Contig-U16276-1
Contig ID Contig-U16276-1
Contig update 2004. 6.11
Contig sequence
>Contig-U16276-1 (Contig-U16276-1Q) /CSM_Contig/Contig-U16276-1Q.Seq.d
CACTGTTGGCCTACTGGGTTGAAATTTTCACATCAAAACAAAATGGTCAT
GAAATTATACACCTACCCACAAAACAGCCGTGCTTTCAAAAGTTTAATTG
CTGCTAAATACGTCAATGTTGATATTGAAGTACCAGCTTTCAACTTTGAA
ACTGATCGTTTAACTGAAGAGTTCAAAACCAACTTCCCATTAGGTAAAGT
TCCAGCTTTATTAACTGAACAAGGTCCACTCTTTGAATCAAACACCATGG
CTCGTTATGTTGCTCGTTTAAATAACAGCACCATCTATGGTTCAGATGCA
TACACTGCCGCCCTCAATGACCAATGGATTGATTATGCAGCCAACGAAAT
CGACCCAAATGCCATTCCATGGTTATATGCCATCCTCGGTTATTACGATT
ACAATGCTAAAGACAGCAACAAAGCCAAAGAAAACATGAAAAAAGTCTTA
GCTTTCCTCGATGCCCAACTCCTCAACAAGCCATTCCTTACTGGTTTCCG
TGTCGCTCTTGCCGATATCATCGTTGTTTGTTCATTATTCAACTTTTACA
AAATGGTCTTTGAACCAACTTTCCGTTCCCCATACGTTAACGTCAACAGA
TGGTTCACCACCTGTATCAACCAACCAAACTTCAAAGCTGTCATTGGTGA
ATTTGCTCTCTGTGAAAAGATGATGGTCTACGTTGCTCCAAAGAAGGAAG
TCAAAGAAGAAAAACCAAAAGCTGCCCCAAAGAAGGAAGTCAAAGAAGAC
GCTGGTGACGATGAAGTCGATGAAAAACCAAAAAAGAAAAACCCATTAGA
TGAATTAGCTCCATCAACCTTTGTTTTGGATGAATTCAAACGTACCTACT
CCAACAATGAAGTCTCCATGTCCATTCCATGGTTCTTTGAACACTTTGAC
AAGGAAGGTTTCTCTGTCTACCAATGTACCTACCAATACAATCACGAATT
AGGTCCAGTCTTCAAAACTTGCAACTTGGTTGGTGGTTTCTTCCAAAGAC
TCGAAACTCTCCACAAATACGCTTTCGCCTCTATGATCATTTTCGGTGAA
GAACAAGGTGGTGCCGTCAAAGATCAAACCGTCTCTGGTCTCTGGGTTTT
CCGTGGTCAAGATTTACCAGCTGACATGAAAGATTGTGATGATTCTTTAG
TCTATGACTGGAAGAAACTCGATGTTGCTGCTGATAAAGCTATCATTGAA
TCTTTCCTTGCTTGGGAAGATAAAAACGGTGGTTTCGCTGGTAAGAAATT
CTTACAAGGTAAATTATACAAATAAATTAATTTAAATTTAATTTAAAATT
TTTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Gap no gap
Contig length 1334
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 89604
End point 90920
Strand (PLUS/MINUS) PLUS
Number of clones 151
Number of EST 220
Link to clone list U16276
List of clone(s)

est1=AFJ281F,1,446
est2=VFB777F,2,254
est3=VFL452F,2,133
est4=SFD490F,3,573
est5=AFK126F,6,473
est6=SFK125F,8,671
est7=VFH501F,10,525
est8=VFE844F,11,527
est9=VFG818F,11,617
est10=VFI711F,12,627
est11=AFD331E,18,1280
est12=AFD383E,18,1288
est13=AFH857F,18,624
est14=AFL377F,18,526
est15=CFD125F,18,527
est16=CFG391F,18,592
est17=SFC754F,18,408
est18=SFD518E,18,1307
est19=SFE656E,18,1309
est20=SFJ153F,19,195
est21=VFA594F,19,623
est22=VFC558F,19,627
est23=VFC846F,19,627
est24=VFD134E,19,1310
est25=VFE775F,19,473
est26=VFF122F,19,631
est27=VFF622E,19,1311
est28=VFF735F,19,622
est29=VFF895E,19,1311
est30=VFG211F,19,525
est31=VFG446F,19,621
est32=VFI250F,19,569
est33=VFJ212E,19,1308
est34=VFJ749F,19,536
est35=VFK203F,19,659
est36=VFK442F,19,568
est37=VFK715F,19,627
est38=VFL147F,19,626
est39=VFL213F,19,635
est40=VFL423F,19,628
est41=VFM208F,19,525
est42=VFM853F,19,675
est43=VFN740F,19,592
est44=VFC663F,20,627
est45=VFD877F,20,533
est46=SFD315F,21,595
est47=SFD373F,21,496
est48=SFG267F,21,525
est49=VFE170E,21,1310
est50=VFC596F,22,622
est51=VFC851F,22,568
est52=VFD609F,22,626
est53=VFD838F,22,594
est54=VFE506F,22,511
est55=VFF676F,22,526
est56=VFH188F,22,532
est57=VFH456F,22,569
est58=VFH496F,22,538
est59=VFK112E,22,1271
est60=VFN290F,22,572
est61=VFN788F,22,572
est62=VFO552F,22,618
est63=SFI240F,23,562
est64=VFK792F,24,567
est65=SFD840F,30,622
est66=VFB836E,31,1308
est67=VFC524F,31,673
est68=VFD517E,31,1311
est69=VFF192F,31,588
est70=VFJ406F,31,571
est71=VFK309F,31,573
est72=VFK737F,31,627
est73=VFO194F,31,569
est74=VFO551F,31,622
est75=VFO556F,31,591
est76=VFO605F,31,591
est77=SLB270E,32,1316
est78=SLE564E,32,781
est79=SLK268F,32,221
est80=VHJ281F,32,524
est81=VFO704F,33,618
est82=SLA292E,36,541
est83=SLK640F,36,721
est84=VFA315F,36,622
est85=VFJ538F,38,607
est86=VFB247F,41,543
est87=FC-AC13E,50,1308
est88=VFH627F,50,466
est89=SFI263F,51,422
est90=SLK573F,52,347
est91=VSF669F,52,673
est92=VFH572F,53,567
est93=VFH666F,54,659
est94=SLD879F,68,352
est95=VFN153E,168,1309
est96=VFO335F,196,325
est97=VSG852F,279,694
est98=VFM141F,344,523
est99=VFM210F,362,505
est100=VFO605Z,560,1294
est101=VFI285Z,563,956
est102=VFB777Z,573,1310
est103=VFO194Z,573,1292
est104=CFG391Z,574,1208
est105=SFG267Z,576,1276
est106=SFD490Z,577,1306
est107=SFI263Z,578,1308
est108=VFJ406Z,578,1309
est109=VFC846Z,580,1310
est110=VFD877Z,582,1308
est111=VFG818Z,582,1311
est112=VFF192Z,589,1308
est113=VFG446Z,591,1308
est114=AFH857Z,598,1298
est115=VFN290Z,599,1308
est116=VFC663Z,600,1310
est117=VFF735Z,600,1311
est118=VFH501Z,602,1308
est119=VFK309Z,602,1269
est120=VFJ538Z,603,1269
est121=SFD840Z,605,1265
est122=SFI240Z,605,1307
est123=VFA594Z,605,1269
est124=VFD609Z,605,1311
est125=VFF122Z,606,1308
est126=VFM208Z,606,1309
est127=SLE720Z,607,1316
est128=SFD373Z,612,1309
est129=VFD838Z,613,1311
est130=VFC558Z,614,1311
est131=SFD315Z,615,1309
est132=VFA315Z,615,1269
est133=VFK715Z,616,1310
est134=VFL213Z,616,1307
est135=VFO704Z,616,1271
est136=SFC754Z,617,1277
est137=VFM210Z,617,1308
est138=VFI250Z,619,1286
est139=VFM141Z,620,1307
est140=VFK203Z,621,1269
est141=VFL452Z,621,1307
est142=VFH627Z,623,1308
est143=VFK737Z,624,1308
est144=VFL423Z,624,1310
est145=SLA282Z,630,1334
est146=SLE111Z,631,1313
est147=VFF676Z,631,1309
est148=FC-AH13Z,632,1315
est149=VFC851Z,632,1299
est150=VFH572Z,638,1308
est151=SLH615Z,655,1330
est152=AFK126Z,656,1273
est153=VSG282E,659,1220
est154=VFG456Z,667,1283
est155=VFO552Z,670,1269
est156=VFI711Z,680,1297
est157=VFK792Z,680,1307
est158=VFO556Z,680,1289
est159=VFB247Z,682,1269
est160=AFL377Z,684,1261
est161=VFH456Z,687,1209
est162=VFE506Z,688,1297
est163=VFE775Z,688,1284
est164=VFH496Z,688,1288
est165=VFJ749Z,688,1268
est166=VFL147Z,688,1310
est167=VFM853Z,688,1294
est168=VSF669Z,688,1275
est169=FC-AR07Z,711,1315
est170=SLG662Z,711,1303
est171=SLE265Z,713,1328
est172=SLE847Z,713,1319
est173=SLE891Z,713,1319
est174=SLB345Z,715,1313
est175=SLK647Z,727,1326
est176=FC-AQ19Z,737,1315
est177=SLF370Z,738,1316
est178=VFG555Z,740,1297
est179=SLD161Z,751,1307
est180=SLD170Z,754,1313
est181=SLH694Z,757,1315
est182=SLF226Z,765,1319
est183=SLF351Z,771,1313
est184=SLA327Z,781,1325
est185=FC-AN04E,785,1334
est186=SLI495Z,788,1313
est187=SLD345Z,789,1316
est188=SLF228Z,789,1323
est189=SLD278Z,790,1334
est190=SLC774Z,792,1315
est191=SLC425Z,794,1313
est192=SLI895Z,796,1322
est193=SLF190Z,800,1323
est194=SLC586Z,815,1313
est195=VFK442Z,823,1293
est196=VFH666Z,826,1280
est197=SLC391Z,828,1313
est198=SLG368Z,839,1314
est199=VFH188Z,849,1207
est200=SLG530E,916,1316
est201=SLG464Z,928,1321
est202=VFO335Z,929,1137
est203=SLD680F,932,1065
est204=SLF261Z,942,1316
est205=SLA536Z,957,1318
est206=SLA701Z,976,1334
est207=FC-AJ20Z,979,1325
est208=SLJ864Z,1003,1313
est209=SLJ701Z,1037,1283
est210=SLJ366Z,1039,1313
est211=VSK167F,1045,1325
est212=VSK167Z,1045,1299
est213=SLH750E,1059,1318
est214=SLJ660Z,1080,1322
est215=SLK324Z,1087,1313
est216=SFA339Z,1096,1271
est217=SLJ608Z,1109,1303
est218=SLD680Z,1134,1323
est219=VFC524Z,1154,1308
est220=SLK573Z,1191,1334
Translated Amino Acid sequence
HCWPTGLKFSHQNKMVMKLYTYPQNSRAFKSLIAAKYVNVDIEVPAFNFETDRLTEEFKT
NFPLGKVPALLTEQGPLFESNTMARYVARLNNSTIYGSDAYTAALNDQWIDYAANEIDPN
AIPWLYAILGYYDYNAKDSNKAKENMKKVLAFLDAQLLNKPFLTGFRVALADIIVVCSLF
NFYKMVFEPTFRSPYVNVNRWFTTCINQPNFKAVIGEFALCEKMMVYVAPKKEVKEEKPK
AAPKKEVKEDAGDDEVDEKPKKKNPLDELAPSTFVLDEFKRTYSNNEVSMSIPWFFEHFD
KEGFSVYQCTYQYNHELGPVFKTCNLVGGFFQRLETLHKYAFASMIIFGEEQGGAVKDQT
VSGLWVFRGQDLPADMKDCDDSLVYDWKKLDVAADKAIIESFLAWEDKNGGFAGKKFLQG
KLYK*inlnli*nff*kkkkkkkk


Translated Amino Acid sequence (All Frames)
Frame A:
HCWPTGLKFSHQNKMVMKLYTYPQNSRAFKSLIAAKYVNVDIEVPAFNFETDRLTEEFKT
NFPLGKVPALLTEQGPLFESNTMARYVARLNNSTIYGSDAYTAALNDQWIDYAANEIDPN
AIPWLYAILGYYDYNAKDSNKAKENMKKVLAFLDAQLLNKPFLTGFRVALADIIVVCSLF
NFYKMVFEPTFRSPYVNVNRWFTTCINQPNFKAVIGEFALCEKMMVYVAPKKEVKEEKPK
AAPKKEVKEDAGDDEVDEKPKKKNPLDELAPSTFVLDEFKRTYSNNEVSMSIPWFFEHFD
KEGFSVYQCTYQYNHELGPVFKTCNLVGGFFQRLETLHKYAFASMIIFGEEQGGAVKDQT
VSGLWVFRGQDLPADMKDCDDSLVYDWKKLDVAADKAIIESFLAWEDKNGGFAGKKFLQG
KLYK*inlnli*nff*kkkkkkkk


