis oxygen limited d... 147 2e-50 6
(FC618298) CAXS9335.fwd CAXS Lottia gigantea from head, foot... 119 2e-50 6
(EH215326) USDA-FP_178119 WHMH (pink hibiscus mealybug) Maco... 182 3e-50 2
(EB806858) 3486_E09 Botrytis cinerea expressed sequence tags... 121 3e-50 4
(EK454071) 1095467864751 Global-Ocean-Sampling_GS-32-01-01-1... 88 3e-50 7
(DW013486) w5i16_M13F Myzus persicae, tobacco lineage, whole... 119 4e-50 4
(EY103870) CAZI3410.fwd CAZI Artemisia annua normalized leaf... 72 4e-50 6
(CN555592) tae14e12.y1 Hydra EST Darmstadt I Hydra magnipapi... 137 5e-50 4
(FD442602) Atr02b_141_H07_C011.g1 FGP Female Amborella trich... 74 5e-50 7
(AY580237) Obelia sp. KJP-2004 ATP synthase beta subunit mRN... 123 5e-50 6
(DB917024) Idiosepius paradoxus cDNA, clone:Ip_aB_028_C11, 5... 105 5e-50 6
(BI749896) Fg02_01e03_R Fg02_AAFC_ECORC_Fusarium_graminearum... 115 7e-50 5
(EE008192) ROE00005079 Rhizopus oryzae Company Rhizopus oryz... 90 7e-50 5
(FC664003) CAXW3575.fwd CAXW Lottia gigantea from female gon... 119 7e-50 7
(FC662004) CAXW2397.fwd CAXW Lottia gigantea from female gon... 119 7e-50 7
(AB014006) Pleodorina indica chloroplast atpB gene for ATP s... 56 7e-50 9
(FC695722) CAXX5137.fwd CAXX Lottia gigantea from male gonad... 119 8e-50 7
(FE852082) CAFP2056.fwd CAFP Pichia stipitis aerobic xylose ... 147 8e-50 6
(DL216154) NUCLEIC ACIDS AND PROTEINS FROM STREPTOCOCCUS GRO... 76 8e-50 6
(CQ647370) Sequence 4327 from Patent WO0234771. 76 8e-50 6
(AJ296761) Thelaxes suberi partial atpD gene for ATPase beta... 147 8e-50 4
(FE843249) CAFH1226.fwd CAFH Pichia stipitis aerobic dextros... 147 9e-50 6
(FC626780) CAXT5184.fwd CAXT Lottia gigantea from mantle Lot... 119 1e-49 7
(DY862480) ApulSEQ16630 Aureobasidium pullulans pBluescript ... 127 1e-49 4
(CN595935) TTE00011928 Normalized large Tetrahymena thermoph... 141 1e-49 4
(FC620578) CAXT1289.fwd CAXT Lottia gigantea from mantle Lot... 119 1e-49 7
(FC689904) CAXX20943.fwd CAXX Lottia gigantea from male gona... 119 1e-49 7
(FF692363) XABT104484.fwd Gateway compatible cien cDNA libra... 72 2e-49 6
(EF113502) Closteriopsis acicularis strain UTEX LB 1381 AtpB... 54 2e-49 11
(CO116835) GR__Eb019E23.r GR__Eb Gossypium raimondii cDNA cl... 78 2e-49 7
(DR914613) EST1106152 Aquilegia cDNA library Aquilegia formo... 62 2e-49 8
(DT732097) EST1165947 Aquilegia cDNA library Aquilegia formo... 68 2e-49 7
(BW263204) Ciona intestinalis cDNA, clone:cign033j15, 5' end... 74 3e-49 6
(BW294877) Ciona intestinalis cDNA, clone:cigd009a06, 5' end... 74 4e-49 6
(BW329672) Ciona intestinalis cDNA, clone:cidg834e23, 5'end,... 74 4e-49 6
(BW355342) Ciona intestinalis cDNA, clone:cima806j02, 5'end,... 74 4e-49 6
(DV184533) CT036_H07_CT036_3700_90.ab1 C. tentans tissue cul... 82 4e-49 5
(FF976507) CBWU101152.b1 Yutaka Satou unpublished cDNA libra... 74 5e-49 6
(BW480222) Ciona intestinalis cDNA, clone:cima024k03, 5'end,... 74 5e-49 6
(BW337328) Ciona intestinalis cDNA, clone:ciem805l06, 5'end,... 74 5e-49 6
(BW475292) Ciona intestinalis cDNA, clone:cima013g15, 5'end,... 74 5e-49 6
(BW212658) Ciona intestinalis cDNA, clone:cieg071c24, 5' end... 74 5e-49 6
(BW213606) Ciona intestinalis cDNA, clone:cieg074b09, 5' end... 74 5e-49 6
(BW327003) Ciona intestinalis cDNA, clone:cidg826g12, 5'end,... 74 5e-49 6
(BW484288) Ciona intestinalis cDNA, clone:cima035p06, 5'end,... 74 5e-49 6
(BW033725) Ciona intestinalis cDNA, clone:cibd023n05, 5' end... 74 5e-49 6
(CX575735) TTE00020375 Amplicon Express - Conjugative Form T... 141 6e-49 3
(FF986250) CBWU98677.b1 Yutaka Satou unpublished cDNA librar... 74 6e-49 6
(BW037499) Ciona intestinalis cDNA, clone:cibd033o13, 5' end... 74 6e-49 6
(BW485758) Ciona intestinalis cDNA, clone:cima051p02, 5'end,... 74 6e-49 6
(FF943415) CBWU76442.b1 Yutaka Satou unpublished cDNA librar... 74 6e-49 6
(FF858688) CBWU7105.b1 Yutaka Satou unpublished cDNA library... 74 6e-49 6
(BW479676) Ciona intestinalis cDNA, clone:cima022i08, 5'end,... 74 6e-49 6
(BW475164) Ciona intestinalis cDNA, clone:cima012o06, 5'end,... 74 6e-49 6
(BW039700) Ciona intestinalis cDNA, clone:cibd041f23, 5' end... 74 7e-49 6
(FF945420) CBWU77690.b1 Yutaka Satou unpublished cDNA librar... 74 7e-49 6
(FF863596) CBWU10221.b1 Yutaka Satou unpublished cDNA librar... 74 8e-49 6
(FF959775) CBWU86539.b1 Yutaka Satou unpublished cDNA librar... 74 8e-49 6
(DN048375) QL4-18 Bombus terrestris larval caste mRNA Bombus... 184 9e-49 4
(FF868438) CBWU13278.b1 Yutaka Satou unpublished cDNA librar... 74 9e-49 6
(FF897563) CBWU31325.b1 Yutaka Satou unpublished cDNA librar... 74 9e-49 6
(FF908182) CBWU38593.b1 Yutaka Satou unpublished cDNA librar... 74 9e-49 6
(FF887275) CBWU24814.b1 Yutaka Satou unpublished cDNA librar... 74 9e-49 6
(FF881978) CBWU21524.b1 Yutaka Satou unpublished cDNA librar... 74 1e-48 6
(FF884375) CBWU23059.b1 Yutaka Satou unpublished cDNA librar... 74 1e-48 6
(BU029207) QHH9N03.yg.ab1 QH_EFGHJ sunflower RHA280 Helianth... 90 1e-48 5
>(BJ439082) Dictyostelium discoideum cDNA clone:ddv39j12, 3' end,
single read.