Frame B:
tvgllg*nfhiktkws*nytpthktavlskv*lllntsmlilkyqlstlkliv*lksskp
tsh*vkfqly*lnkvhslnqtpwlvmllv*itapsmvqmhtlppsmtnglimqptkstqm
pfhgympssvititmlktatkpkkt*kks*lssmpnsstshsllvsvsllpisslfvhys
tftkwslnqlsvphtltstdgsppvstnqtsklslvnllsvkr*wstllqrrkskkknqk
lpqrrkskktlvtmksmknqkrkth*mn*lhqplfwmnsnvptptmkspcpfhgslntlt
rkvslstnvptntitn*vqssklatwlvvsskdsklstntlspl*sfsvknkvvpskikp
slvsgfsvvkiyqlt*kivmil*smtgrnsmllliklslnlsllgkiktvvslvrnsykv
nytnkli*i*fkiffkkkkkkkkk


Frame C:
llaywveiftskqngheiihlptkqpcfqkfncc*irqc*y*stsfql*n*sfn*rvqnq
lpir*sssfin*trstl*ikhhgslccsfk*qhhlwfrcihcrpq*pmd*lcsqrnrpkc
hsmvichprllrlqc*rqqqsqrkhekslsfprcptpqqaipywfpcrscryhrclfiiq
llqngl*tnfpfpir*rqqmvhhlyqptklqschw*icsl*kddglrcskegsqrrktks
cpkegsqrrrw*r*sr*ktkkekpir*issinlcfg*iqtyllqq*slhvhsmvl*tl*q
grflclpmylpiqsrirsslqnlqlgwwflpktrnspqirfrlydhfr*rtrwcrqrsnr
lwslgfpwsrfts*herl**ffsl*leetrccc**syh*ifpclgr*krwfrw*eiltr*
iiqin*fkfnlkfflkkkkkkkkk


own update 2004. 6.23
Homology vs CSM-cDNA
Query= Contig-U16276-1 (Contig-U16276-1Q)
/CSM_Contig/Contig-U16276-1Q.Seq.d
(1334 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U16276-1 (Contig-U16276-1Q) /CSM_Contig/Conti... 1530 0.0
Contig-U04002-1 (Contig-U04002-1Q) /CSM_Contig/Conti... 745 0.0
Contig-U10766-1 (Contig-U10766-1Q) /CSM_Contig/Conti... 42 0.002
Contig-U09012-1 (Contig-U09012-1Q) /CSM_Contig/Conti... 42 0.002
Contig-U12817-1 (Contig-U12817-1Q) /CSM_Contig/Conti... 40 0.009
Contig-U10309-1 (Contig-U10309-1Q) /CSM_Contig/Conti... 40 0.009
Contig-U15984-1 (Contig-U15984-1Q) /CSM_Contig/Conti... 38 0.034
Contig-U15835-1 (Contig-U15835-1Q) /CSM_Contig/Conti... 38 0.034
Contig-U15626-1 (Contig-U15626-1Q) /CSM_Contig/Conti... 38 0.034
Contig-U12301-1 (Contig-U12301-1Q) /CSM_Contig/Conti... 38 0.034

>Contig-U16276-1 (Contig-U16276-1Q) /CSM_Contig/Contig-U16276-1Q.Seq.d
Length = 1334

Score = 1530 bits (772), Expect = 0.0
Identities = 772/772 (100%)
Strand = Plus / Plus


Query: 1 cactgttggcctactgggttgaaattttcacatcaaaacaaaatggtcatgaaattatac 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 cactgttggcctactgggttgaaattttcacatcaaaacaaaatggtcatgaaattatac 60


Query: 61 acctacccacaaaacagccgtgctttcaaaagtttaattgctgctaaatacgtcaatgtt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 acctacccacaaaacagccgtgctttcaaaagtttaattgctgctaaatacgtcaatgtt 120


Query: 121 gatattgaagtaccagctttcaactttgaaactgatcgtttaactgaagagttcaaaacc 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gatattgaagtaccagctttcaactttgaaactgatcgtttaactgaagagttcaaaacc 180


Query: 181 aacttcccattaggtaaagttccagctttattaactgaacaaggtccactctttgaatca 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aacttcccattaggtaaagttccagctttattaactgaacaaggtccactctttgaatca 240


Query: 241 aacaccatggctcgttatgttgctcgtttaaataacagcaccatctatggttcagatgca 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 aacaccatggctcgttatgttgctcgtttaaataacagcaccatctatggttcagatgca 300


Query: 301 tacactgccgccctcaatgaccaatggattgattatgcagccaacgaaatcgacccaaat 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tacactgccgccctcaatgaccaatggattgattatgcagccaacgaaatcgacccaaat 360


Query: 361 gccattccatggttatatgccatcctcggttattacgattacaatgctaaagacagcaac 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 gccattccatggttatatgccatcctcggttattacgattacaatgctaaagacagcaac 420


Query: 421 aaagccaaagaaaacatgaaaaaagtcttagctttcctcgatgcccaactcctcaacaag 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aaagccaaagaaaacatgaaaaaagtcttagctttcctcgatgcccaactcctcaacaag 480


Query: 481 ccattccttactggtttccgtgtcgctcttgccgatatcatcgttgtttgttcattattc 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 ccattccttactggtttccgtgtcgctcttgccgatatcatcgttgtttgttcattattc 540


Query: 541 aacttttacaaaatggtctttgaaccaactttccgttccccatacgttaacgtcaacaga 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 aacttttacaaaatggtctttgaaccaactttccgttccccatacgttaacgtcaacaga 600


Query: 601 tggttcaccacctgtatcaaccaaccaaacttcaaagctgtcattggtgaatttgctctc 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 tggttcaccacctgtatcaaccaaccaaacttcaaagctgtcattggtgaatttgctctc 660


Query: 661 tgtgaaaagatgatggtctacgttgctccaaagaaggaagtcaaagaagaaaaaccaaaa 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 tgtgaaaagatgatggtctacgttgctccaaagaaggaagtcaaagaagaaaaaccaaaa 720


Query: 721 gctgccccaaagaaggaagtcaaagaagacgctggtgacgatgaagtcgatg 772
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 gctgccccaaagaaggaagtcaaagaagacgctggtgacgatgaagtcgatg 772


Score = 900 bits (454), Expect = 0.0
Identities = 454/454 (100%)
Strand = Plus / Plus


Query: 792 cccattagatgaattagctccatcaacctttgttttggatgaattcaaacgtacctactc 851
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 792 cccattagatgaattagctccatcaacctttgttttggatgaattcaaacgtacctactc 851


Query: 852 caacaatgaagtctccatgtccattccatggttctttgaacactttgacaaggaaggttt 911
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 852 caacaatgaagtctccatgtccattccatggttctttgaacactttgacaaggaaggttt 911


Query: 912 ctctgtctaccaatgtacctaccaatacaatcacgaattaggtccagtcttcaaaacttg 971
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 912 ctctgtctaccaatgtacctaccaatacaatcacgaattaggtccagtcttcaaaacttg 971


Query: 972 caacttggttggtggtttcttccaaagactcgaaactctccacaaatacgctttcgcctc 1031
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 972 caacttggttggtggtttcttccaaagactcgaaactctccacaaatacgctttcgcctc 1031


Query: 1032 tatgatcattttcggtgaagaacaaggtggtgccgtcaaagatcaaaccgtctctggtct 1091
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1032 tatgatcattttcggtgaagaacaaggtggtgccgtcaaagatcaaaccgtctctggtct 1091


Query: 1092 ctgggttttccgtggtcaagatttaccagctgacatgaaagattgtgatgattctttagt 1151
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1092 ctgggttttccgtggtcaagatttaccagctgacatgaaagattgtgatgattctttagt 1151


Query: 1152 ctatgactggaagaaactcgatgttgctgctgataaagctatcattgaatctttccttgc 1211
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1152 ctatgactggaagaaactcgatgttgctgctgataaagctatcattgaatctttccttgc 1211


Query: 1212 ttgggaagataaaaacggtggtttcgctggtaag 1245
||||||||||||||||||||||||||||||||||
Sbjct: 1212 ttgggaagataaaaacggtggtttcgctggtaag 1245


>Contig-U04002-1 (Contig-U04002-1Q) /CSM_Contig/Contig-U04002-1Q.Seq.d
Length = 680

Score = 745 bits (376), Expect = 0.0
Identities = 382/385 (99%)
Strand = Plus / Plus


Query: 43 atggtcatgaaattatacacctacccacaaaacagccgtgctttcaaaagtttaattgct 102
|||||||||||||||||| |||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atggtcatgaaattatacnnntacccacaaaacagccgtgctttcaaaagtttaattgct 60


Query: 103 gctaaatacgtcaatgttgatattgaagtaccagctttcaactttgaaactgatcgttta 162
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 gctaaatacgtcaatgttgatattgaagtaccagctttcaactttgaaactgatcgttta 120


Query: 163 actgaagagttcaaaaccaacttcccattaggtaaagttccagctttattaactgaacaa 222
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 actgaagagttcaaaaccaacttcccattaggtaaagttccagctttattaactgaacaa 180


Query: 223 ggtccactctttgaatcaaacaccatggctcgttatgttgctcgtttaaataacagcacc 282
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ggtccactctttgaatcaaacaccatggctcgttatgttgctcgtttaaataacagcacc 240


Query: 283 atctatggttcagatgcatacactgccgccctcaatgaccaatggattgattatgcagcc 342
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 atctatggttcagatgcatacactgccgccctcaatgaccaatggattgattatgcagcc 300


Query: 343 aacgaaatcgacccaaatgccattccatggttatatgccatcctcggttattacgattac 402
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 aacgaaatcgacccaaatgccattccatggttatatgccatcctcggttattacgattac 360


Query: 403 aatgctaaagacagcaacaaagcca 427
|||||||||||||||||||||||||
Sbjct: 361 aatgctaaagacagcaacaaagcca 385


Score = 585 bits (295), Expect = e-167
Identities = 295/295 (100%)
Strand = Plus / Plus


Query: 478 aagccattccttactggtttccgtgtcgctcttgccgatatcatcgttgtttgttcatta 537
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 380 aagccattccttactggtttccgtgtcgctcttgccgatatcatcgttgtttgttcatta 439


Query: 538 ttcaacttttacaaaatggtctttgaaccaactttccgttccccatacgttaacgtcaac 597
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 440 ttcaacttttacaaaatggtctttgaaccaactttccgttccccatacgttaacgtcaac 499


Query: 598 agatggttcaccacctgtatcaaccaaccaaacttcaaagctgtcattggtgaatttgct 657
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 500 agatggttcaccacctgtatcaaccaaccaaacttcaaagctgtcattggtgaatttgct 559


Query: 658 ctctgtgaaaagatgatggtctacgttgctccaaagaaggaagtcaaagaagaaaaacca 717
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 560 ctctgtgaaaagatgatggtctacgttgctccaaagaaggaagtcaaagaagaaaaacca 619


Query: 718 aaagctgccccaaagaaggaagtcaaagaagacgctggtgacgatgaagtcgatg 772
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 620 aaagctgccccaaagaaggaagtcaaagaagacgctggtgacgatgaagtcgatg 674


>Contig-U10766-1 (Contig-U10766-1Q) /CSM_Contig/Contig-U10766-1Q.Seq.d
Length = 1351

Score = 42.1 bits (21), Expect = 0.002
Identities = 21/21 (100%)
Strand = Plus / Plus


Query: 1 cactgttggcctactgggttg 21
|||||||||||||||||||||
Sbjct: 1 cactgttggcctactgggttg 21


Database: CSM
Posted date: Jun 21, 2004 1:35 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 12,425
Number of Sequences: 8402
Number of extensions: 12425
Number of successful extensions: 1668
Number of sequences better than 10.0: 713
length of query: 1334
length of database: 8,075,542
effective HSP length: 16
effective length of query: 1318
effective length of database: 7,941,110
effective search space: 10466382980
effective search space used: 10466382980
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 3.23
Homology vs DNA
Query= Contig-U16276-1 (Contig-U16276-1Q) /CSM_Contig/Contig-U16276-1Q.Seq.d
(1334 letters)

Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ410338) Dictyostelium discoideum cDNA clone:ddv12k06, 5' ... 1330 0.0 1
(AU060732) Dictyostelium discoideum slug cDNA, clone SLB270. 1302 0.0 1
(BJ416499) Dictyostelium discoideum cDNA clone:ddv26j14, 5' ... 1289 0.0 1
(AU060615) Dictyostelium discoideum slug cDNA, clone SLK640. 1287 0.0 1
(BJ390117) Dictyostelium discoideum cDNA clone:dds21a07, 5' ... 1287 0.0 1
(BJ412730) Dictyostelium discoideum cDNA clone:ddv9k17, 5' e... 1285 0.0 1
(BJ410545) Dictyostelium discoideum cDNA clone:ddv12n24, 5' ... 1285 0.0 1
(BJ386787) Dictyostelium discoideum cDNA clone:dds10o14, 5' ... 1275 0.0 1
(BJ411886) Dictyostelium discoideum cDNA clone:ddv6o05, 5' e... 1269 0.0 1
(C23646) Dictyostelium discoideum gamete cDNA, clone FC-AC13. 1267 0.0 1
(BJ414974) Dictyostelium discoideum cDNA clone:ddv21e02, 5' ... 1265 0.0 1
(BJ324751) Dictyostelium discoideum cDNA clone:dda7f21, 5' e... 1263 0.0 1
(BJ414986) Dictyostelium discoideum cDNA clone:ddv21g03, 5' ... 1257 0.0 1
(BJ412186) Dictyostelium discoideum cDNA clone:ddv7c09, 5' e... 1257 0.0 1
(BJ388121) Dictyostelium discoideum cDNA clone:dds8c05, 5' e... 1253 0.0 1
(BJ324670) Dictyostelium discoideum cDNA clone:dda7n07, 5' e... 1247 0.0 1
(BJ411420) Dictyostelium discoideum cDNA clone:ddv4h10, 5' e... 1243 0.0 1
(BJ414412) Dictyostelium discoideum cDNA clone:ddv19g04, 5' ... 1235 0.0 2
(BJ412340) Dictyostelium discoideum cDNA clone:ddv8a05, 5' e... 1235 0.0 1
(AU265591) Dictyostelium discoideum vegetative cDNA clone:VS... 1227 0.0 1
(AU061527) Dictyostelium discoideum slug cDNA, clone SLE564. 1227 0.0 1
(BJ415607) Dictyostelium discoideum cDNA clone:ddv23i04, 5' ... 1207 0.0 1
(BJ415320) Dictyostelium discoideum cDNA clone:ddv22n03, 5' ... 1203 0.0 1
(BJ411943) Dictyostelium discoideum cDNA clone:ddv6l12, 5' e... 1203 0.0 1
(BJ410082) Dictyostelium discoideum cDNA clone:ddv11k05, 5' ... 1203 0.0 1
(BJ326441) Dictyostelium discoideum cDNA clone:dda16b16, 5' ... 1203 0.0 1
(BJ415702) Dictyostelium discoideum cDNA clone:ddv23m11, 5' ... 1199 0.0 1
(BJ414098) Dictyostelium discoideum cDNA clone:ddv18f03, 5' ... 1197 0.0 1
(AU034835) Dictyostelium discoideum slug cDNA, clone SLE564. 1195 0.0 1
(BJ413652) Dictyostelium discoideum cDNA clone:ddv16c18, 5' ... 1195 0.0 1
(BJ412339) Dictyostelium discoideum cDNA clone:ddv8a04, 5' e... 1195 0.0 1
(BJ411972) Dictyostelium discoideum cDNA clone:ddv6c15, 5' e... 1195 0.0 1
(BJ412021) Dictyostelium discoideum cDNA clone:ddv6m16, 5' e... 1193 0.0 1
(BJ410379) Dictyostelium discoideum cDNA clone:ddv12f09, 5' ... 1193 0.0 1
(BJ412921) Dictyostelium discoideum cDNA clone:ddv13l12, 5' ... 1191 0.0 1
(BJ415630) Dictyostelium discoideum cDNA clone:ddv23n06, 5' ... 1189 0.0 1
(BJ417422) Dictyostelium discoideum cDNA clone:ddv30g13, 5' ... 1179 0.0 1
(BJ415377) Dictyostelium discoideum cDNA clone:ddv22j09, 5' ... 1179 0.0 1
(BJ412096) Dictyostelium discoideum cDNA clone:ddv6o23, 5' e... 1179 0.0 1
(BJ413058) Dictyostelium discoideum cDNA clone:ddv14d06, 5' ... 1178 0.0 1
(BJ388214) Dictyostelium discoideum cDNA clone:dds8p10, 5' e... 1172 0.0 1
(BJ417414) Dictyostelium discoideum cDNA clone:ddv30e13, 5' ... 1170 0.0 1
(BJ417280) Dictyostelium discoideum cDNA clone:ddv30h01, 5' ... 1158 0.0 1
(BJ359301) Dictyostelium discoideum cDNA clone:ddc13f23, 5' ... 1140 0.0 1
(BJ387968) Dictyostelium discoideum cDNA clone:dds7n03, 5' e... 1136 0.0 1
(BJ411074) Dictyostelium discoideum cDNA clone:ddv2k23, 5' e... 1132 0.0 2
(BJ417693) Dictyostelium discoideum cDNA clone:ddv28p09, 5' ... 1128 0.0 1
(BJ414778) Dictyostelium discoideum cDNA clone:ddv20k09, 5' ... 1128 0.0 1
(BJ412422) Dictyostelium discoideum cDNA clone:ddv8l10, 5' e... 1126 0.0 1
(BJ388078) Dictyostelium discoideum cDNA clone:dds7d24, 5' e... 1122 0.0 1
(BJ417462) Dictyostelium discoideum cDNA clone:ddv30o13, 5' ... 1110 0.0 1
(BJ417286) Dictyostelium discoideum cDNA clone:ddv30i02, 5' ... 1110 0.0 1
(BJ410258) Dictyostelium discoideum cDNA clone:ddv11g23, 5' ... 1104 0.0 1
(BJ416919) Dictyostelium discoideum cDNA clone:ddv27c24, 5' ... 1090 0.0 1
(BJ413952) Dictyostelium discoideum cDNA clone:ddv17c14, 5' ... 1090 0.0 1
(BJ415055) Dictyostelium discoideum cDNA clone:ddv21d12, 5' ... 1088 0.0 1
(BJ413479) Dictyostelium discoideum cDNA clone:ddv15p14, 5' ... 1084 0.0 1
(BJ411985) Dictyostelium discoideum cDNA clone:ddv6f14, 5' e... 1082 0.0 1
(BJ415520) Dictyostelium discoideum cDNA clone:ddv22h23, 5' ... 1076 0.0 1
(BJ435643) Dictyostelium discoideum cDNA clone:ddv27c24, 3' ... 928 0.0 3
(BJ434130) Dictyostelium discoideum cDNA clone:ddv16a01, 3' ... 928 0.0 3
(BJ432568) Dictyostelium discoideum cDNA clone:ddv19g04, 3' ... 928 0.0 3
(BJ431032) Dictyostelium discoideum cDNA clone:ddv9k17, 3' e... 928 0.0 3
(BJ430807) Dictyostelium discoideum cDNA clone:ddv8j20, 3' e... 928 0.0 3
(BJ430619) Dictyostelium discoideum cDNA clone:ddv8a05, 3' e... 928 0.0 3
(BJ430618) Dictyostelium discoideum cDNA clone:ddv8a04, 3' e... 928 0.0 3
(BJ430436) Dictyostelium discoideum cDNA clone:ddv7c09, 3' e... 928 0.0 3
(BJ430274) Dictyostelium discoideum cDNA clone:ddv6m16, 3' e... 928 0.0 3
(BJ430195) Dictyostelium discoideum cDNA clone:ddv6l12, 3' e... 928 0.0 3
(BJ429783) Dictyostelium discoideum cDNA clone:ddv4j19, 3' e... 928 0.0 3
(BJ428529) Dictyostelium discoideum cDNA clone:ddv12f09, 3' ... 928 0.0 3
(BJ428491) Dictyostelium discoideum cDNA clone:ddv12k06, 3' ... 928 0.0 3
(BJ428409) Dictyostelium discoideum cDNA clone:ddv11g23, 3' ... 928 0.0 3
(BJ402678) Dictyostelium discoideum cDNA clone:dds17m16, 3' ... 928 0.0 3
(BJ399860) Dictyostelium discoideum cDNA clone:dds7d24, 3' e... 928 0.0 3
(BJ398033) Dictyostelium discoideum cDNA clone:dds10o14, 3' ... 928 0.0 3
(BJ343576) Dictyostelium discoideum cDNA clone:dda16b16, 3' ... 928 0.0 3
(BJ436086) Dictyostelium discoideum cDNA clone:ddv29k23, 3' ... 922 0.0 3
(BJ429640) Dictyostelium discoideum cDNA clone:ddv4h10, 3' e... 920 0.0 3
(BJ341612) Dictyostelium discoideum cDNA clone:dda7n07, 3' e... 920 0.0 3
(BJ432594) Dictyostelium discoideum cDNA clone:ddv19l02, 3' ... 912 0.0 3
(BJ431395) Dictyostelium discoideum cDNA clone:ddv14d06, 3' ... 904 0.0 3
(BJ431244) Dictyostelium discoideum cDNA clone:ddv13l12, 3' ... 886 0.0 4
(BJ400504) Dictyostelium discoideum cDNA clone:dds13e18, 3' ... 868 0.0 4
(BJ341705) Dictyostelium discoideum cDNA clone:dda7f21, 3' e... 868 0.0 4
(BJ399914) Dictyostelium discoideum cDNA clone:dds8c05, 3' e... 860 0.0 4
(BJ436139) Dictyostelium discoideum cDNA clone:ddv30i02, 3' ... 805 0.0 5
(AU061399) Dictyostelium discoideum slug cDNA, clone SLE106. 745 0.0 3
(BJ428707) Dictyostelium discoideum cDNA clone:ddv12n24, 3' ... 928 0.0 3
(BJ402599) Dictyostelium discoideum cDNA clone:dds17o10, 3' ... 928 0.0 3
(BJ428214) Dictyostelium discoideum cDNA clone:ddv11k05, 3' ... 928 0.0 3
(BJ410608) Dictyostelium discoideum cDNA clone:ddv1n03, 5' e... 1023 0.0 3
(BJ430704) Dictyostelium discoideum cDNA clone:ddv8l10, 3' e... 928 0.0 3
(BJ430224) Dictyostelium discoideum cDNA clone:ddv6c15, 3' e... 928 0.0 3
(BJ417832) Dictyostelium discoideum cDNA clone:ddv28p21, 5' ... 1072 0.0 1
(BJ435589) Dictyostelium discoideum cDNA clone:ddv27i13, 3' ... 928 0.0 3
(BJ433844) Dictyostelium discoideum cDNA clone:ddv23i04, 3' ... 928 0.0 3
(BJ399721) Dictyostelium discoideum cDNA clone:dds7n03, 3' e... 928 0.0 3
(BJ399850) Dictyostelium discoideum cDNA clone:dds7b19, 3' e... 928 0.0 3
(BJ414960) Dictyostelium discoideum cDNA clone:ddv21b03, 5' ... 1066 0.0 1
(BJ389084) Dictyostelium discoideum cDNA clone:dds17o10, 5' ... 1066 0.0 1
(BJ432066) Dictyostelium discoideum cDNA clone:ddv17c14, 3' ... 928 0.0 3
(AU039541) Dictyostelium discoideum slug cDNA, clone SLE720. 928 0.0 4
(BJ434875) Dictyostelium discoideum cDNA clone:ddv25a11, 3' ... 928 0.0 3
(BJ433536) Dictyostelium discoideum cDNA clone:ddv22n03, 3' ... 920 0.0 3
(BJ434000) Dictyostelium discoideum cDNA clone:ddv23h14, 3' ... 928 0.0 3
(BJ434862) Dictyostelium discoideum cDNA clone:ddv25o02, 3' ... 920 0.0 4
(BJ433868) Dictyostelium discoideum cDNA clone:ddv23n06, 3' ... 928 0.0 3
(BJ416872) Dictyostelium discoideum cDNA clone:ddv27i13, 5' ... 1037 0.0 2
(BJ417221) Dictyostelium discoideum cDNA clone:ddv29k23, 5' ... 1053 0.0 1
(BJ433599) Dictyostelium discoideum cDNA clone:ddv22j09, 3' ... 920 0.0 3
(BJ400013) Dictyostelium discoideum cDNA clone:dds8p10, 3' e... 868 0.0 4
(BJ434803) Dictyostelium discoideum cDNA clone:ddv25c04, 3' ... 920 0.0 4
(BJ428678) Dictyostelium discoideum cDNA clone:ddv12g20, 3' ... 928 0.0 3
(BJ433172) Dictyostelium discoideum cDNA clone:ddv21b03, 3' ... 854 0.0 4
(BJ433200) Dictyostelium discoideum cDNA clone:ddv21g03, 3' ... 854 0.0 4
(AU034643) Dictyostelium discoideum slug cDNA, clone SLE111. 928 0.0 3
(BJ432971) Dictyostelium discoideum cDNA clone:ddv20k09, 3' ... 850 0.0 4
(AU284283) Dictyostelium discoideum gamete cDNA clone:FC-AH1... 928 0.0 3
(AU052231) Dictyostelium discoideum slug cDNA, clone SLA282. 920 0.0 3
(BJ372714) Dictyostelium discoideum cDNA clone:ddc13f23, 3' ... 819 0.0 3
(BJ434381) Dictyostelium discoideum cDNA clone:ddv16o17, 3' ... 928 0.0 3
(BJ436134) Dictyostelium discoideum cDNA clone:ddv30h01, 3' ... 868 0.0 4
(AU033651) Dictyostelium discoideum slug cDNA, clone SLB270. 928 0.0 3
(BJ428772) Dictyostelium discoideum cDNA clone:ddv1n03, 3' e... 862 0.0 4
(BJ429267) Dictyostelium discoideum cDNA clone:ddv2k23, 3' e... 775 0.0 5
(BJ434240) Dictyostelium discoideum cDNA clone:ddv16e08, 3' ... 928 0.0 3
(BJ413708) Dictyostelium discoideum cDNA clone:ddv16o17, 5' ... 1019 0.0 1
(BJ412516) Dictyostelium discoideum cDNA clone:ddv8j20, 5' e... 1017 0.0 1
(BJ430240) Dictyostelium discoideum cDNA clone:ddv6f14, 3' e... 886 0.0 4
(BJ414435) Dictyostelium discoideum cDNA clone:ddv19l02, 5' ... 955 0.0 3
(BJ360662) Dictyostelium discoideum cDNA clone:ddc7a07, 5' e... 1011 0.0 1
(BJ416176) Dictyostelium discoideum cDNA clone:ddv25o02, 5' ... 1003 0.0 1
(BJ412839) Dictyostelium discoideum cDNA clone:ddv13e04, 5' ... 1003 0.0 1
(BJ409872) Dictyostelium discoideum cDNA clone:ddv10h12, 5' ... 1001 0.0 1
(BJ410513) Dictyostelium discoideum cDNA clone:ddv12g20, 5' ... 999 0.0 1
(BJ413491) Dictyostelium discoideum cDNA clone:ddv16a01, 5' ... 989 0.0 2
(BJ399594) Dictyostelium discoideum cDNA clone:dds6l13, 3' e... 805 0.0 5
(BJ391373) Dictyostelium discoideum cDNA clone:dds13e18, 5' ... 997 0.0 1
(BJ414812) Dictyostelium discoideum cDNA clone:ddv20b13, 5' ... 995 0.0 1
(AU039349) Dictyostelium discoideum slug cDNA, clone SLH615. 928 0.0 3
(BJ411208) Dictyostelium discoideum cDNA clone:ddv3m12, 5' e... 975 0.0 1
(BJ328351) Dictyostelium discoideum cDNA clone:dda23j19, 5' ... 940 0.0 2
(BJ409817) Dictyostelium discoideum cDNA clone:ddv10k01, 5' ... 969 0.0 1