Length = 767
Score = 1413 bits (713), Expect = 0.0
Identities = 713/713 (100%)
Strand = Plus / Minus
Query: 1446 gtaccagctgatgatttgactgatccagcccccagccactacatttgcacatcttgatgc 1505
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 767 gtaccagctgatgatttgactgatccagcccccagccactacatttgcacatcttgatgc 708
Query: 1506 caccactgtactttctcgtgccatctctgaattgggtatctatccatgtgtcgatccatt 1565
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 707 caccactgtactttctcgtgccatctctgaattgggtatctatccatgtgtcgatccatt 648
Query: 1566 agattcaacctcattgatgatggatccaaatattattggtgttgaacattacaaagttgc 1625
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 647 agattcaacctcattgatgatggatccaaatattattggtgttgaacattacaaagttgc 588
Query: 1626 caccgatgtacaaaagatcctccaagaatataaatcacttcaagatattattgccatttt 1685
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 587 caccgatgtacaaaagatcctccaagaatataaatcacttcaagatattattgccatttt 528
Query: 1686 aggtatggatgatttatctgaagaccaaaaagcaactgtattccgtgctcgtaagattca 1745
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 527 aggtatggatgatttatctgaagaccaaaaagcaactgtattccgtgctcgtaagattca 468
Query: 1746 acgtttcttatcacaaccattcgaagttgcccacgccttcaccaatatggaaggtagatt 1805
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 467 acgtttcttatcacaaccattcgaagttgcccacgccttcaccaatatggaaggtagatt 408
Query: 1806 cgttaaactctccgactctatcaaagccttcaaaggtatcctcgaaggtaaatacgatca 1865
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 407 cgttaaactctccgactctatcaaagccttcaaaggtatcctcgaaggtaaatacgatca 348
Query: 1866 tctcccagaagctgccttctatatggttggtggtatcgaagatgtcgaaattaaagctgc 1925
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 347 tctcccagaagctgccttctatatggttggtggtatcgaagatgtcgaaattaaagctgc 288
Query: 1926 taaactcttagaatccgctggtaaagaagaaaagaaaaccaccactacctccaccactgg 1985
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 287 taaactcttagaatccgctggtaaagaagaaaagaaaaccaccactacctccaccactgg 228
Query: 1986 tcaagtcaaagaagaaactgtcagagaaaaagttaccagactcgtcgatgaagcttacaa 2045
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 227 tcaagtcaaagaagaaactgtcagagaaaaagttaccagactcgtcgatgaagcttacaa 168
Query: 2046 tgctaaagtcaagaaattaaaggaatatggtgcctcaactgctcaccttgaagaattacg 2105
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 167 tgctaaagtcaagaaattaaaggaatatggtgcctcaactgctcaccttgaagaattacg 108
Query: 2106 tgctcaatatgaaaagaactttgaatctgaaatcagtcaattagaagttttat 2158
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 107 tgctcaatatgaaaagaactttgaatctgaaatcagtcaattagaagttttat 55
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 2,348,762,088
Number of extensions: 136380229
Number of successful extensions: 10753903
Number of sequences better than 10.0: 26022
Length of query: 2327
Length of database: 98,766,808,389
Length adjustment: 25
Effective length of query: 2302
Effective length of database: 96,311,147,814
Effective search space: 221708262267828
Effective search space used: 221708262267828
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 8. 2 |
| Homology vs Protein |
Query= Contig-U16283-1 (Contig-U16283-1Q) /CSM_Contig/Contig-U16283-1Q.Seq.d
(2327 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(P49376) RecName: Full=ATP synthase subunit beta, mitochondrial;... 452 0.0
AE017346_61(AE017346|pid:none) Cryptococcus neoformans var. neof... 456 0.0
FN392320_1159(FN392320|pid:none) Pichia pastoris GS115 chromosom... 449 0.0
AB104883_1(AB104883|pid:none) Zygosaccharomyces rouxii ZrATP2 ge... 447 0.0
GN102063_1(GN102063|pid:none) Sequence 6844 from Patent WO200903... 447 0.0
CP000498_39(CP000498|pid:none) Pichia stipitis CBS 6054 chromoso... 448 0.0
CU928176_67(CU928176|pid:none) Zygosaccharomyces rouxii strain C... 446 0.0
CR382128_148(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 444 0.0
(P38482) RecName: Full=ATP synthase subunit beta, mitochondrial;... 436 0.0
FJ208948_1(FJ208948|pid:none) Gillichthys mirabilis F1 ATP synth... 438 0.0
DQ443321_1(DQ443321|pid:none) Bombyx mori H+ transporting ATP sy... 437 0.0
DQ443322_1(DQ443322|pid:none) Bombyx mori H+ transporting ATP sy... 436 0.0
GN102123_1(GN102123|pid:none) Sequence 6904 from Patent WO200903... 444 0.0
GN102065_1(GN102065|pid:none) Sequence 6846 from Patent WO200903... 445 0.0
GN102059_1(GN102059|pid:none) Sequence 6840 from Patent WO200903... 441 e-180
M12082_1(M12082|pid:none) Yeast (S.cerevisiae) nuclear ATP2 gene... 449 e-180
AK159737_1(AK159737|pid:none) Mus musculus osteoclast-like cell ... 432 e-180
GN102053_1(GN102053|pid:none) Sequence 6834 from Patent WO200903... 449 e-180
(P10719) RecName: Full=ATP synthase subunit beta, mitochondrial;... 434 e-180
(Q9PTY0) RecName: Full=ATP synthase subunit beta, mitochondrial;... 434 e-180
A28701(A28701;S70510)H+-transporting two-sector ATPase (EC 3.6.3... 434 e-180
GN102557_1(GN102557|pid:none) Sequence 7338 from Patent WO200903... 436 e-180
BC037127_1(BC037127|pid:none) Mus musculus ATP synthase, H+ tran... 432 e-180
(Q5ZLC5) RecName: Full=ATP synthase subunit beta, mitochondrial;... 432 e-180
(Q3U774) RecName: Full=ATP synthase subunit beta, mitochondrial;... 432 e-180
(Q2VZN2) RecName: Full=ATP synthase subunit beta; EC=3.... 441 e-180
(P06576) RecName: Full=ATP synthase subunit beta, mitochondrial;... 433 e-180
AK167764_1(AK167764|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 432 e-180
AK166603_1(AK166603|pid:none) Mus musculus 4 days embryo whole b... 431 e-179
AM920436_1007(AM920436|pid:none) Penicillium chrysogenum Wiscons... 449 e-179
D00022_1(D00022|pid:none) Homo sapiens mRNA for F1 beta subunit,... 432 e-179
AK151081_1(AK151081|pid:none) Mus musculus bone marrow macrophag... 432 e-179
BC067388_1(BC067388|pid:none) Xenopus tropicalis ATP synthase, H... 430 e-179
(Q01859) RecName: Full=ATP synthase subunit beta, mitochondrial;... 435 e-179
(P00829) RecName: Full=ATP synthase subunit beta, mitochondrial;... 431 e-179
DQ440233_1(DQ440233|pid:none) Aedes aegypti clone AET-272 F0F1-t... 432 e-179
AP008207_2168(AP008207|pid:none) Oryza sativa (japonica cultivar... 435 e-179
AP007175_411(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 441 e-179
GN102555_1(GN102555|pid:none) Sequence 7336 from Patent WO200903... 434 e-179
CU638744_194(CU638744|pid:none) Podospora anserina genomic DNA c... 442 e-178
(P17614) RecName: Full=ATP synthase subunit beta, mitochondrial;... 437 e-178
(P46561) RecName: Full=ATP synthase subunit beta, mitochondrial;... 436 e-178
(Q11DD5) RecName: Full=ATP synthase subunit beta; EC=3.... 433 e-178
EF085070_1(EF085070|pid:none) Picea sitchensis clone WS02728_O12... 434 e-178
AE016815_382(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 427 e-178
AJ870436_1(AJ870436|pid:none) Polytomella sp. Pringsheim 198.80 ... 431 e-178
DQ674545_1(DQ674545|pid:none) Coccidioides posadasii ATP synthas... 438 e-178
BC046741_1(BC046741|pid:none) Xenopus laevis ATP synthase, H+ tr... 427 e-178
(Q05825) RecName: Full=ATP synthase subunit beta, mitochondrial;... 426 e-178
GN102565_1(GN102565|pid:none) Sequence 7346 from Patent WO200903... 431 e-177
GN102155_1(GN102155|pid:none) Sequence 6936 from Patent WO200903... 425 e-177
AF030559_1(AF030559|pid:none) Mus musculus ATP synthase beta-sub... 428 e-177
CP000613_2189(CP000613|pid:none) Rhodospirillum centenum SW, com... 430 e-177
GN102205_1(GN102205|pid:none) Sequence 6986 from Patent WO200903... 434 e-177
D10491_1(D10491|pid:none) Oryza sativa Japonica Group atpB gene ... 431 e-177
CP001574_443(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 439 e-177
M19483_1(M19483|pid:none) Human ATP synthase beta subunit gene, ... 429 e-177
(P05038) RecName: Full=ATP synthase subunit beta; EC=3.... 437 e-177
(P72247) RecName: Full=ATP synthase subunit beta; EC=3.... 422 e-176
(Q2G5N5) RecName: Full=ATP synthase subunit beta; EC=3.... 430 e-176
GN102563_1(GN102563|pid:none) Sequence 7344 from Patent WO200903... 427 e-176
GN102561_1(GN102561|pid:none) Sequence 7342 from Patent WO200903... 427 e-176
(A6WXX1) RecName: Full=ATP synthase subunit beta; EC=3.... 433 e-176
(A5VSE1) RecName: Full=ATP synthase subunit beta; EC=3.... 429 e-176
(Q2YLE6) RecName: Full=ATP synthase subunit beta; EC=3.... 429 e-176
CP001389_3042(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 433 e-176
(A8LJR4) RecName: Full=ATP synthase subunit beta 2; EC=... 423 e-175
Y15178_1(Y15178|pid:none) Sorghum bicolor F1-ATP synthase, culti... 433 e-175
GN102197_1(GN102197|pid:none) Sequence 6978 from Patent WO200903... 426 e-175
(Q0BQE8) RecName: Full=ATP synthase subunit beta; EC=3.... 429 e-175
DQ403107_1(DQ403107|pid:none) Homo sapiens mitochondrial ATP syn... 432 e-175
AJ271468_1(AJ271468|pid:none) Arabidopsis thaliana mRNA for mito... 426 e-175
(P83483) RecName: Full=ATP synthase subunit beta-1, mitochondria... 426 e-175
(P83484) RecName: Full=ATP synthase subunit beta-2, mitochondria... 426 e-175
FN319664_1(FN319664|pid:none) Schistosoma japonicum isolate Anhu... 424 e-175
(B6JD09) RecName: Full=ATP synthase subunit beta; EC=3.... 423 e-175
(Q162S9) RecName: Full=ATP synthase subunit beta; EC=3.... 417 e-175
DQ228960_1(DQ228960|pid:none) Toxoplasma gondii mitochondrial F1... 433 e-175
(Q3SVJ1) RecName: Full=ATP synthase subunit beta; EC=3.... 428 e-175
DQ358698_1(DQ358698|pid:none) Pinctada fucata ATP synthase beta ... 422 e-175
FN319667_1(FN319667|pid:none) Schistosoma japonicum isolate Anhu... 422 e-174
(A3PIB9) RecName: Full=ATP synthase subunit beta 1; EC=... 424 e-174
(A4WUM7) RecName: Full=ATP synthase subunit beta; EC=3.... 423 e-174
(Q25117) RecName: Full=ATP synthase subunit beta, mitochondrial;... 426 e-174
(Q13DP2) RecName: Full=ATP synthase subunit beta; EC=3.... 426 e-174
(Q1RKD7) RecName: Full=ATP synthase subunit beta; EC=3.... 419 e-174
AM910996_536(AM910996|pid:none) Plasmodium knowlesi strain H chr... 428 e-174
BT000796_1(BT000796|pid:none) Arabidopsis thaliana unknown prote... 422 e-174
(Q1MAZ2) RecName: Full=ATP synthase subunit beta; EC=3.... 424 e-173
CP000628_3248(CP000628|pid:none) Agrobacterium radiobacter K84 c... 426 e-173
(A9H9A8) RecName: Full=ATP synthase subunit beta; EC=3.... 417 e-173
(A8GY40) RecName: Full=ATP synthase subunit beta; EC=3.... 419 e-173
CP001016_215(CP001016|pid:none) Beijerinckia indica subsp. indic... 418 e-173
(Q1QQS8) RecName: Full=ATP synthase subunit beta; EC=3.... 425 e-173
CP001622_3870(CP001622|pid:none) Rhizobium leguminosarum bv. tri... 424 e-173
GN102239_1(GN102239|pid:none) Sequence 7020 from Patent WO200903... 418 e-173
CP001131_4443(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 423 e-173
(B3PQ68) RecName: Full=ATP synthase subunit beta; EC=3.... 425 e-172
CP000683_877(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 416 e-172
(Q2K3H0) RecName: Full=ATP synthase subunit beta; EC=3.... 424 e-172
(A8GPZ4) RecName: Full=ATP synthase subunit beta; EC=3.... 415 e-172
CP001280_337(CP001280|pid:none) Methylocella silvestris BL2, com... 416 e-172
(A8F004) RecName: Full=ATP synthase subunit beta; EC=3.... 415 e-172
(A1ALL7) RecName: Full=ATP synthase subunit beta 1; EC=... 419 e-172
CP000930_845(CP000930|pid:none) Heliobacterium modesticaldum Ice... 413 e-172
DQ087459_1(DQ087459|pid:none) Sycon lingua ATP synthase beta sub... 432 e-172
(O50290) RecName: Full=ATP synthase subunit beta; EC=3.... 416 e-171
(A7HIX7) RecName: Full=ATP synthase subunit beta; EC=3.... 415 e-171
(Q2RFX9) RecName: Full=ATP synthase subunit beta; EC=3.... 422 e-171
CP001391_156(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 410 e-171
DQ403105_1(DQ403105|pid:none) Oryctolagus cuniculus mitochondria... 425 e-171
(A1VFJ5) RecName: Full=ATP synthase subunit beta; EC=3.... 420 e-171
(A4YKE0) RecName: Full=ATP synthase subunit beta; EC=3.... 411 e-171
(A7IH31) RecName: Full=ATP synthase subunit beta; EC=3.... 423 e-171
(Q68VU8) RecName: Full=ATP synthase subunit beta; EC=3.... 411 e-171
(Q67TB7) RecName: Full=ATP synthase subunit beta; EC=3.... 423 e-171
(B3EA01) RecName: Full=ATP synthase subunit beta; EC=3.... 416 e-171
CP000766_1244(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 416 e-170
(Q5FRC5) RecName: Full=ATP synthase subunit beta 1; EC=... 418 e-170
(P42469) RecName: Full=ATP synthase subunit beta; EC=3.... 412 e-170
(A5E950) RecName: Full=ATP synthase subunit beta 1; EC=... 410 e-170
(A8GTS6) RecName: Full=ATP synthase subunit beta; EC=3.... 416 e-170
DQ403111_1(DQ403111|pid:none) Felis catus mitochondrial ATP synt... 425 e-170
(Q89X74) RecName: Full=ATP synthase subunit beta; EC=3.... 410 e-170
(Q73IG3) RecName: Full=ATP synthase subunit beta; EC=3.... 410 e-170
(Q1MRB8) RecName: Full=ATP synthase subunit beta; EC=3.... 419 e-170
CP001349_7065(CP001349|pid:none) Methylobacterium nodulans ORS 2... 410 e-170
GN102129_1(GN102129|pid:none) Sequence 6910 from Patent WO200903... 415 e-170