(BJ433945) Dictyostelium discoideum cDNA clone:ddv23m11, 3' ... 928 0.0 2
(BJ432221) Dictyostelium discoideum cDNA clone:ddv18f03, 3' ... 928 0.0 2
(AU034744) Dictyostelium discoideum slug cDNA, clone SLE265. 928 0.0 2
(BJ427937) Dictyostelium discoideum cDNA clone:ddv10k01, 3' ... 928 0.0 2
(AU284390) Dictyostelium discoideum gamete cDNA clone:FC-AR0... 928 0.0 2
(AU039644) Dictyostelium discoideum slug cDNA, clone SLE891. 928 0.0 2
(AU033710) Dictyostelium discoideum slug cDNA, clone SLB345. 928 0.0 2
(AU039883) Dictyostelium discoideum slug cDNA, clone SLG662. 928 0.0 2
(AU284382) Dictyostelium discoideum gamete cDNA clone:FC-AQ1... 928 0.0 2
(AU052950) Dictyostelium discoideum slug cDNA, clone SLF370. 928 0.0 2
(AU052336) Dictyostelium discoideum slug cDNA, clone SLD161. 928 0.0 2
(BJ433187) Dictyostelium discoideum cDNA clone:ddv21e02, 3' ... 821 0.0 6
(BJ431312) Dictyostelium discoideum cDNA clone:ddv13p14, 3' ... 920 0.0 3
(AU039617) Dictyostelium discoideum slug cDNA, clone SLE847. 928 0.0 2
(AU052342) Dictyostelium discoideum slug cDNA, clone SLD170. 928 0.0 2
(BJ436289) Dictyostelium discoideum cDNA clone:ddv30o13, 3' ... 922 0.0 2
(BJ423589) Dictyostelium discoideum cDNA clone:ddv49a22, 5' ... 846 0.0 2
(AU039391) Dictyostelium discoideum slug cDNA, clone SLH694. 928 0.0 2
(BJ433756) Dictyostelium discoideum cDNA clone:ddv22h23, 3' ... 912 0.0 2
(BJ388069) Dictyostelium discoideum cDNA clone:dds7b19, 5' e... 934 0.0 1
(BJ431899) Dictyostelium discoideum cDNA clone:ddv15p24, 3' ... 910 0.0 2
(BJ431575) Dictyostelium discoideum cDNA clone:ddv14m13, 3' ... 886 0.0 3
(AU052937) Dictyostelium discoideum slug cDNA, clone SLF351. 928 0.0 1
(AU052864) Dictyostelium discoideum slug cDNA, clone SLF228. 928 0.0 1
(AU052863) Dictyostelium discoideum slug cDNA, clone SLF226. 928 0.0 1
(AU052454) Dictyostelium discoideum slug cDNA, clone SLD345. 928 0.0 1
(AU053553) Dictyostelium discoideum slug cDNA, clone SLI895. 924 0.0 1
(BJ417888) Dictyostelium discoideum cDNA clone:ddv15o21, 5' ... 922 0.0 1
(BJ344996) Dictyostelium discoideum cDNA clone:dda21c07, 3' ... 842 0.0 4
(BJ435273) Dictyostelium discoideum cDNA clone:ddv26j14, 3' ... 910 0.0 2
(AU053375) Dictyostelium discoideum slug cDNA, clone SLI495. 920 0.0 1
(AU052415) Dictyostelium discoideum slug cDNA, clone SLD278. 920 0.0 1
(AU034269) Dictyostelium discoideum slug cDNA, clone SLC425. 920 0.0 1
(BJ436252) Dictyostelium discoideum cDNA clone:ddv30g13, 3' ... 862 0.0 4
(AU052775) Dictyostelium discoideum slug cDNA, clone SLK647. 759 0.0 4
(BJ428116) Dictyostelium discoideum cDNA clone:ddv10f19, 3' ... 868 0.0 3
(AU034376) Dictyostelium discoideum slug cDNA, clone SLC774. 904 0.0 1
(BJ345494) Dictyostelium discoideum cDNA clone:dda23j19, 3' ... 854 0.0 3
(BJ409988) Dictyostelium discoideum cDNA clone:ddv10f19, 5' ... 892 0.0 1
(AU265592) Dictyostelium discoideum vegetative cDNA clone:VS... 868 0.0 2
(AU052838) Dictyostelium discoideum slug cDNA, clone SLF190. 658 0.0 2
(BJ433006) Dictyostelium discoideum cDNA clone:ddv20b13, 3' ... 848 0.0 3
(BJ429422) Dictyostelium discoideum cDNA clone:ddv3m12, 3' e... 848 0.0 3
(AU034594) Dictyostelium discoideum slug cDNA, clone SLC586. 880 0.0 1
(BJ327244) Dictyostelium discoideum cDNA clone:dda19a22, 5' ... 872 0.0 1
(AU034526) Dictyostelium discoideum slug cDNA, clone SLC391. 850 0.0 1
(BJ327648) Dictyostelium discoideum cDNA clone:dda21c07, 5' ... 848 0.0 1
(AU040053) Dictyostelium discoideum slug cDNA, clone SLA327. 450 0.0 2
(AU039766) Dictyostelium discoideum slug cDNA, clone SLG368. 841 0.0 1
(BJ433266) Dictyostelium discoideum cDNA clone:ddv21d12, 3' ... 841 0.0 1
(AU266868) Dictyostelium discoideum vegetative cDNA clone:VS... 817 0.0 1
(AU266246) Dictyostelium discoideum vegetative cDNA clone:VS... 739 0.0 4
(BJ434318) Dictyostelium discoideum cDNA clone:ddv16c18, 3' ... 809 0.0 1
(BJ413585) Dictyostelium discoideum cDNA clone:ddv16e08, 5' ... 797 0.0 2
(BJ431825) Dictyostelium discoideum cDNA clone:ddv15p14, 3' ... 595 0.0 3
(AU266247) Dictyostelium discoideum vegetative cDNA clone:VS... 793 0.0 1
(C25509) Dictyostelium discoideum slug cDNA, clone SLA292. 745 0.0 1
(AU284339) Dictyostelium discoideum gamete cDNA clone:FC-AN0... 743 0.0 1
(BJ389147) Dictyostelium discoideum cDNA clone:dds17m16, 5' ... 733 0.0 1
(BJ388657) Dictyostelium discoideum cDNA clone:dds6l13, 5' e... 549 0.0 3
(AU039829) Dictyostelium discoideum slug cDNA, clone SLG530. 690 0.0 1
(BJ431892) Dictyostelium discoideum cDNA clone:ddv15o21, 3' ... 478 0.0 2
(AU039806) Dictyostelium discoideum slug cDNA, clone SLG464. 666 0.0 1
(AU052881) Dictyostelium discoideum slug cDNA, clone SLF261. 617 e-172 1
(AU052120) Dictyostelium discoideum slug cDNA, clone SLA536. 587 e-165 2
(AU060596) Dictyostelium discoideum slug cDNA, clone SLK573. 583 e-162 1
(BJ432161) Dictyostelium discoideum cDNA clone:ddv17i22, 3' ... 315 e-156 3
(AU061386) Dictyostelium discoideum slug cDNA, clone SLD879. 549 e-152 1
(AU053883) Dictyostelium discoideum slug cDNA, clone SLJ864. 519 e-143 1
(AU033380) Dictyostelium discoideum slug cDNA, clone SLA701. 511 e-140 1
(AU284303) Dictyostelium discoideum gamete cDNA clone:FC-AJ2... 464 e-138 3
(BJ411550) Dictyostelium discoideum cDNA clone:ddv4j19, 5' e... 474 e-129 1
(AU053795) Dictyostelium discoideum slug cDNA, clone SLJ701. 452 e-122 1
(AU053668) Dictyostelium discoideum slug cDNA, clone SLJ366. 448 e-121 1
(AU039419) Dictyostelium discoideum slug cDNA, clone SLH750. 408 e-109 1
(AU053773) Dictyostelium discoideum slug cDNA, clone SLJ660. 367 7e-97 1
(BJ389661) Dictyostelium discoideum cDNA clone:dds19i13, 5' ... 349 2e-91 1
(AU053972) Dictyostelium discoideum slug cDNA, clone SLK324. 345 3e-90 1
(AU060521) Dictyostelium discoideum slug cDNA, clone SLK268. 194 7e-89 2
(BJ435991) Dictyostelium discoideum cDNA clone:ddv29f09, 3' ... 335 3e-87 1
(AU053749) Dictyostelium discoideum slug cDNA, clone SLJ608. 309 1e-79 1
(AU270745) Dictyostelium discoideum vegetative cDNA clone:VS... 307 6e-79 1
(AU270744) Dictyostelium discoideum vegetative cDNA clone:VS... 307 6e-79 1
(BJ416188) Dictyostelium discoideum cDNA clone:ddv25a11, 5' ... 291 3e-74 1
(BJ417895) Dictyostelium discoideum cDNA clone:ddv15p24, 5' ... 264 8e-66 1
(BJ415745) Dictyostelium discoideum cDNA clone:ddv23h14, 5' ... 258 5e-64 1
(BJ398653) Dictyostelium discoideum cDNA clone:dds1n09, 3' e... 123 9e-64 3
(BJ417066) Dictyostelium discoideum cDNA clone:ddv29f09, 5' ... 232 3e-56 1
(AU061288) Dictyostelium discoideum slug cDNA, clone SLD680. 190 8e-54 2
(BJ430136) Dictyostelium discoideum cDNA clone:ddv6o05, 3' e... 218 4e-52 1
(BJ416119) Dictyostelium discoideum cDNA clone:ddv25c04, 5' ... 172 2e-38 1
(AU054086) Dictyostelium discoideum slug cDNA, clone SLK573. 147 1e-30 1
(AU052647) Dictyostelium discoideum slug cDNA, clone SLD680. 137 1e-27 1
(FF350197) BG02022A1D01.r1 BG02 - primary and normalized lib... 60 2e-06 2
(AM780580) Nicotiana tabacum EST, clone nt002185071. 42 6e-05 2
(FF350196) BG02022A1D01.f1 BG02 - primary and normalized lib... 60 2e-04 1
(BH133887) ENTPB89TR Entamoeba histolytica Sheared DNA Entam... 46 0.001 2
(AY389902) Protopterus dolloi eukaryotic translation elongat... 52 0.007 2
(CN140432) OX1_36_D07.b1_A002 Oxidatively-stressed leaves an... 42 0.019 2
(DQ680311) Aphonopelma reversum MY63 elongation factor-1 gam... 52 0.024 2
(DN803810) G.hir-8-10 DAA bolls drought stressed686 8-10 DAA... 40 0.047 2
(DY895504) CeleSEQ15350 Cunninghamella elegans pBluescript (... 36 0.051 3
(DT544617) EST1055257 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.053 2
(EV499290) sg161E03 Cotton Lambda Zap Express Library Gossyp... 40 0.054 2
(DT567792) EST1078432 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.055 2
(AM765636) Sycon raphanus EST, 5' end sequence, clone IL0ADA... 52 0.055 1
(CJ459462) Macaca fascicularis mRNA, clone: QmoA-11679, 5' e... 52 0.055 1
(CJ432280) Macaca fascicularis mRNA, clone: QbsB-10769, 5' e... 52 0.055 1
(CJ431232) Macaca fascicularis mRNA, clone: QbsA-11567, 5' e... 52 0.055 1
(BQ408819) GA__Ed0012B02r Gossypium arboreum 7-10 dpa fiber ... 40 0.057 2
(ES809248) UFL_163_38 Cotton fiber 0-10 day post anthesis Go... 40 0.058 2
(DY888305) CeleSEQ5153 Cunninghamella elegans pBluescript (E... 36 0.066 3
(DT570573) EST1081213 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.068 2
(DT568466) EST1079106 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.069 2
(BM359385) GA__Ea0019F11r Gossypium arboreum 7-10 dpa fiber ... 40 0.072 2
(DT468768) GH_CHX22G17.r GH_CHX Gossypium hirsutum cDNA clon... 40 0.072 2
(DT465252) GH_CHX17A17.f GH_CHX Gossypium hirsutum cDNA clon... 40 0.072 2
(BF271879) GA__Eb0013A09f Gossypium arboreum 7-10 dpa fiber ... 40 0.074 2
(DT545310) EST1055950 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.075 2
(DT550745) EST1061385 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.077 2
(BG444769) GA__Ea0025I10f Gossypium arboreum 7-10 dpa fiber ... 40 0.077 2
(DT548004) EST1058644 GH_TMO Gossypium hirsutum cDNA, mRNA s... 40 0.078 2
(ES806612) UFL_639_16 Cotton fiber 0-10 day post anthesis Go... 40 0.080 2
(BG440506) GA__Ea0008H23f Gossypium arboreum 7-10 dpa fiber ... 40 0.082 2
(ES808026) UFL_214_54 Cotton fiber 0-10 day post anthesis Go... 40 0.12 2
(ES834028) UFL_424_94 Cotton fiber 0-10 day post anthesis Go... 40 0.12 2
(AR550645) Sequence 5776 from patent US 6747137. 38 0.15 4
(FF074906) G1045P311FH8.T0 Aplysia californica Pooled Normal... 40 0.16 2
(EB270556) MCC013-F-017322-501 Non-Normalized MCC Processes ... 40 0.17 2
(BD101245) Novel genes cloned in humanneuroblastoma and frag... 50 0.22 1
(BD021307) Novel gene and novel gene fragment cloned in huma... 50 0.22 1
(ES712473) TFR6_3_B10_E001.g1 USDA-Tifton Peanut Library TFR... 46 0.59 2
(DN803801) G.hir-8-10 DAA bolls drought stressed677 8-10 DAA... 36 0.71 2
(CO108921) GR__Eb0040P22.r GR__Eb Gossypium raimondii cDNA c... 36 0.81 2
(BQ403971) GA__Ed0064D09f Gossypium arboreum 7-10 dpa fiber ... 36 0.81 2
(EV491583) 213D02 Cotton Lambda Zap Express Library Gossypiu... 36 0.81 2
(CO106881) GR__Eb0037L23.r GR__Eb Gossypium raimondii cDNA c... 36 0.82 2
(CO105946) GR__Eb0036G01.r GR__Eb Gossypium raimondii cDNA c... 36 0.83 2
(ES793143) UFL_555_40 Cotton fiber 0-10 day post anthesis Go... 36 0.84 2
(ED819064) MUGQ_CH252P147I23T7_CN160_088 CHORI-252 Vervet Mo... 48 0.86 1
(EB011527) LedoSEQ13890 Lentinula edodes pBluescript (EcoRI-... 48 0.86 1
(AM764409) Sycon raphanus EST, 5' end sequence, clone IL0ADA... 48 0.86 1
(BJ999006) Lentinula edodes cDNA, clone:LeEST0910, 3'-end se... 48 0.86 1
(DT557383) EST1068023 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 0.92 2
(ES852348) UFL_685_36 Cotton fiber 0-10 day post anthesis Go... 36 0.93 2
(DT571112) EST1081752 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 0.94 2