(Q3YS09) RecName: Full=ATP synthase subunit beta; EC=3.... 402 e-170
AE006914_1235(AE006914|pid:none) Rickettsia conorii str. Malish ... 414 e-170
(Q1CX36) RecName: Full=ATP synthase subunit beta; EC=3.... 420 e-170
CP001612_933(CP001612|pid:none) Rickettsia africae ESF-5, comple... 414 e-170
DQ403118_1(DQ403118|pid:none) Sus scrofa mitochondrial ATP synth... 429 e-170
EU074272_1(EU074272|pid:none) Sagitta setosa mitochondrial ATP s... 428 e-170
(Q0AKW0) RecName: Full=ATP synthase subunit beta; EC=3.... 412 e-169
CP001227_613(CP001227|pid:none) Rickettsia peacockii str. Rustic... 412 e-169
EU074273_1(EU074273|pid:none) Terebratulina retusa mitochondrial... 423 e-169
CR940347_800(CR940347|pid:none) Theileria annulata strain Ankara... 422 e-169
(A9IYW6) RecName: Full=ATP synthase subunit beta; EC=3.... 417 e-169
CP000633_3010(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 411 e-169
(P42465) RecName: Full=ATP synthase subunit beta; EC=3.... 415 e-169
(Q8KAC9) RecName: Full=ATP synthase subunit beta 2; EC=... 413 e-169
AY580195_1(AY580195|pid:none) Dendraster excentricus ATP synthas... 427 e-169
(B3CN17) RecName: Full=ATP synthase subunit beta; EC=3.... 404 e-168
CP000096_21(CP000096|pid:none) Pelodictyon luteolum DSM 273, com... 412 e-168
(A1UR49) RecName: Full=ATP synthase subunit beta; EC=3.... 416 e-168
(Q313W0) RecName: Full=ATP synthase subunit beta; EC=3.... 411 e-168
CP001104_1871(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 409 e-168
DQ403108_1(DQ403108|pid:none) Aotus trivirgatus mitochondrial AT... 432 e-168
(B0T335) RecName: Full=ATP synthase subunit beta; EC=3.... 405 e-167
(Q24MP1) RecName: Full=ATP synthase subunit beta; EC=3.... 410 e-167
(A5G9D8) RecName: Full=ATP synthase subunit beta; EC=3.... 414 e-167
AF533147_8(AF533147|pid:none) Bacillus sp. TA2.A1 ATP synthase s... 421 e-167
AY580216_1(AY580216|pid:none) Eucidaris tribuloides ATP synthase... 423 e-167
(Q6FYM3) RecName: Full=ATP synthase subunit beta; EC=3.... 415 e-167
(B5EFI7) RecName: Full=ATP synthase subunit beta; EC=3.... 410 e-167
CP001336_4716(CP001336|pid:none) Desulfitobacterium hafniense DC... 410 e-167
AY580175_1(AY580175|pid:none) Asterina miniata ATP synthase beta... 415 e-167
(Q5HB71) RecName: Full=ATP synthase subunit beta; EC=3.... 410 e-166
AY580189_1(AY580189|pid:none) Ephydatia cooperensis ATP synthase... 419 e-166
DQ403116_1(DQ403116|pid:none) Balaenoptera physalus mitochondria... 410 e-166
(Q5PAN2) RecName: Full=ATP synthase subunit beta; EC=3.... 402 e-166
(A0LLF8) RecName: Full=ATP synthase subunit beta; EC=3.... 405 e-166
AY580297_1(AY580297|pid:none) Priapulus caudatus ATP synthase be... 422 e-166
CP001079_454(CP001079|pid:none) Anaplasma marginale str. Florida... 401 e-166
AE017321_685(AE017321|pid:none) Wolbachia endosymbiont strain TR... 400 e-166
CP000908_1438(CP000908|pid:none) Methylobacterium extorquens PA1... 404 e-166
(Q2GD08) RecName: Full=ATP synthase subunit beta; EC=3.... 421 e-166
EU074271_1(EU074271|pid:none) Phoronis muelleri mitochondrial AT... 418 e-166
(Q1IIG8) RecName: Full=ATP synthase subunit beta; EC=3.... 402 e-166
AY580293_1(AY580293|pid:none) Ptychodera flava ATP synthase beta... 418 e-166
(A1EA15) RecName: Full=ATP synthase subunit beta, chloroplastic;... 422 e-166
GN102167_1(GN102167|pid:none) Sequence 6948 from Patent WO200903... 403 e-166
EF148198_1(EF148198|pid:none) Populus trichocarpa clone WS0128_K... 391 e-166
(A8Y9H7) RecName: Full=ATP synthase subunit beta, chloroplastic;... 421 e-166
AY580264_1(AY580264|pid:none) Modiolus americanus ATP synthase b... 417 e-166
AY580230_1(AY580230|pid:none) Nucula proxima ATP synthase beta s... 416 e-165
DQ781014_1(DQ781014|pid:none) Festuca arundinacea ATP synthase b... 421 e-165
DQ780975_1(DQ780975|pid:none) Cynosurus cristatus ATP synthase b... 420 e-165
AB266032_1(AB266032|pid:none) Dicyema acuticephalum gene for ATP... 396 e-165
DQ780965_1(DQ780965|pid:none) Brachypodium pinnatum ATP synthase... 419 e-165
DQ780986_1(DQ780986|pid:none) Festuca subverticillata ATP syntha... 419 e-165
CP000859_603(CP000859|pid:none) Desulfococcus oleovorans Hxd3, c... 408 e-165
(A3DIM9) RecName: Full=ATP synthase subunit beta; EC=3.... 406 e-165
AY580269_1(AY580269|pid:none) Mytilus edulis ATP synthase beta s... 417 e-165
(P00828) RecName: Full=ATP synthase subunit beta, chloroplastic;... 418 e-165
DQ780993_1(DQ780993|pid:none) Helictotrichon convolutum ATP synt... 419 e-165
DQ781009_1(DQ781009|pid:none) Poa billardierei ATP synthase beta... 418 e-165
DQ780967_1(DQ780967|pid:none) Bromus inermis ATP synthase beta s... 418 e-165
DQ780984_1(DQ780984|pid:none) Elymus trachycaulus ATP synthase b... 418 e-165
AY830248_1(AY830248|pid:none) Savia dictyocarpa ATP synthase bet... 416 e-165
DQ780958_1(DQ780958|pid:none) Anthoxanthum odoratum ATP synthase... 418 e-165
DQ780956_1(DQ780956|pid:none) Amphibromus scabrivalvis ATP synth... 418 e-165
DQ781013_1(DQ781013|pid:none) Rostraria pubescens ATP synthase b... 418 e-165
DQ781011_1(DQ781011|pid:none) Polypogon monspeliensis ATP syntha... 418 e-165
DQ780966_1(DQ780966|pid:none) Briza minor ATP synthase beta subu... 418 e-165
DQ780989_1(DQ780989|pid:none) Gaudinia fragilis ATP synthase bet... 418 e-165
DQ781021_1(DQ781021|pid:none) Vahlodea atropurpurea ATP synthase... 418 e-165
AB267988_1(AB267988|pid:none) Blachia siamensis chloroplast atpB... 415 e-165
DQ780952_1(DQ780952|pid:none) Aira caryophyllea ATP synthase bet... 418 e-165
EU325680_28(EU325680|pid:none) Brachypodium distachyon cultivar ... 418 e-165
D00432_1(D00432|pid:none) Oryza sativa Japonica Group chloroplas... 417 e-165
DQ780988_1(DQ780988|pid:none) Gastridium ventricosum ATP synthas... 418 e-165
AB233643_1(AB233643|pid:none) Montrouziera sphaeroidea chloropla... 415 e-165
AY830229_1(AY830229|pid:none) Meineckia phyllanthoides ATP synth... 416 e-165
AY580168_1(AY580168|pid:none) Antedon mediterranea ATP synthase ... 427 e-165
AY580244_1(AY580244|pid:none) Metridium senile ATP synthase beta... 410 e-165
AJ236166_1(AJ236166|pid:none) Myoporum mauritanum atpB gene. 417 e-164
AB354465_1(AB354465|pid:none) Paypayrola grandiflora chloroplast... 416 e-164
AY788229_1(AY788229|pid:none) Hybanthus sp. Alford 89 ATP syntha... 415 e-164
AJ233106_1(AJ233106|pid:none) Heliocarpus americanus chloroplast... 414 e-164
AY830228_1(AY830228|pid:none) Martretia quadricornis ATP synthas... 416 e-164
AY830193_1(AY830193|pid:none) Andrachne ovalis ATP synthase beta... 415 e-164
M31464_1(M31464|pid:none) Rice chloroplast beta and epsilon subu... 417 e-164
(P0C2Z7) RecName: Full=ATP synthase subunit beta, chloroplastic;... 417 e-164
(A1E9T1) RecName: Full=ATP synthase subunit beta, chloroplastic;... 416 e-164
DQ780990_1(DQ780990|pid:none) Gaudinia hispanica ATP synthase be... 417 e-164
AY788204_1(AY788204|pid:none) Austrobuxus megacarpus ATP synthas... 413 e-164
AC092750_37(AC092750|pid:none) Oryza sativa (japonica cultivar-g... 417 e-164
PWBHB(A01026;S07243) H+-transporting two-sector ATPase (EC 3.6.3... 416 e-164
AY096111_1(AY096111|pid:none) Drosera regia ATP synthase beta su... 417 e-164
AJ419684_1(AJ419684|pid:none) Escallonia calcottiae chloroplast ... 416 e-164
AB267996_1(AB267996|pid:none) Klaineanthus gaboniae chloroplast ... 415 e-164
AB354472_1(AB354472|pid:none) Viola philippica chloroplast atpB ... 414 e-164
(Q10Z38) RecName: Full=ATP synthase subunit beta; EC=3.... 404 e-164
AY580306_1(AY580306|pid:none) Monosiga brevicollis ATP synthase ... 414 e-164
AF528856_1(AF528856|pid:none) Piper betle ATP synthase beta subu... 417 e-164
EU002168_1(EU002168|pid:none) Staphylea colchica ATP synthase CF... 414 e-164
DQ780951_1(DQ780951|pid:none) Agrostis tenerrima ATP synthase be... 416 e-164
AB233666_1(AB233666|pid:none) Adenocline acuta chloroplast atpB ... 415 e-164
(Q32RI0) RecName: Full=ATP synthase subunit beta, chloroplastic;... 414 e-164
AB233715_1(AB233715|pid:none) Oldfieldia dactylophylla chloropla... 413 e-164
(P26527) RecName: Full=ATP synthase subunit beta; EC=3.... 405 e-164
DQ780964_1(DQ780964|pid:none) Bellardiochloa variegata ATP synth... 416 e-164
EU002166_1(EU002166|pid:none) Plumbago auriculata ATP synthase C... 417 e-164
EU922524_1(EU922524|pid:none) Pelargonium cotyledonis ATP syntha... 414 e-164
AJ235565_1(AJ235565|pid:none) Plumbago zeylanica chloroplast atp... 417 e-164
AJ235584_1(AJ235584|pid:none) Rinorea bengalensis chloroplast at... 414 e-164
AB354440_1(AB354440|pid:none) Amphirrhox surinamensis chloroplas... 414 e-164
AB354445_1(AB354445|pid:none) Decorsella paradoxa chloroplast at... 414 e-164
AB267976_1(AB267976|pid:none) Mareya micrantha chloroplast atpB ... 412 e-164
AJ235578_1(AJ235578|pid:none) Rhabdodendron amazonicum chloropla... 416 e-164
DQ780982_1(DQ780982|pid:none) Dupontia fisheri ATP synthase beta... 416 e-164
DQ780997_1(DQ780997|pid:none) Leucopoa kingii ATP synthase beta ... 416 e-164
(Q03235) RecName: Full=ATP synthase subunit beta; EC=3.... 402 e-164
AY580283_1(AY580283|pid:none) Strongylocentrotus purpuratus ATP ... 419 e-164
(A9L9A3) RecName: Full=ATP synthase subunit beta, chloroplastic;... 416 e-164
(P00827) RecName: Full=ATP synthase subunit beta, chloroplastic;... 415 e-164
EU437598_1(EU437598|pid:none) Lobelia cardinalis ATP synthase be... 417 e-164
AB354469_1(AB354469|pid:none) Rinorea neglecta chloroplast atpB ... 414 e-164
AB267981_1(AB267981|pid:none) Seidelia triandra chloroplast atpB... 414 e-164
AB354467_1(AB354467|pid:none) Rinorea dentata chloroplast atpB g... 414 e-164
AB354466_1(AB354466|pid:none) Rinorea apiculata chloroplast atpB... 414 e-164
AB354448_1(AB354448|pid:none) Gloeospermum dichotomum chloroplas... 414 e-164
AB233693_1(AB233693|pid:none) Mascagnia rivularis chloroplast at... 412 e-164
AJ419136_1(AJ419136|pid:none) Ecdeiocolea monostachya partial ch... 414 e-164
AY788257_1(AY788257|pid:none) Tetrorchidium sp. Bell 93-204 ATP ... 413 e-164
AY830254_1(AY830254|pid:none) Zimmermannia capillipes ATP syntha... 414 e-164
DQ781003_1(DQ781003|pid:none) Molineriella laevis ATP synthase b... 416 e-164
EU437674_1(EU437674|pid:none) Campanula jacquinii ATP synthase b... 419 e-164
EU437575_1(EU437575|pid:none) Campanula bellidifolia ATP synthas... 419 e-164
EU042809_1(EU042809|pid:none) Samadera bidwillii AtpB (atpB) gen... 411 e-164
DQ781022_1(DQ781022|pid:none) Vulpia microstachys ATP synthase b... 416 e-164
AB233653_1(AB233653|pid:none) Clutia augustifolia chloroplast at... 414 e-164
AB267993_1(AB267993|pid:none) Endospermum moluccanum chloroplast... 413 e-164
(Q8DLG8) RecName: Full=ATP synthase subunit beta; EC=3.... 412 e-164
AY830201_1(AY830201|pid:none) Blotia leandriana ATP synthase bet... 414 e-164
AY830221_1(AY830221|pid:none) Leptopus diplospermus voucher Midd... 414 e-164
AJ235495_1(AJ235495|pid:none) Humiria balsaminifera chloroplast ... 414 e-164
(Q6EW72) RecName: Full=ATP synthase subunit beta, chloroplastic;... 417 e-164
AF209599_1(AF209599|pid:none) Humulus lupulus ATP synthase beta ... 411 e-164
AJ419679_1(AJ419679|pid:none) Paracryphia alticola chloroplast p... 414 e-164
AB233645_1(AB233645|pid:none) Elatine triandra chloroplast atpB ... 414 e-164
AB233682_1(AB233682|pid:none) Sacoglottis sp. Hammel 18390 chlor... 413 e-164
AB233681_1(AB233681|pid:none) Humiria balsamifera var. balsamife... 413 e-164
AB267995_1(AB267995|pid:none) Hevea brasiliensis chloroplast atp... 413 e-164
EF422975_1(EF422975|pid:none) Pseudosasa japonica ATP synthase b... 416 e-164
AY788205_1(AY788205|pid:none) Bischofia javanica ATP synthase be... 413 e-164
AJ233112_1(AJ233112|pid:none) Sparrmannia ricinocarpa chloroplas... 414 e-164
(B1NWF7) RecName: Full=ATP synthase subunit beta, chloroplastic;... 413 e-164
AJ236164_1(AJ236164|pid:none) Callitriche heterophylla atpB gene. 414 e-164
(Q14FF0) RecName: Full=ATP synthase subunit beta, chloroplastic;... 413 e-164
AJ236184_1(AJ236184|pid:none) Hydrolea ovata atpB gene. 408 e-164
AJ417572_1(AJ417572|pid:none) Kniphofia uvaria plastid partial a... 415 e-164
AB354453_1(AB354453|pid:none) Hybanthus elatus chloroplast atpB ... 416 e-164
AB354454_1(AB354454|pid:none) Hybanthus enneaspermus chloroplast... 414 e-164
AJ419131_1(AJ419131|pid:none) Centrolepis strigosa partial chlor... 414 e-164
FJ026397_1(FJ026397|pid:none) Nandina domestica ATP synthase bet... 413 e-164
AY788226_1(AY788226|pid:none) Homalanthus populneus ATP synthase... 413 e-164
AB267984_1(AB267984|pid:none) Tragia betonicifolia chloroplast a... 413 e-164
AB268009_1(AB268009|pid:none) Homalanthus nutans chloroplast atp... 413 e-164
AB267991_1(AB267991|pid:none) Ditta myricoides chloroplast atpB ... 412 e-164
AB233723_1(AB233723|pid:none) Casearia sp. Tokuoka NC052 chlorop... 412 e-164
AB233644_1(AB233644|pid:none) Symphonia tanalensis chloroplast a... 411 e-164