(DT548925) EST1059565 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 0.96 2
(DN465859) USDA-FP_139839 Diaphorina citri Kuwayama (Hemipte... 38 0.96 2
(DT551472) EST1062112 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 0.96 2
(EH680427) CCIL5300.b1_H06.ab1 CCI(LMS) chicory Cichorium in... 46 0.96 2
(DT568475) EST1079115 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 0.97 2
(DT567280) EST1077920 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 0.98 2
(ES849104) UFL_656_32 Cotton fiber 0-10 day post anthesis Go... 36 0.98 2
(EE124436) 1F12 Peanut (Luhua14) seeds full length cDNA Libr... 46 0.98 2
(CO107821) GR__Eb0039D24.r GR__Eb Gossypium raimondii cDNA c... 36 0.99 2
(CO091167) GR__Ea11I08.f GR__Ea Gossypium raimondii cDNA clo... 36 0.99 2
(CJ448263) Macaca fascicularis mRNA, clone: QflA-13630, 5' e... 38 1.0 2
(CO097789) GR__Ea21N02.r GR__Ea Gossypium raimondii cDNA clo... 36 1.0 2
(CO087935) GR__Ea06K04.f GR__Ea Gossypium raimondii cDNA clo... 36 1.0 2
(CJ473794) Macaca fascicularis mRNA, clone: QorA-13836, 5' e... 44 1.0 2
(CJ449112) Macaca fascicularis mRNA, clone: QflA-14615, 5' e... 38 1.0 2
(CO125496) GR__Eb09A09.f GR__Eb Gossypium raimondii cDNA clo... 36 1.0 2
(CO118196) GR__Eb020G20.r GR__Eb Gossypium raimondii cDNA cl... 36 1.0 2
(CO082539) GR__Ea47D09.r GR__Ea Gossypium raimondii cDNA clo... 36 1.0 2
(CO086803) GR__Ea04P15.f GR__Ea Gossypium raimondii cDNA clo... 36 1.0 2
(DT462473) GH_CHX12C07.r GH_CHX Gossypium hirsutum cDNA clon... 36 1.0 2
(DT562887) EST1073527 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 1.0 2
(DT550445) EST1061085 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 1.1 2
(CO081821) GR__Ea46C05.r GR__Ea Gossypium raimondii cDNA clo... 36 1.1 2
(CO114564) GR__Eb015M12.r GR__Eb Gossypium raimondii cDNA cl... 36 1.1 2
(DT548768) EST1059408 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 1.1 2
(DT564069) EST1074709 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 1.1 2
(DT572374) EST1083014 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 1.2 2
(ES814122) UFL_199_01 Cotton fiber 0-10 day post anthesis Go... 36 1.2 2
(ES824911) UFL_347_76 Cotton fiber 0-10 day post anthesis Go... 36 1.2 2
(ES799430) UFL_604_59 Cotton fiber 0-10 day post anthesis Go... 36 1.4 2
(ES805795) UFL_621_87 Cotton fiber 0-10 day post anthesis Go... 36 1.4 2
(ES818686) UFL_281_30 Cotton fiber 0-10 day post anthesis Go... 36 1.6 2
(DT550012) EST1060652 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 2.0 2
(DT545186) EST1055826 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 2.1 2
(CJ487327) Macaca fascicularis mRNA, clone: QtsA-14988, 5' e... 34 2.2 3
(BT043961) Salmo salar clone HM5_0791 eukaryotic translation... 44 2.2 2
(FF073990) G1045P339RE4.T0 Aplysia californica Pooled Normal... 36 2.3 2
(EV491985) 222D05 Cotton Lambda Zap Express Library Gossypiu... 36 2.4 2
(DT575078) EST1085718 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 2.5 2
(BJ387305) Dictyostelium discoideum cDNA clone:dds1b15, 5' e... 36 2.7 2
(FC261227) CAGN13354.fwd CAGN Nematostella vectensis Nemve m... 40 2.7 2
(BJ363456) Dictyostelium discoideum cDNA clone:ddc26b19, 5' ... 36 2.8 2
(BT045430) Salmo salar clone ssal-rgf-521-130 Elongation fac... 44 2.8 2
(DT548043) EST1058683 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 2.8 2
(AI730912) BNLGHi8180 Six-day Cotton fiber Gossypium hirsutu... 36 2.9 2
(FC235412) CAGH10586.fwd CAGH Nematostella vectensis Nemve L... 40 3.1 2
(DT549967) EST1060607 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.1 2
(DT574465) EST1085105 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.1 2
(DV080957) 248-2_H19.abi Nematostella vectensis non-normaliz... 40 3.2 2
(FC241923) CAGH1689.fwd CAGH Nematostella vectensis Nemve La... 40 3.2 2
(FC240412) CAGH13308.fwd CAGH Nematostella vectensis Nemve L... 40 3.2 2
(DV080956) 248-2_N02.abi Nematostella vectensis non-normaliz... 40 3.2 2
(DT463213) GH_CHX13D20.f GH_CHX Gossypium hirsutum cDNA clon... 36 3.2 2
(DT572904) EST1083544 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.2 2
(FE853280) CAFP2683.rev CAFP Pichia stipitis aerobic xylose ... 44 3.3 2
(FC264180) CAGN15208.fwd CAGN Nematostella vectensis Nemve m... 40 3.3 2
(FC234896) CAGH10282.fwd CAGH Nematostella vectensis Nemve L... 40 3.3 2
(AC140385) Mus musculus BAC clone RP23-173G20 from chromosom... 46 3.4 1
(AC206452) Pongo abelii BAC clone CH276-181G3 from chromosom... 46 3.4 1
(AY657022) Mus musculus chromosome 6 clone GA_x54KRFPKN04:95... 46 3.4 1
(FI115479) MUGQ_CH252P486N02Sp6_CH0181_003 CHORI-252 Vervet ... 46 3.4 1
(EI515610) MUGQ_CH252P235N22Sp6_CN410_083 CHORI-252 Vervet M... 46 3.4 1
(EI514022) MUGQ_CH252P233B04T7_CN406_016 CHORI-252 Vervet Mo... 46 3.4 1
(EI202725) MUGQ_CH252P194H11T7_CN296_042 CHORI-252 Vervet Mo... 46 3.4 1
(CR233762) Reverse strand read from insert in 5'HPRT inserti... 46 3.4 1
(CR015728) Reverse strand read from insert in 5'HPRT inserti... 46 3.4 1
(DR109062) USDA-FP_166325 5th-instar Anoplophora glabripenni... 46 3.4 1
(DC241121) Petunia x hybrida cDNA, clone: PET04SEQ03911B. 46 3.4 1
(CJ481008) Macaca fascicularis mRNA, clone: QtrA-16595, 5' e... 46 3.4 1
(CJ480598) Macaca fascicularis mRNA, clone: QtrA-16120, 5' e... 46 3.4 1
(CJ466645) Macaca fascicularis mRNA, clone: QnpA-16039, 5' e... 46 3.4 1
(CJ448935) Macaca fascicularis mRNA, clone: QflA-14330, 5' e... 46 3.4 1
(CJ446491) Macaca fascicularis mRNA, clone: QflA-11781, 5' e... 46 3.4 1
(CJ446123) Macaca fascicularis mRNA, clone: QflA-11295, 5' e... 46 3.4 1
(AJ898721) Trichoderma atroviride EST, clone L07T11P011R01052. 46 3.4 1
(BP922332) Populus nigra mRNA, clone: PnFL1-006_J12.f, 5'end... 46 3.4 1
(FC286984) CAGN3667.fwd CAGN Nematostella vectensis Nemve mi... 40 3.4 2
(FE850800) CAFP1375.rev CAFP Pichia stipitis aerobic xylose ... 44 3.4 2
(FE853210) CAFP2645.rev CAFP Pichia stipitis aerobic xylose ... 44 3.5 2
(DT564506) EST1075146 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.5 2
(FC287043) CAGN3700.fwd CAGN Nematostella vectensis Nemve mi... 40 3.5 2
(FC257803) CAGN11178.fwd CAGN Nematostella vectensis Nemve m... 40 3.5 2
(FE856739) CAFU791.rev CAFU Pichia stipitis oxygen limited d... 44 3.5 2
(DT567522) EST1078162 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.5 2
(FE849728) CAFO658.rev CAFO Pichia stipitis aerobic xylose M... 44 3.5 2
(FC245145) CAGH3548.fwd CAGH Nematostella vectensis Nemve La... 40 3.5 2
(FE846223) CAFI620.rev CAFI Pichia stipitis aerobic dextrose... 44 3.5 2
(FC280112) CAGN24087.fwd CAGN Nematostella vectensis Nemve m... 40 3.5 2
(FC269081) CAGN18069.fwd CAGN Nematostella vectensis Nemve m... 40 3.5 2
(FE846046) CAFI523.rev CAFI Pichia stipitis aerobic dextrose... 44 3.5 2
(FC255683) CAGN10062.fwd CAGN Nematostella vectensis Nemve m... 40 3.5 2
(FE851150) CAFP1564.rev CAFP Pichia stipitis aerobic xylose ... 44 3.6 2
(FC286556) CAGN3429.fwd CAGN Nematostella vectensis Nemve mi... 40 3.6 2
(DT556830) EST1067470 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.6 2
(FE859230) CAFX772.fwd CAFX Pichia stipitis oxygen limited x... 44 3.6 2
(FC289029) CAGN4780.fwd CAGN Nematostella vectensis Nemve mi... 40 3.6 2
(DT551652) EST1062292 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.6 2
(DT544970) EST1055610 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.6 2
(DT558457) EST1069097 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.6 2
(FE852436) CAFP2245.rev CAFP Pichia stipitis aerobic xylose ... 44 3.7 2
(FC275186) CAGN2145.fwd CAGN Nematostella vectensis Nemve mi... 40 3.7 2
(FE860538) CAFY685.rev CAFY Pichia stipitis oxygen limited x... 44 3.7 2
(FE846047) CAFI523.fwd CAFI Pichia stipitis aerobic dextrose... 44 3.7 2
(FE855811) CAFU1067.rev CAFU Pichia stipitis oxygen limited ... 44 3.7 2
(FE859229) CAFX772.rev CAFX Pichia stipitis oxygen limited x... 44 3.7 2
(FE845511) CAFI1004.rev CAFI Pichia stipitis aerobic dextros... 44 3.7 2
(CJ451945) Macaca fascicularis mRNA, clone: QflA-17577, 5' e... 44 3.7 2
(FE845941) CAFI467.rev CAFI Pichia stipitis aerobic dextrose... 44 3.7 2
(FE851411) CAFP1701.rev CAFP Pichia stipitis aerobic xylose ... 44 3.8 2
(FE846903) CAFI979.rev CAFI Pichia stipitis aerobic dextrose... 44 3.8 2
(FC294200) CAGN7503.fwd CAGN Nematostella vectensis Nemve mi... 40 3.8 2
(FC283438) CAGN25889.fwd CAGN Nematostella vectensis Nemve m... 40 3.8 2
(DT572005) EST1082645 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.8 2
(FC291142) CAGN5895.fwd CAGN Nematostella vectensis Nemve mi... 40 3.8 2
(FC260558) CAGN12989.fwd CAGN Nematostella vectensis Nemve m... 40 3.8 2
(FC256521) CAGN10506.fwd CAGN Nematostella vectensis Nemve m... 40 3.8 2
(FC260564) CAGN12991.fwd CAGN Nematostella vectensis Nemve m... 40 3.9 2
(FC268797) CAGN17902.fwd CAGN Nematostella vectensis Nemve m... 40 3.9 2
(FC246658) CAGH4376.fwd CAGH Nematostella vectensis Nemve La... 40 3.9 2
(FC256333) CAGN10405.fwd CAGN Nematostella vectensis Nemve m... 40 3.9 2
(DT565419) EST1076059 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.9 2
(FC266847) CAGN16759.fwd CAGN Nematostella vectensis Nemve m... 40 3.9 2
(DT553975) EST1064615 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.9 2
(DT543707) EST1054347 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 3.9 2
(FC276274) CAGN22039.fwd CAGN Nematostella vectensis Nemve m... 40 3.9 2
(FC279129) CAGN2356.fwd CAGN Nematostella vectensis Nemve mi... 40 3.9 2
(FC266194) CAGN16382.fwd CAGN Nematostella vectensis Nemve m... 40 3.9 2
(FC294761) CAGN7805.fwd CAGN Nematostella vectensis Nemve mi... 40 3.9 2
(FC275959) CAGN2187.fwd CAGN Nematostella vectensis Nemve mi... 40 3.9 2
(DV080955) 248-2_L22.abi Nematostella vectensis non-normaliz... 40 4.0 2
(DT550013) EST1060653 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 4.1 2
(DT566890) EST1077530 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 4.2 2
(DT574532) EST1085172 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 4.2 2
(EX170710) G11_F11_086 Cotton 1-14 day post anthesis Lambda ... 36 4.4 2
(DT544219) EST1054859 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 4.5 2
(BJ326157) Dictyostelium discoideum cDNA clone:dda15b14, 5' ... 34 7.0 2
(CJ462497) Macaca fascicularis mRNA, clone: QnpA-10007, 5' e... 34 7.2 3
(AC106931) Rattus norvegicus clone CH230-71H11, WORKING DRAF... 42 7.4 3
(DK287760) Drosophila auraria mRNA, adult full-length cDNA c... 42 8.1 2
(DK284871) Drosophila auraria mRNA, adult full-length cDNA c... 42 8.7 2
(DK293058) Drosophila auraria mRNA, adult full-length cDNA c... 42 8.9 2
(EV523728) JB2_43_H05 Castor seed endosperm Ricinus communis... 34 9.1 3
(DK286225) Drosophila auraria mRNA, adult full-length cDNA c... 42 9.7 2
(CI006511) Oryza sativa Japonica Group cDNA, clone: 005-M006... 36 10.0 2