AB233689_1(AB233689|pid:none) Bunchosia hookeriana chloroplast a... 411 e-164
AB233677_1(AB233677|pid:none) Excoecaria cochinchinensis chlorop... 413 e-164
AB233672_1(AB233672|pid:none) Manihot esculenta chloroplast atpB... 413 e-164
AB233690_1(AB233690|pid:none) Byrsonima crassifolia chloroplast ... 412 e-164
AF209552_1(AF209552|pid:none) Callitriche heterophylla ATP synth... 414 e-164
AJ235546_1(AJ235546|pid:none) Ochna multiflora chloroplast atpB ... 414 e-164
AF209573_1(AF209573|pid:none) Cucurbita pepo ATP synthase beta s... 413 e-164
AF209594_1(AF209594|pid:none) Greyia radlkoferi ATP synthase bet... 412 e-164
AY788211_1(AY788211|pid:none) Codiaeum variegatum ATP synthase b... 412 e-164
AY465537_1(AY465537|pid:none) Flagellaria indica ATP synthase be... 416 e-164
EU437631_1(EU437631|pid:none) Prismatocarpus sessilis ATP syntha... 414 e-164
AY830194_1(AY830194|pid:none) Antidesma alexiteria ATP synthase ... 413 e-164
EU042812_1(EU042812|pid:none) Samadera sp. C-Ford 4679 AtpB (atp... 411 e-163
AF168929_1(AF168929|pid:none) Mayaca aubletii ATP synthase beta ... 412 e-163
EU042806_1(EU042806|pid:none) Quassia africana AtpB (atpB) gene,... 410 e-163
AY968441_1(AY968441|pid:none) Octomeles sumatrana ATP synthase b... 413 e-163
AY935854_1(AY935854|pid:none) Elaeocarpus reticulatus isolate 32... 413 e-163
AB267997_1(AB267997|pid:none) Micrandra spruceana chloroplast at... 412 e-163
AB233725_1(AB233725|pid:none) Flacourtia indica chloroplast atpB... 412 e-163
AB233673_1(AB233673|pid:none) Neoboutonia mannii chloroplast atp... 412 e-163
AB233708_1(AB233708|pid:none) Astrocasia tremula chloroplast atp... 412 e-163
AB233650_1(AB233650|pid:none) Chaetocarpus africanus chloroplast... 412 e-163
AB268006_1(AB268006|pid:none) Adenopeltis serrata chloroplast at... 412 e-163
AB233674_1(AB233674|pid:none) Schinziophyton rautanenii chloropl... 412 e-163
AB233678_1(AB233678|pid:none) Hura crepitans chloroplast atpB ge... 412 e-163
AB268002_1(AB268002|pid:none) Suregada aequoreum chloroplast atp... 412 e-163
AB233659_1(AB233659|pid:none) Mercurialis leiocarpa chloroplast ... 412 e-163
AB233652_1(AB233652|pid:none) Chrozophora oblongifolia chloropla... 412 e-163
AB233717_1(AB233717|pid:none) Scagea oligostemon chloroplast atp... 409 e-163
AB233665_1(AB233665|pid:none) Trigonopleura malayana chloroplast... 412 e-163
AB267992_1(AB267992|pid:none) Elateriospermum tapos chloroplast ... 412 e-163
AY788238_1(AY788238|pid:none) Microdesmis puberula ATP synthase ... 412 e-163
AY788228_1(AY788228|pid:none) Hura crepitans ATP synthase beta s... 412 e-163
EU437609_1(EU437609|pid:none) Campanula bononiensis ATP synthase... 417 e-163
AY830231_1(AY830231|pid:none) Petalodiscus fadenii ATP synthase ... 414 e-163
AY830197_1(AY830197|pid:none) Astrocasia neurocarpa ATP synthase... 412 e-163
EU437619_1(EU437619|pid:none) Diosphaera rumeliana ATP synthase ... 417 e-163
DQ781004_1(DQ781004|pid:none) Parafestuca albida ATP synthase be... 414 e-163
AF066837_1(AF066837|pid:none) Casimiroa edulis ATP synthase beta... 413 e-163
EF174608_1(EF174608|pid:none) Lysipomia pumila voucher Ayers 118... 414 e-163
AB037543_1(AB037543|pid:none) Oryza sativa chloroplast atpB mRNA... 413 e-163
(Q09MH1) RecName: Full=ATP synthase subunit beta, chloroplastic;... 411 e-163
(A4QL26) RecName: Full=ATP synthase subunit beta, chloroplastic;... 410 e-163
AF233085_1(AF233085|pid:none) Luzuriaga latifolia ATP synthase b... 413 e-163
DQ908948_1(DQ908948|pid:none) Phyllostachys pubescens AtpB (atpB... 413 e-163
(Q8SLY2) RecName: Full=ATP synthase subunit beta, chloroplastic;... 414 e-163
EU437664_1(EU437664|pid:none) Campanula elatines ATP synthase be... 415 e-163
AB233633_1(AB233633|pid:none) Ceratiosicyos laevis chloroplast a... 412 e-163
AB267974_1(AB267974|pid:none) Macaranga aleuritoides chloroplast... 412 e-163
AB233662_1(AB233662|pid:none) Pycnocoma cornuta chloroplast atpB... 412 e-163
AB267985_1(AB267985|pid:none) Tragiella anomala chloroplast atpB... 412 e-163
AB233658_1(AB233658|pid:none) Macaranga tanarius chloroplast atp... 412 e-163
AB233669_1(AB233669|pid:none) Croton insularis chloroplast atpB ... 412 e-163
AB233713_1(AB233713|pid:none) Phyllanthus flexuosus chloroplast ... 410 e-163
AF093376_1(AF093376|pid:none) Haloragus erecta ATP synthase beta... 409 e-163
AY788266_1(AY788266|pid:none) Dapania racemosa ATP synthase beta... 413 e-163
AB233656_1(AB233656|pid:none) Dicoelia beccariana chloroplast at... 412 e-163
AB233664_1(AB233664|pid:none) Romanoa tamnoides chloroplast atpB... 412 e-163
AY788236_1(AY788236|pid:none) Lunania sp. Alford 69 ATP synthase... 412 e-163
AY788241_1(AY788241|pid:none) Omphalea diandra ATP synthase beta... 413 e-163
AF066848_1(AF066848|pid:none) Ptaeroxylon obliquum ATP synthase ... 412 e-163
AF209571_1(AF209571|pid:none) Crossosoma californicum ATP syntha... 412 e-163
AY788215_1(AY788215|pid:none) Ctenolophon englerianus ATP syntha... 412 e-163
AY788227_1(AY788227|pid:none) Spathiostemon javensis ATP synthas... 412 e-163
(P31476) RecName: Full=ATP synthase subunit beta, chloroplastic;... 413 e-163
AB233649_1(AB233649|pid:none) Caryodendron orinocense chloroplas... 412 e-163
DQ646015_1(DQ646015|pid:none) Conocephalum conicum ATPase beta s... 412 e-163
EF694737_1(EF694737|pid:none) Lobelia arnhemiaca voucher Albrech... 415 e-163
EF174609_1(EF174609|pid:none) Lysipomia sphagnophila voucher San... 414 e-163
EF999978_1(EF999978|pid:none) Lobelia sp. EBK-2007a voucher Alla... 414 e-163
AJ236204_1(AJ236204|pid:none) Nymphoides geminata atpB gene. 414 e-163
AF209681_1(AF209681|pid:none) Stylobasium spathulatum ATP syntha... 412 e-163
AF093383_1(AF093383|pid:none) Itea ilicifolia ATP synthase beta ... 414 e-163
AJ419143_1(AJ419143|pid:none) Joinvillea gaudichaudiana partial ... 417 e-163
AY096108_1(AY096108|pid:none) Aldrovanda vesiculosa ATP synthase... 411 e-163
AB233679_1(AB233679|pid:none) Pimelodendron griffithianum chloro... 412 e-163
AB233635_1(AB233635|pid:none) Kiggelaria africana chloroplast at... 412 e-163
AY788217_1(AY788217|pid:none) Dovyalis rhamnoides ATP synthase b... 412 e-163
AB267966_1(AB267966|pid:none) Adelia ricinella chloroplast atpB ... 412 e-163
AB233655_1(AB233655|pid:none) Dalechampia spathulata chloroplast... 412 e-163
AJ235552_1(AJ235552|pid:none) Parnassia palustris chloroplast at... 411 e-163
FJ571175_1(FJ571175|pid:none) Gomphichis crassilabia voucher ABA... 411 e-163
EU642739_1(EU642739|pid:none) Grevillea caleyi ATP synthase beta... 414 e-163
AF209527_1(AF209527|pid:none) Androstachys johnsonii ATP synthas... 413 e-163
AY788231_1(AY788231|pid:none) Kiggelaria sp. Alford 51 ATP synth... 412 e-163
AB267978_1(AB267978|pid:none) Paranecepsia alchorneifolia chloro... 412 e-163
AF209664_1(AF209664|pid:none) Quiina pteridophylla ATP synthase ... 411 e-163
AF209533_1(AF209533|pid:none) Asteropeia micraster ATP synthase ... 414 e-163
AY788247_1(AY788247|pid:none) Pimelodendron zoanthogyne ATP synt... 412 e-163
AF209550_1(AF209550|pid:none) Cajophora acuminata ATP synthase b... 412 e-163
AF209610_1(AF209610|pid:none) Kiggelaria africana ATP synthase b... 412 e-163
AY788233_1(AY788233|pid:none) Lasiocroton bahamensis ATP synthas... 412 e-163
AY788216_1(AY788216|pid:none) Dalechampia spathulata ATP synthas... 412 e-163
AY788223_1(AY788223|pid:none) Hevea sp. Gillespie 4272 ATP synth... 411 e-163
AY830192_1(AY830192|pid:none) Andrachne aspera ATP synthase beta... 412 e-163
AB267967_1(AB267967|pid:none) Argomuellera macrophylla chloropla... 412 e-163
AY830213_1(AY830213|pid:none) Gonatogyne brasiliensis ATP syntha... 412 e-163
EU717530_1(EU717530|pid:none) Tephrosia rhodesica isolate 17 mem... 413 e-163
CP000554_498(CP000554|pid:none) Prochlorococcus marinus str. MIT... 400 e-163
EF174612_1(EF174612|pid:none) Centropogon baezanus voucher Muchh... 415 e-163
EF694719_1(EF694719|pid:none) Lobelia sp. EBK-2007 voucher Gray ... 415 e-163
EF694724_1(EF694724|pid:none) Lobelia macrodon voucher Knox 5030... 415 e-163
EU437668_1(EU437668|pid:none) Campanula rotundifolia ATP synthas... 414 e-163
AJ236192_1(AJ236192|pid:none) Erithalis fruticosa atpB gene. 414 e-163
AJ417590_1(AJ417590|pid:none) Eustrephus latifolius plastid atpB... 413 e-163
EU437663_1(EU437663|pid:none) Campanula cretica ATP synthase bet... 413 e-163
(Q49KZ1) RecName: Full=ATP synthase subunit beta, chloroplastic;... 412 e-163
EU042774_1(EU042774|pid:none) Ailanthus triphysa AtpB (atpB) gen... 410 e-163
(A4QLU0) RecName: Full=ATP synthase subunit beta, chloroplastic;... 409 e-163
AF168912_1(AF168912|pid:none) Eustrephus latifolius ATP synthase... 413 e-163
AF168905_1(AF168905|pid:none) Cymbocarpa refracta ATP synthase b... 413 e-163
EU642724_1(EU642724|pid:none) Gevuina avellana ATP synthase beta... 414 e-163
AJ235434_1(AJ235434|pid:none) Cinchona pubescens chloroplast atp... 414 e-163
AY465548_1(AY465548|pid:none) Luzuriaga radicans ATP synthase be... 413 e-163
AB233698_1(AB233698|pid:none) Diporidium greveanum chloroplast a... 412 e-163
AB233699_1(AB233699|pid:none) Gomphia serrata chloroplast atpB g... 412 e-163
AB354446_1(AB354446|pid:none) Fusispermum laxiflorum chloroplast... 412 e-163
AJ318971_1(AJ318971|pid:none) Dampiera spicigera partial atpB ge... 412 e-163
AJ235609_1(AJ235609|pid:none) Stachyurus praecox chloroplast atp... 412 e-163
AJ236200_1(AJ236200|pid:none) Gerbera jamesonii atpB gene. 412 e-163
AJ233113_1(AJ233113|pid:none) Tilia platyphyllos chloroplast atp... 412 e-163
AB267975_1(AB267975|pid:none) Mallotus japonicus chloroplast atp... 411 e-163
AB267970_1(AB267970|pid:none) Erythrococca anomala chloroplast a... 411 e-163
AB233730_1(AB233730|pid:none) Xylosma congesta chloroplast atpB ... 411 e-163
AF209586_1(AF209586|pid:none) Trigonobalanus verticillata ATP sy... 410 e-163
(A2C6Z4) RecName: Full=ATP synthase subunit beta; EC=3.... 400 e-163
AY788260_1(AY788260|pid:none) Tripterygium regelii ATP synthase ... 412 e-163
AF209697_1(AF209697|pid:none) Xanthoceras sorbifolium ATP syntha... 410 e-163
AJ235576_1(AJ235576|pid:none) Quisqualis indica chloroplast atpB... 411 e-163
AY788202_1(AY788202|pid:none) Archytaea multiflora ATP synthase ... 413 e-163
DQ780953_1(DQ780953|pid:none) Aira cupaniana ATP synthase beta s... 413 e-163
AJ235605_1(AJ235605|pid:none) Sophora toromiro chloroplast atpB ... 412 e-163
AB233711_1(AB233711|pid:none) Flueggea virosa chloroplast atpB g... 411 e-163
AJ235480_1(AJ235480|pid:none) Geum sp. 'Chase 2507 K' chloroplas... 413 e-163
DQ780955_1(DQ780955|pid:none) Alopecurus textilis ATP synthase b... 413 e-163
(A1VXJ0) RecName: Full=ATP synthase subunit beta; EC=3.... 384 e-163
EU002162_1(EU002162|pid:none) Gunnera manicata ATP synthase CF1 ... 412 e-163
EU437577_1(EU437577|pid:none) Campanula saxatilis ATP synthase b... 416 e-163
EU437600_1(EU437600|pid:none) Pseudonemacladus oppositifolius AT... 416 e-163
EF174622_1(EF174622|pid:none) Centropogon aequatorialis voucher ... 415 e-163
AJ236233_1(AJ236233|pid:none) Decumaria barbara atpB gene. 413 e-163
(Q09X10) RecName: Full=ATP synthase subunit beta, chloroplastic;... 412 e-163
EU042778_1(EU042778|pid:none) Brucea javanica AtpB (atpB) gene, ... 410 e-163
(A4QK25) RecName: Full=ATP synthase subunit beta, chloroplastic;... 409 e-163
AJ235569_1(AJ235569|pid:none) Polygonum sachalinense chloroplast... 412 e-163
AB267968_1(AB267968|pid:none) Discoglypremna caloneura chloropla... 412 e-163
AB354443_1(AB354443|pid:none) Anchietea selloviana chloroplast a... 412 e-163
AF060397_1(AF060397|pid:none) Stirlingia latifolia ATP synthase ... 412 e-163
AY935847_1(AY935847|pid:none) Tripterococcus brunonis isolate 25... 411 e-163
AB354450_1(AB354450|pid:none) Gloeospermum sphaerocarpum chlorop... 411 e-163
(A4QJC2) RecName: Full=ATP synthase subunit beta, chloroplastic;... 410 e-163
AY792722_1(AY792722|pid:none) Phlomis lychnitis voucher LY3-54 A... 415 e-163
AY968424_1(AY968424|pid:none) Anisophyllea corneri ATP synthase ... 414 e-163
AF209672_1(AF209672|pid:none) Scoliopus hallii ATP synthase beta... 411 e-163
AY935852_1(AY935852|pid:none) Connarus championii isolate 30 ATP... 410 e-163
(A3PES6) RecName: Full=ATP synthase subunit beta; EC=3.... 403 e-163
AY788199_1(AY788199|pid:none) Acalypha californica ATP synthase ... 408 e-163
AY830216_1(AY830216|pid:none) Hymenocardia acida ATP synthase be... 412 e-163
AF209539_1(AF209539|pid:none) Bauera rubioides ATP synthase beta... 411 e-163
AY830191_1(AY830191|pid:none) Amanoa strobilacea ATP synthase be... 411 e-163
AB233714_1(AB233714|pid:none) Aristogeitonia monophylla chloropl... 408 e-163
DQ780959_1(DQ780959|pid:none) Arctagrostis latifolia ATP synthas... 416 e-163
AF209607_1(AF209607|pid:none) Ixonanthes icosandra ATP synthase ... 412 e-163