>(BJ410338) Dictyostelium discoideum cDNA clone:ddv12k06, 5' end,
single read.
Length = 673

Score = 1330 bits (671), Expect = 0.0
Identities = 671/671 (100%)
Strand = Plus / Plus


Query: 18 gttgaaattttcacatcaaaacaaaatggtcatgaaattatacacctacccacaaaacag 77
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 gttgaaattttcacatcaaaacaaaatggtcatgaaattatacacctacccacaaaacag 60


Query: 78 ccgtgctttcaaaagtttaattgctgctaaatacgtcaatgttgatattgaagtaccagc 137
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ccgtgctttcaaaagtttaattgctgctaaatacgtcaatgttgatattgaagtaccagc 120


Query: 138 tttcaactttgaaactgatcgtttaactgaagagttcaaaaccaacttcccattaggtaa 197
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tttcaactttgaaactgatcgtttaactgaagagttcaaaaccaacttcccattaggtaa 180


Query: 198 agttccagctttattaactgaacaaggtccactctttgaatcaaacaccatggctcgtta 257
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 agttccagctttattaactgaacaaggtccactctttgaatcaaacaccatggctcgtta 240


Query: 258 tgttgctcgtttaaataacagcaccatctatggttcagatgcatacactgccgccctcaa 317
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 tgttgctcgtttaaataacagcaccatctatggttcagatgcatacactgccgccctcaa 300


Query: 318 tgaccaatggattgattatgcagccaacgaaatcgacccaaatgccattccatggttata 377
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tgaccaatggattgattatgcagccaacgaaatcgacccaaatgccattccatggttata 360


Query: 378 tgccatcctcggttattacgattacaatgctaaagacagcaacaaagccaaagaaaacat 437
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tgccatcctcggttattacgattacaatgctaaagacagcaacaaagccaaagaaaacat 420


Query: 438 gaaaaaagtcttagctttcctcgatgcccaactcctcaacaagccattccttactggttt 497
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 gaaaaaagtcttagctttcctcgatgcccaactcctcaacaagccattccttactggttt 480


Query: 498 ccgtgtcgctcttgccgatatcatcgttgtttgttcattattcaacttttacaaaatggt 557
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 ccgtgtcgctcttgccgatatcatcgttgtttgttcattattcaacttttacaaaatggt 540


Query: 558 ctttgaaccaactttccgttccccatacgttaacgtcaacagatggttcaccacctgtat 617
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 ctttgaaccaactttccgttccccatacgttaacgtcaacagatggttcaccacctgtat 600


Query: 618 caaccaaccaaacttcaaagctgtcattggtgaatttgctctctgtgaaaagatgatggt 677
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 caaccaaccaaacttcaaagctgtcattggtgaatttgctctctgtgaaaagatgatggt 660


Query: 678 ctacgttgctc 688
|||||||||||
Sbjct: 661 ctacgttgctc 671

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,242,111,829
Number of extensions: 68086291
Number of successful extensions: 5282381
Number of sequences better than 10.0: 437
Length of query: 1334
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1310
Effective length of database: 96,409,374,237
Effective search space: 126296280250470
Effective search space used: 126296280250470
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 8. 2
Homology vs Protein
Query= Contig-U16276-1 (Contig-U16276-1Q) /CSM_Contig/Contig-U16276-1Q.Seq.d
(1334 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(Q6PE25) RecName: Full=Elongation factor 1-gamma; Short... 318 4e-85
(Q90YC0) RecName: Full=Elongation factor 1-gamma; Short... 315 2e-84
AY099512_1(AY099512|pid:none) Danio rerio eukaryotic translation... 312 2e-83
(P29694) RecName: Full=Elongation factor 1-gamma; Short... 311 4e-83
(A2Q127) RecName: Full=Elongation factor 1-gamma; Short... 309 1e-82
AK300203_1(AK300203|pid:none) Homo sapiens cDNA FLJ56389 complet... 307 5e-82
(P26641) RecName: Full=Elongation factor 1-gamma; Short... 307 5e-82
BC007949_1(BC007949|pid:none) Homo sapiens eukaryotic translatio... 307 5e-82
(P26642) RecName: Full=Elongation factor 1-gamma-A; Sho... 306 1e-81
BC080966_1(BC080966|pid:none) Xenopus tropicalis hypothetical pr... 306 1e-81
I51237(I51237) translation elongation factor EF-1 gamma - Africa... 306 1e-81
BC013918_1(BC013918|pid:none) Homo sapiens eukaryotic translatio... 306 1e-81
BT056809_1(BT056809|pid:none) Salmo salar clone ssal-eve-528-150... 305 3e-81
BC054190_1(BC054190|pid:none) Xenopus laevis elongation factor 1... 304 5e-81
(Q9D8N0) RecName: Full=Elongation factor 1-gamma; Short... 304 5e-81
(P12261) RecName: Full=Elongation factor 1-gamma; Short... 303 7e-81
AB246880_1(AB246880|pid:none) Lethenteron japonicum EEF1G mRNA f... 303 7e-81
BT057310_1(BT057310|pid:none) Salmo salar clone ssal-evf-562-222... 303 9e-81
(Q3SZV3) RecName: Full=Elongation factor 1-gamma; Short... 302 2e-80
BT045430_1(BT045430|pid:none) Salmo salar clone ssal-rgf-521-130... 302 2e-80
BC134217_1(BC134217|pid:none) Danio rerio zgc:163074, mRNA (cDNA... 302 2e-80
FJ384983_1(FJ384983|pid:none) Bombina orientalis translation elo... 301 3e-80
DQ680344_1(DQ680344|pid:none) Argiope argentata elongation facto... 301 3e-80
AY077628_1(AY077628|pid:none) Locusta migratoria translation elo... 298 3e-79
AF321126_1(AF321126|pid:none) Mus musculus elongation factor-lik... 298 4e-79
BC170045_1(BC170045|pid:none) Xenopus laevis elongation factor 1... 298 4e-79
BC084224_1(BC084224|pid:none) Xenopus laevis cDNA clone MGC:8088... 298 4e-79
(Q91375) RecName: Full=Elongation factor 1-gamma-B; Sho... 296 9e-79
DQ680343_1(DQ680343|pid:none) Diguetia canites elongation factor... 294 6e-78
EF070468_1(EF070468|pid:none) Maconellicoccus hirsutus clone WHM... 293 1e-77
DQ680342_1(DQ680342|pid:none) Hypochilus thorelli elongation fac... 292 2e-77
AY737542_1(AY737542|pid:none) Toxoptera citricida putative trans... 287 7e-76
BT080927_1(BT080927|pid:none) Caligus clemensi clone ccle-evs-51... 286 2e-75
DQ680341_1(DQ680341|pid:none) Uloborus diversus elongation facto... 285 3e-75
EU937995_1(EU937995|pid:none) Phytophthora sojae calcium-depende... 283 8e-75
DQ440238_1(DQ440238|pid:none) Aedes aegypti clone AET-2855 elong... 282 2e-74
BC154938_1(BC154938|pid:none) Xenopus tropicalis hypothetical pr... 281 3e-74
(Q9NJH0) RecName: Full=Elongation factor 1-gamma; Short... 278 4e-73
BT001612_1(BT001612|pid:none) Drosophila melanogaster RE32823 fu... 278 4e-73
AY393847_1(AY393847|pid:none) Gallus gallus eukaryotic translati... 277 5e-73
AF148814_1(AF148814|pid:none) Drosophila melanogaster translatio... 276 2e-72
AJ973179_1(AJ973179|pid:none) Strongylocentrotus purpuratus mRNA... 273 8e-72
DQ680306_1(DQ680306|pid:none) Aliatypus plutonis elongation fact... 272 2e-71
AY130445_1(AY130445|pid:none) Branchiostoma lanceolatum eukaryot... 266 1e-69
EU964027_1(EU964027|pid:none) Zea mays clone 275329 elongation f... 265 2e-69
EF146598_1(EF146598|pid:none) Populus trichocarpa clone WS01210_... 262 2e-68
FJ866630_1(FJ866630|pid:none) Citrus maxima translation elongati... 259 2e-67
EU969941_1(EU969941|pid:none) Zea mays clone 337631 elongation f... 258 4e-67
EF085935_1(EF085935|pid:none) Picea sitchensis clone WS0274_F08 ... 257 6e-67
EU960932_1(EU960932|pid:none) Zea mays clone 229655 elongation f... 257 8e-67
DQ680347_1(DQ680347|pid:none) Latrodectus hesperus elongation fa... 255 2e-66
AY389901_1(AY389901|pid:none) Latimeria chalumnae eukaryotic tra... 255 3e-66
AP005797_8(AP005797|pid:none) Oryza sativa Japonica Group genomi... 253 8e-66
(Q9ZRI7) RecName: Full=Elongation factor 1-gamma 1; Sho... 253 8e-66
BC021974_1(BC021974|pid:none) Homo sapiens eukaryotic translatio... 250 7e-65
(Q6YW46) RecName: Full=Elongation factor 1-gamma 2; Sho... 250 9e-65
AY224455_1(AY224455|pid:none) Oryza sativa (japonica cultivar-gr... 248 3e-64
DQ680348_1(DQ680348|pid:none) Zorocrates fuscus elongation facto... 248 4e-64
AC140549_7(AC140549|pid:none) Medicago truncatula clone mth2-28o... 248 5e-64
(Q9FVT2) RecName: Full=Probable elongation factor 1-gamma 2; ... 247 8e-64
AY035082_1(AY035082|pid:none) Arabidopsis thaliana putative elon... 247 8e-64
DQ241837_1(DQ241837|pid:none) Solanum tuberosum clone 180F09 put... 246 1e-63
EU580435_1(EU580435|pid:none) Nicotiana tabacum elongation facto... 246 1e-63
DQ680315_1(DQ680315|pid:none) Hadronyche sp. MY885 elongation fa... 245 2e-63
DQ680309_1(DQ680309|pid:none) Nemesiidae sp. NAA-2006 elongation... 244 7e-63
AF475939_1(AF475939|pid:none) Glycine max elongation factor 1-ga... 241 3e-62
BT052504_1(BT052504|pid:none) Medicago truncatula clone MTYFD_FE... 241 4e-62
DQ207868_1(DQ207868|pid:none) Solanum tuberosum clone 085G10 unk... 240 1e-61
DQ680320_1(DQ680320|pid:none) Stanwellia hoggi MY912 elongation ... 236 1e-60
DQ680350_1(DQ680350|pid:none) Dolomedes tenebrosus elongation fa... 236 2e-60
DQ680312_1(DQ680312|pid:none) Bymainiella terraereginae MY883 el... 236 2e-60
DQ680345_1(DQ680345|pid:none) Kukulcania hibernalis elongation f... 235 2e-60
DQ680311_1(DQ680311|pid:none) Aphonopelma reversum MY63 elongati... 232 2e-59
BC064264_1(BC064264|pid:none) Xenopus tropicalis hypothetical pr... 231 5e-59
AF148813_1(AF148813|pid:none) Drosophila melanogaster translatio... 230 1e-58
DQ680323_1(DQ680323|pid:none) Atypus snetsingeri MY2283 elongati... 229 1e-58
AF119850_1(AF119850|pid:none) Homo sapiens PRO1608 mRNA, complet... 227 7e-58
BC023495_1(BC023495|pid:none) Mus musculus eukaryotic translatio... 224 7e-57
FN322814_1(FN322814|pid:none) Schistosoma japonicum isolate Anhu... 219 2e-55
FN316206_1(FN316206|pid:none) Schistosoma japonicum isolate Anhu... 218 3e-55
FN316201_1(FN316201|pid:none) Schistosoma japonicum isolate Anhu... 218 3e-55
FN316204_1(FN316204|pid:none) Schistosoma japonicum isolate Anhu... 218 3e-55
AK318808_1(AK318808|pid:none) Arabidopsis thaliana AT1G57720 mRN... 217 9e-55
FN316203_1(FN316203|pid:none) Schistosoma japonicum isolate Anhu... 216 1e-54
FN322815_1(FN322815|pid:none) Schistosoma japonicum isolate Anhu... 216 1e-54
FN322802_1(FN322802|pid:none) Schistosoma japonicum isolate Anhu... 216 1e-54
AM494946_102(AM494946|pid:none) Leishmania braziliensis chromoso... 216 2e-54
DQ680317_1(DQ680317|pid:none) Microstigmata longipes MY165 elong... 213 1e-53
AM502227_102(AM502227|pid:none) Leishmania infantum chromosome 9. 213 1e-53
AM502227_103(AM502227|pid:none) Leishmania infantum chromosome 9. 213 1e-53
AY545588_1(AY545588|pid:none) Crithidia fasciculata elongation f... 212 3e-53
AY677169_1(AY677169|pid:none) Leishmania major elongation factor... 209 2e-52
DQ680314_1(DQ680314|pid:none) Calisoga longitarsis MY77 elongati... 208 3e-52
DQ680328_1(DQ680328|pid:none) Atypoides riversi MY1048 elongatio... 208 3e-52
DQ680321_1(DQ680321|pid:none) Stasimopus sp. MY161 elongation fa... 207 5e-52
DQ680308_1(DQ680308|pid:none) Aptostichus sp. 2 NAA-2006 elongat... 205 3e-51
AY545587_1(AY545587|pid:none) Crithidia fasciculata elongation f... 204 6e-51
(P54412) RecName: Full=Probable elongation factor 1-gamma; ... 202 3e-50
DQ680316_1(DQ680316|pid:none) Homogona pulleinei MY897 elongatio... 201 5e-50
AY816158_1(AY816158|pid:none) Schistosoma japonicum SJCHGC09416 ... 201 7e-50
BX842617_2(BX842617|pid:none) Neurospora crassa DNA linkage grou... 201 7e-50
DQ448229_1(DQ448229|pid:none) Artemia franciscana clone 13RP10.0... 200 9e-50
DQ680349_1(DQ680349|pid:none) Plectreurys tristis elongation fac... 198 3e-49
CU640366_1297(CU640366|pid:none) Podospora anserina genomic DNA ... 192 2e-47
Z72507_18(Z72507|pid:none) Caenorhabditis elegans Cosmid F17C11,... 189 2e-46
BT044055_1(BT044055|pid:none) Salmo salar clone HM4_2581 elongat... 189 3e-46
AB171194_1(AB171194|pid:none) Macaca fascicularis brain cDNA clo... 189 3e-46
AK011973_1(AK011973|pid:none) Mus musculus 10 days embryo whole ... 188 4e-46
BT012478_1(BT012478|pid:none) Drosophila melanogaster RE15368 fu... 188 4e-46
AK014277_1(AK014277|pid:none) Mus musculus 14, 17 days embryo he... 188 4e-46
FN357619_20(FN357619|pid:none) Schistosoma mansoni genome sequen... 186 2e-45
EU964428_1(EU964428|pid:none) Zea mays clone 278867 unknown mRNA. 185 3e-45
AM910994_154(AM910994|pid:none) Plasmodium knowlesi strain H chr... 182 2e-44
BT034968_1(BT034968|pid:none) Zea mays full-length cDNA clone ZM... 182 2e-44
AE017341_392(AE017341|pid:none) Cryptococcus neoformans var. neo... 181 7e-44
AM920435_1185(AM920435|pid:none) Penicillium chrysogenum Wiscons... 173 1e-41
CR382126_1114(CR382126|pid:none) Kluyveromyces lactis strain NRR... 173 1e-41
Z72507_17(Z72507|pid:none) Caenorhabditis elegans Cosmid F17C11,... 171 7e-41
CP000496_779(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 166 2e-39
AL844509_376(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 165 3e-39
L01880_1(L01880|pid:none) Saccharomyces cerevisiae elongation fa... 159 2e-37
(P36008) RecName: Full=Elongation factor 1-gamma 2; Sho... 159 2e-37
FM992690_559(FM992690|pid:none) Candida dubliniensis CD36 chromo... 159 3e-37
(P40921) RecName: Full=Elongation factor 1-gamma; Short... 158 5e-37
FN392322_96(FN392322|pid:none) Pichia pastoris GS115 chromosome ... 155 2e-36
CR382128_486(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 154 5e-36
L01879_1(L01879|pid:none) Saccharomyces cerevisiae elongation fa... 150 1e-34
Z28080_1(Z28080|pid:none) S.cerevisiae chromosome XI reading fra... 148 5e-34
EF207971_1(EF207971|pid:none) Heliconius melpomene elongation fa... 145 4e-33
EU711260_1(EU711260|pid:none) Caenorhabditis brenneri clone 5B54... 144 7e-33
EF214852_1(EF214852|pid:none) Callithrix jacchus clone F07-41.2_... 144 9e-33
AK318832_1(AK318832|pid:none) Arabidopsis thaliana AT1G09640 mRN... 141 5e-32
CU928178_355(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 141 6e-32
AK300729_1(AK300729|pid:none) Homo sapiens cDNA FLJ59433 complet... 140 1e-31
DQ680324_1(DQ680324|pid:none) Megahexura fulva MY152 elongation ... 139 2e-31
CR380958_220(CR380958|pid:none) Candida glabrata strain CBS138 c... 137 1e-30
AB098933_1(AB098933|pid:none) Bos taurus mRNA for similar to elo... 132 4e-29
CU928169_485(CU928169|pid:none) Kluyveromyces thermotolerans str... 130 8e-29
AB099085_1(AB099085|pid:none) Bos taurus mRNA for similar to elo... 129 2e-28
DQ680329_1(DQ680329|pid:none) Segregara sp. MY192 elongation fac... 122 3e-26
AB098935_1(AB098935|pid:none) Bos taurus mRNA for similar to elo... 122 4e-26
DQ680326_1(DQ680326|pid:none) Ozicrypta sp. MY839 elongation fac... 120 1e-25
DQ453521_1(DQ453521|pid:none) Marmota monax eukaryotic translati... 114 6e-24
AK300686_1(AK300686|pid:none) Homo sapiens cDNA FLJ59991 complet... 106 2e-21
FN316199_1(FN316199|pid:none) Schistosoma japonicum isolate Anhu... 105 5e-21
FN322805_1(FN322805|pid:none) Schistosoma japonicum isolate Anhu... 105 5e-21
AB098747_1(AB098747|pid:none) Bos taurus mRNA for similar to pan... 104 8e-21
BT052291_1(BT052291|pid:none) Medicago truncatula clone MTYF9_FA... 102 3e-20
AY225101_1(AY225101|pid:none) Pseudopleuronectes americanus euka... 101 5e-20
FN322813_1(FN322813|pid:none) Schistosoma japonicum isolate Anhu... 99 3e-19
FN316202_1(FN316202|pid:none) Schistosoma japonicum isolate Anhu... 98 6e-19
AK221925_1(AK221925|pid:none) Arabidopsis thaliana mRNA for hypo... 98 6e-19
AM270332_4(AM270332|pid:none) Aspergillus niger contig An15c0050... 95 5e-18
(P49696) RecName: Full=Valyl-tRNA synthetase; EC=6.1.1.... 95 7e-18
AY825246_1(AY825246|pid:none) Tetrahymena pyriformis translation... 94 1e-17
AF506219_1(AF506219|pid:none) Danio rerio valyl-tRNA synthetase ... 92 6e-17
AM269978_57(AM269978|pid:none) Aspergillus niger contig An01c031... 91 1e-16
CU633457_117(CU633457|pid:none) Podospora anserina genomic DNA c... 89 3e-16
EU677708_1(EU677708|pid:none) Caenorhabditis brenneri EF-1-gamma... 82 6e-14
BC084762_1(BC084762|pid:none) Xenopus laevis hypothetical LOC495... 81 8e-14
EU692912_1(EU692912|pid:none) Caenorhabditis brenneri clone 2C7.... 80 1e-13
AP007157_511(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 80 1e-13
EU282356_1(EU282356|pid:none) Sus scrofa valyl-tRNA synthetase (... 80 2e-13
BC012808_1(BC012808|pid:none) Homo sapiens valyl-tRNA synthetase... 79 4e-13
(P26640) RecName: Full=Valyl-tRNA synthetase; EC=6.1.1.... 78 8e-13
AL929592_1(AL929592|pid:none) Human DNA sequence from clone DAQB... 78 8e-13
AF109906_13(AF109906|pid:none) Mus musculus MHC class III region... 77 2e-12
AF087141_1(AF087141|pid:none) Mus musculus uncharacterized long ... 77 2e-12
BC053703_1(BC053703|pid:none) Mus musculus valyl-tRNA synthetase... 77 2e-12
(Q9Z1Q9) RecName: Full=Valyl-tRNA synthetase; EC=6.1.1.... 77 2e-12
(Q04462) RecName: Full=Valyl-tRNA synthetase; EC=6.1.1.... 76 2e-12
L27825_2(L27825|pid:none) Emericella nidulans (verA) gene, compl... 76 3e-12
CR954204_497(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 76 3e-12
AM502251_164(AM502251|pid:none) Leishmania infantum chromosome 33. 74 2e-11
FN392321_1100(FN392321|pid:none) Pichia pastoris GS115 chromosom... 73 2e-11
CT005270_189(CT005270|pid:none) Leishmania major strain Friedlin... 70 2e-10
AM494970_180(AM494970|pid:none) Leishmania braziliensis chromoso... 70 2e-10
BT069650_1(BT069650|pid:none) Zea mays full-length cDNA clone ZM... 69 3e-10
XUZM1(S03726;S00716;S03727)glutathione transferase (EC 2.5.1.18)... 69 4e-10
AB098752_1(AB098752|pid:none) Bos taurus mRNA for similar to pan... 69 4e-10