EU042793_1(EU042793|pid:none) Holacantha emoryi AtpB (atpB) gene... 410 e-163
CP001034_2792(CP001034|pid:none) Natranaerobius thermophilus JW/... 405 e-163
DQ186619_1(DQ186619|pid:none) Micavibrio sp. EPB AtpD gene, part... 408 e-163
EF174604_1(EF174604|pid:none) Lobelia polyphylla voucher Lammers... 414 e-163
EF174636_1(EF174636|pid:none) Burmeistera multiflora voucher Muc... 414 e-163
EF174638_1(EF174638|pid:none) Burmeistera cyclostigmata voucher ... 414 e-163
EF174610_1(EF174610|pid:none) Centropogon granulosus subsp. nuta... 414 e-163
EF174633_1(EF174633|pid:none) Burmeistera domingensis voucher Mu... 414 e-163
(Q06RC2) RecName: Full=ATP synthase subunit beta, chloroplastic;... 410 e-163
AJ318972_1(AJ318972|pid:none) Dialypetalum sp. Gustafsson 244 pa... 414 e-163
AF168952_1(AF168952|pid:none) Xanthorrhoea quadrangulata ATP syn... 413 e-163
AJ235515_1(AJ235515|pid:none) Lactoris fernandeziana chloroplast... 413 e-163
AY725917_1(AY725917|pid:none) Hydrangea sp. JS-2005 ATP synthase... 413 e-163
AJ419148_1(AJ419148|pid:none) Mayaca fluviatilis partial chlorop... 410 e-163
(Q32RY8) RecName: Full=ATP synthase subunit beta, chloroplastic;... 402 e-163
EU437638_1(EU437638|pid:none) Musschia aurea ATP synthase beta s... 415 e-163
FJ571207_1(FJ571207|pid:none) Stenorrhynchos speciosum voucher 2... 414 e-163
AY147595_1(AY147595|pid:none) Tofieldia glutinosa ATP synthase b... 412 e-163
AJ419677_1(AJ419677|pid:none) Desfontainia spinosa chloroplast p... 412 e-163
AB354442_1(AB354442|pid:none) Anchietea salutaris chloroplast at... 412 e-163
AJ494840_1(AJ494840|pid:none) Pennantia corymbosa chloroplast pa... 412 e-163
FJ571176_1(FJ571176|pid:none) Gonatostylis vieillardii voucher K... 411 e-163
AB233686_1(AB233686|pid:none) Lacistema aggregatum chloroplast a... 410 e-163
AY788207_1(AY788207|pid:none) Centroplacus glaucinus ATP synthas... 410 e-163
FJ571189_1(FJ571189|pid:none) Porphyrostachys parviflora voucher... 410 e-163
(Q19V65) RecName: Full=ATP synthase subunit beta, chloroplastic;... 413 e-163
AY788263_1(AY788263|pid:none) Celastrus orbiculatus ATP synthase... 411 e-163
AF502597_1(AF502597|pid:none) Strasburgeria robusta ATP synthase... 411 e-163
AF209526_1(AF209526|pid:none) Ancistrocladus korupensis ATP synt... 412 e-163
AY788255_1(AY788255|pid:none) Suregada boiviniana ATP synthase b... 410 e-163
AJ235531_1(AJ235531|pid:none) Megacarpaea polyandra chloroplast ... 408 e-163
AY830206_1(AY830206|pid:none) Bridelia retusa ATP synthase beta ... 413 e-163
AY830235_1(AY830235|pid:none) Phyllanthus cf. fuscoluridus Hoffm... 410 e-163
AF308039_1(AF308039|pid:none) Croomia japonica ATP synthase beta... 414 e-163
AF066839_1(AF066839|pid:none) Aegle marmelos ATP synthase beta s... 409 e-163
AF066834_1(AF066834|pid:none) Calodendrum capense ATP synthase b... 409 e-163
EU717515_1(EU717515|pid:none) Cajanus cajan isolate 121 membrane... 412 e-163
EU717519_1(EU717519|pid:none) Campylotropis macrocarpa isolate 9... 412 e-163
EU717526_1(EU717526|pid:none) Hardenbergia violacea isolate 117 ... 412 e-163
EU437624_1(EU437624|pid:none) Campanula pinatzii ATP synthase be... 415 e-163
EU437626_1(EU437626|pid:none) Campanula erinus ATP synthase beta... 415 e-163
AF308035_1(AF308035|pid:none) Pentastemona sumatrana ATP synthas... 415 e-163
EF174632_1(EF174632|pid:none) Burmeistera sp. Muchhala 142 ATP s... 414 e-163
>(P49376) RecName: Full=ATP synthase subunit beta, mitochondrial;
EC=3.6.3.14; Flags: Precursor;
&CR382124_441(CR382124|pid:none)
&GN102389_1(GN102389|pid:none) &U37764_1(U37764|pid:none)
Length = 505
Score = 452 bits (1162), Expect(2) = 0.0
Identities = 241/351 (68%), Positives = 271/351 (77%)
Frame = +3
Query: 429 YSKLNENQGVVHQVIGAVVDVYFPHGKLPYINDALIVDDFQAENVEKVIEDLNNPSLKGK 608
Y+ +QG V VIGA+VDV F G+LP I +AL +D +
Sbjct: 30 YAAAASSQGKVRAVIGAIVDVQFEQGQLPAILNALEIDTPEG------------------ 71
Query: 609 IDFNNVPISNIKLVLEVAQHLGDGIVRCVALDITDGLGRGALVLNTGSPLMVPVGQATLG 788
KLVLEVAQHLG+ VR +A+D T+GL RG V +TG+P+ VPVG+ TLG
Sbjct: 72 -----------KLVLEVAQHLGENTVRTIAMDGTEGLVRGENVSDTGAPISVPVGRETLG 120
Query: 789 RIMNVIGEPIDGCGPIPATEKRPIWRAPPPFADLAPSASILETGIKVIDLLAPYSRGGKI 968
RI+NVIGEPID GPI + ++PI PP F + + +A +LETGIKV+DLLAPY+RGGKI
Sbjct: 121 RIINVIGEPIDERGPINSKMRKPIHADPPLFVEQSTAAEVLETGIKVVDLLAPYARGGKI 180
Query: 969 GLFGGAGVGKTVLIQELINNIAKAHGGFSVFTGVGERTREGNDLYHEMVEAGVIKKEGPG 1148
GLFGGAGVGKTV IQELINNIAKAHGGFSVFTGVGERTREGNDLY EM E GVI EG
Sbjct: 181 GLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEG-D 239
Query: 1149 SKVALVFGQMNEPPGARARVTLTGLTVAEYFRDAEGQDVLLFIDNIFRFTQAGSEMSALL 1328
SKVALVFGQMNEPPGARARV LTGLT+AEYFRD EGQDVLLFIDNIFRFTQAGSE+SALL
Sbjct: 240 SKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALL 299
Query: 1329 GRIPSAVGYQPTLATDMGCMQERIATTKKGSITSVQAVYVPADDLTDPAPS 1481
GRIPSAVGYQPTLATDMG +QERI TTKKGS+TSVQAVYVPADDLTDPAP+
Sbjct: 300 GRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPA 350
Score = 223 bits (567), Expect(2) = 0.0
Identities = 113/156 (72%), Positives = 125/156 (80%)
Frame = +1
Query: 1477 PATTFAHLDATTVLSRAISELGIYPCVDPLDSTSLMMDPNIIGVEHYKVATDVQKILQEY 1656
PATTFAHLDATTVLSR ISELGIYP VDPLDS S ++D ++G EHY VAT VQ+ LQ Y
Sbjct: 349 PATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVATQVQQTLQAY 408
Query: 1657 KSLQDIIAILGMDDLSEDQKATVFRARKIQRFLSQPFEVAHAFTNMEGRFVKLSDSIKAF 1836
KSLQDIIAILGMD+LSE K TV RARKIQRFLSQPF VA FT + GR V+L D+I +F
Sbjct: 409 KSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGRLVRLKDTISSF 468
Query: 1837 KGILEGKYDHLPEAAFYMVGGIEDVEIKAAKLLESA 1944
K +L+GKYDHLPE AFYMVGGIEDV KA KL A
Sbjct: 469 KAVLDGKYDHLPENAFYMVGGIEDVVAKAEKLAAEA 504
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 3,679,382,903
Number of extensions: 79520544
Number of successful extensions: 261735
Number of sequences better than 10.0: 6775
Number of HSP's gapped: 251636
Number of HSP's successfully gapped: 10383
Length of query: 775
Length of database: 1,061,185,681
Length adjustment: 137
Effective length of query: 638
Effective length of database: 613,408,305
Effective search space: 391354498590
Effective search space used: 391354498590
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
2 |
| VH (FL, L) |
62 |
| VF (FL, S) |
18 |
| AH (FL, L) |
6 |
| AF (FL, S) |
3 |
| SL (DIR, L) |
6 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
1 |
| SF (FL, S) |
5 |
| CH (FL, L) |
0 |
| CF (FL, S) |
1 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
6 |
| FC-IC (SUB) |
1 |