(P12653) RecName: Full=Glutathione S-transferase 1; EC=... 69 4e-10
FB809657_1(FB809657|pid:none) Sequence 28930 from Patent WO20080... 69 5e-10
CP000388_195(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 67 1e-09
AJ419775_1(AJ419775|pid:none) Hordeum vulgare mRNA for glutathio... 67 2e-09
DQ185040_1(DQ185040|pid:none) Homo sapiens eukaryotic translatio... 65 6e-09
AB010288_1(AB010288|pid:none) Trypanosoma cruzi gene for elongat... 64 1e-08
CP000571_1688(CP000571|pid:none) Burkholderia pseudomallei 668 c... 64 2e-08
AK220816_1(AK220816|pid:none) Arabidopsis thaliana mRNA for hypo... 64 2e-08
CP001614_4214(CP001614|pid:none) Teredinibacter turnerae T7901, ... 64 2e-08
AF184059_1(AF184059|pid:none) Triticum aestivum glutathione S-tr... 64 2e-08
FB809655_1(FB809655|pid:none) Sequence 28928 from Patent WO20080... 64 2e-08
AM902716_3907(AM902716|pid:none) Bordetella petrii strain DSM 12... 63 2e-08
DQ222511_1(DQ222511|pid:none) Solanum tuberosum clone 117C01 unk... 63 3e-08
A98037_1(A98037|pid:none) Sequence 7 from Patent WO9914337. &AJ... 63 3e-08
DQ355374_1(DQ355374|pid:none) Bombyx mori glutathione S-transfer... 62 4e-08
AC104489_3(AC104489|pid:none) Trypanosoma cruzi strain CL Brener... 62 6e-08
FB809767_1(FB809767|pid:none) Sequence 29040 from Patent WO20080... 62 6e-08
FB809799_1(FB809799|pid:none) Sequence 29072 from Patent WO20080... 61 8e-08
AP002914_5(AP002914|pid:none) Oryza sativa Japonica Group genomi... 61 8e-08
A98043_1(A98043|pid:none) Sequence 13 from Patent WO9914337. &A... 60 1e-07
CP000090_1474(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 60 2e-07
CP000644_2329(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 60 2e-07
CP001053_884(CP001053|pid:none) Burkholderia phytofirmans PsJN c... 60 2e-07
CP000076_4519(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 60 2e-07
CP000512_4360(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 59 3e-07
CP000777_287(CP000777|pid:none) Leptospira biflexa serovar Patoc... 59 3e-07
AM902716_3738(AM902716|pid:none) Bordetella petrii strain DSM 12... 59 3e-07
CP000584_459(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 59 4e-07
DQ149246_4(DQ149246|pid:none) Mycosphaerella pini hypothetical p... 59 5e-07
AM743169_3968(AM743169|pid:none) Stenotrophomonas maltophilia K2... 58 7e-07
AK062937_1(AK062937|pid:none) Oryza sativa Japonica Group cDNA c... 58 9e-07
AY823546_1(AY823546|pid:none) Pennisetum glaucum glutathione S-t... 57 1e-06
AF309382_1(AF309382|pid:none) Oryza sativa (japonica cultivar-gr... 57 2e-06
FB809661_1(FB809661|pid:none) Sequence 28934 from Patent WO20080... 57 2e-06
FB809805_1(FB809805|pid:none) Sequence 29078 from Patent WO20080... 57 2e-06
AY553635_1(AY553635|pid:none) Cynodon dactylon glutathione s-tra... 57 2e-06
CP000075_1628(CP000075|pid:none) Pseudomonas syringae pv. syring... 57 2e-06
EF576125_1(EF576125|pid:none) Oryza sativa (indica cultivar-grou... 57 2e-06
AK063796_1(AK063796|pid:none) Oryza sativa Japonica Group cDNA c... 57 2e-06
CP000615_776(CP000615|pid:none) Burkholderia vietnamiensis G4 ch... 57 2e-06
EF147828_1(EF147828|pid:none) Populus trichocarpa clone WS0125_E... 57 2e-06
AP009386_282(AP009386|pid:none) Burkholderia multivorans ATCC 17... 56 3e-06
FJ360741_1(FJ360741|pid:none) Cydia pomonella glutathione S-tran... 56 3e-06
CP000712_3768(CP000712|pid:none) Pseudomonas putida F1, complete... 56 3e-06
CU640366_769(CU640366|pid:none) Podospora anserina genomic DNA c... 56 3e-06
CP000058_1554(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 56 3e-06
AJ010295_1(AJ010295|pid:none) Zea mays mRNA for glutathione tran... 56 3e-06
CP001013_4331(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 55 4e-06
CP000440_1576(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 55 4e-06
CP001029_3147(CP001029|pid:none) Methylobacterium populi BJ001, ... 55 4e-06
CP001037_5570(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 55 4e-06
CP001111_3596(CP001111|pid:none) Stenotrophomonas maltophilia R5... 55 4e-06
AE004091_2814(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 55 4e-06
CP000438_2211(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 55 4e-06
(O43324) RecName: Full=Eukaryotic translation elongation factor ... 55 4e-06
AY657603_1(AY657603|pid:none) Synthetic construct Peudomonas aer... 55 4e-06
AM502230_31(AM502230|pid:none) Leishmania infantum chromosome 12. 55 6e-06
CP001074_1220(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 55 6e-06
CP001026_463(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 55 6e-06
CP000606_3204(CP000606|pid:none) Shewanella loihica PV-4, comple... 55 6e-06
CP000085_16(CP000085|pid:none) Burkholderia thailandensis E264 c... 55 6e-06
CP000908_2278(CP000908|pid:none) Methylobacterium extorquens PA1... 55 6e-06
AM181176_2096(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 55 6e-06
CT005251_37(CT005251|pid:none) Leishmania major strain Friedlin,... 55 6e-06
AE016853_4655(AE016853|pid:none) Pseudomonas syringae pv. tomato... 54 1e-05
BT040369_1(BT040369|pid:none) Zea mays full-length cDNA clone ZM... 54 1e-05
CP000494_1518(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 54 1e-05
AF448500_1(AF448500|pid:none) Nilaparvata lugens glutathione S-t... 54 1e-05
EU124621_1(EU124621|pid:none) Lutzomyia longipalpis putative glu... 54 1e-05
AM286415_1401(AM286415|pid:none) Yersinia enterocolitica subsp. ... 54 1e-05
AE0160(AE0160) probable glutathione S-transferase-family protein... 54 1e-05
CP000884_906(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 54 1e-05
A98041_1(A98041|pid:none) Sequence 11 from Patent WO9914337. &A... 54 1e-05
CP000863_1174(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 54 1e-05
AM428484_1(AM428484|pid:none) Vitis vinifera contig VV78X050883.... 54 1e-05
AE015451_1879(AE015451|pid:none) Pseudomonas putida KT2440 compl... 54 1e-05
CP000441_1568(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 54 1e-05
AE009952_2826(AE009952|pid:none) Yersinia pestis KIM, complete g... 54 1e-05
CP000269_2627(CP000269|pid:none) Janthinobacterium sp. Marseille... 54 1e-05
CP001191_785(CP001191|pid:none) Rhizobium leguminosarum bv. trif... 54 1e-05
CU695242_151(CU695242|pid:none) Ralstonia solanacearum strain Mo... 54 1e-05
AE015451_1152(AE015451|pid:none) Pseudomonas putida KT2440 compl... 54 2e-05
AM181176_1825(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 54 2e-05
CP000744_2315(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 54 2e-05
AL162651_19(AL162651|pid:none) Arabidopsis thaliana DNA chromoso... 53 2e-05
CP001635_3685(CP001635|pid:none) Variovorax paradoxus S110 chrom... 53 2e-05
AC073906_3(AC073906|pid:none) Trypanosoma brucei chromosome 6 cl... 53 2e-05
BC084764_1(BC084764|pid:none) Xenopus laevis hypothetical LOC495... 53 3e-05
CP000927_2773(CP000927|pid:none) Caulobacter sp. K31, complete g... 53 3e-05
BC166841_1(BC166841|pid:none) Rattus norvegicus eukaryotic trans... 53 3e-05
(O82451) RecName: Full=Probable glutathione S-transferase GSTF2;... 53 3e-05
CP001503_1752(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 53 3e-05
CP000926_2006(CP000926|pid:none) Pseudomonas putida GB-1, comple... 53 3e-05
CP000614_1597(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 53 3e-05
AB019225_1(AB019225|pid:none) Arabidopsis thaliana genomic DNA, ... 53 3e-05
CP001655_2347(CP001655|pid:none) Dickeya zeae Ech1591, complete ... 52 4e-05
FB809651_1(FB809651|pid:none) Sequence 28924 from Patent WO20080... 52 4e-05
CP000926_1458(CP000926|pid:none) Pseudomonas putida GB-1, comple... 52 4e-05
CP000250_1309(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 52 4e-05
FJ851372_1(FJ851372|pid:none) Chironomus tentans glutathione S-t... 52 4e-05
CP000152_202(CP000152|pid:none) Burkholderia sp. 383 chromosome ... 52 4e-05
CP000633_869(CP000633|pid:none) Agrobacterium vitis S4 chromosom... 52 5e-05
AF243376_1(AF243376|pid:none) Glycine max glutathione S-transfer... 52 5e-05
AP009384_3556(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 52 5e-05
CP000076_1739(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 52 5e-05
CP000712_3130(CP000712|pid:none) Pseudomonas putida F1, complete... 52 5e-05
AE008923_4290(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 52 5e-05
CP001298_3095(CP001298|pid:none) Methylobacterium chloromethanic... 52 6e-05
AF515524_1(AF515524|pid:none) Anopheles gambiae glutathione S-tr... 52 6e-05
AE004091_1892(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 52 6e-05
S64523(S64523;S53924;S63850) translation elongation factor eEF-1... 52 6e-05
AM167904_1908(AM167904|pid:none) Bordetella avium 197N complete ... 52 6e-05
EU719194_1(EU719194|pid:none) Phragmites australis glutathione S... 52 6e-05
CP000152_2433(CP000152|pid:none) Burkholderia sp. 383 chromosome... 52 6e-05
CP000949_1503(CP000949|pid:none) Pseudomonas putida W619, comple... 51 8e-05
EF576347_1(EF576347|pid:none) Oryza sativa (indica cultivar-grou... 51 8e-05
CP000884_4692(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 51 8e-05
CP000316_4166(CP000316|pid:none) Polaromonas sp. JS666, complete... 51 8e-05
CP000826_1617(CP000826|pid:none) Serratia proteamaculans 568, co... 51 8e-05
AL591688_961(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 51 8e-05
EU070904_1(EU070904|pid:none) Dasypyrum villosum glutathione S-t... 51 8e-05
A98033_1(A98033|pid:none) Sequence 3 from Patent WO9914337. &AJ... 51 8e-05
DQ680336_1(DQ680336|pid:none) Nesticus sp. 733 elongation factor... 51 8e-05
CP000613_2272(CP000613|pid:none) Rhodospirillum centenum SW, com... 51 1e-04
FB809671_1(FB809671|pid:none) Sequence 28944 from Patent WO20080... 51 1e-04
CP000781_1497(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 51 1e-04
CP000379_1692(CP000379|pid:none) Burkholderia cenocepacia AU 105... 51 1e-04
FB809801_1(FB809801|pid:none) Sequence 29074 from Patent WO20080... 51 1e-04
CP001191_901(CP001191|pid:none) Rhizobium leguminosarum bv. trif... 51 1e-04
CP000282_3817(CP000282|pid:none) Saccharophagus degradans 2-40, ... 50 1e-04
CP000086_2351(CP000086|pid:none) Burkholderia thailandensis E264... 50 1e-04
EU520417_2(EU520417|pid:none) Hypomyces subiculosus strain DSM11... 50 1e-04
CP000959_661(CP000959|pid:none) Burkholderia cenocepacia MC0-3 c... 50 1e-04
GM960708_1(GM960708|pid:none) Sequence 7662 from Patent WO200814... 50 1e-04
(P46423) RecName: Full=Glutathione S-transferase; EC=2.... 50 1e-04
CP000151_1648(CP000151|pid:none) Burkholderia sp. 383 chromosome... 50 1e-04
(Q96324) RecName: Full=Glutathione S-transferase; EC=2.... 50 1e-04
AY632357_1(AY632357|pid:none) Antrodia camphorata glutathione tr... 50 2e-04
CP001622_892(CP001622|pid:none) Rhizobium leguminosarum bv. trif... 50 2e-04
CP001029_2235(CP001029|pid:none) Methylobacterium populi BJ001, ... 50 2e-04
CP001053_1068(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 50 2e-04
CP000647_3830(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 50 2e-04
AM747720_1727(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 50 2e-04
CR954247_326(CR954247|pid:none) Pseudoalteromonas haloplanktis s... 50 2e-04
AJ879121_1(AJ879121|pid:none) Capsicum chinense mRNA for glutath... 50 2e-04
AL646052_985(AL646052|pid:none) Ralstonia solanacearum GMI1000 c... 50 2e-04
CP001622_506(CP001622|pid:none) Rhizobium leguminosarum bv. trif... 50 2e-04
CR543861_15(CR543861|pid:none) Acinetobacter sp. ADP1 complete g... 50 2e-04
CP000076_2242(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 50 2e-04
EU418978_1(EU418978|pid:none) Oesophagostomum dentatum cytosolic... 50 2e-04
AM747721_710(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 50 2e-04
DQ315381_1(DQ315381|pid:none) Lygus lineolaris isolate LLS GST m... 49 3e-04
CP001654_1796(CP001654|pid:none) Dickeya dadantii Ech703, comple... 49 3e-04
BX640424_171(BX640424|pid:none) Bordetella parapertussis strain ... 49 3e-04
AF402793_1(AF402793|pid:none) Oryza sativa (japonica cultivar-gr... 49 3e-04
AK340178_1(AK340178|pid:none) Acyrthosiphon pisum ACYPI009122 mR... 49 3e-04
CP000738_403(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 49 4e-04
AE016825_905(AE016825|pid:none) Chromobacterium violaceum ATCC 1... 49 4e-04
AY657600_1(AY657600|pid:none) Synthetic construct Peudomonas aer... 49 4e-04
BX950851_2666(BX950851|pid:none) Erwinia carotovora subsp. atros... 49 4e-04
CP000712_1180(CP000712|pid:none) Pseudomonas putida F1, complete... 49 4e-04
CP000521_1275(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 49 4e-04
BX640438_170(BX640438|pid:none) Bordetella bronchiseptica strain... 49 4e-04
AM902716_1526(AM902716|pid:none) Bordetella petrii strain DSM 12... 49 4e-04
CP000380_291(CP000380|pid:none) Burkholderia cenocepacia AU 1054... 49 4e-04
CP001510_4571(CP001510|pid:none) Methylobacterium extorquens AM1... 49 4e-04
EU079461_1(EU079461|pid:none) Drosophila arizonae strain CHI13 g... 49 4e-04
EU365624_1(EU365624|pid:none) Thellungiella halophila glutathion... 49 5e-04
AM181176_4708(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 49 5e-04
AJ002381_1(AJ002381|pid:none) Oryza sativa mRNA for second gluta... 49 5e-04
BT053539_1(BT053539|pid:none) Medicago truncatula clone MTYFP_FQ... 49 5e-04
CP000542_1138(CP000542|pid:none) Verminephrobacter eiseniae EF01... 49 5e-04
CP000744_3575(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 49 5e-04
AF243362_1(AF243362|pid:none) Glycine max glutathione S-transfer... 49 5e-04
AE005673_2626(AE005673|pid:none) Caulobacter crescentus CB15, co... 49 5e-04
CP000680_3202(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 49 5e-04
BA000040_7404(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 49 5e-04
CP000075_1841(CP000075|pid:none) Pseudomonas syringae pv. syring... 49 5e-04
CP001074_1352(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 49 5e-04
CP001052_1963(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 48 7e-04
CR382124_481(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 48 7e-04
AP009384_3365(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 48 7e-04
CP000031_3417(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 48 7e-04
CP000270_1097(CP000270|pid:none) Burkholderia xenovorans LB400 c... 48 7e-04
FB809643_1(FB809643|pid:none) Sequence 28916 from Patent WO20080... 48 7e-04
CP000271_2061(CP000271|pid:none) Burkholderia xenovorans LB400 c... 48 0.001
AK340504_1(AK340504|pid:none) Acyrthosiphon pisum ACYPI008657 mR... 48 0.001
FB809641_1(FB809641|pid:none) Sequence 28914 from Patent WO20080... 48 0.001
CP000529_3951(CP000529|pid:none) Polaromonas naphthalenivorans C... 48 0.001
CP000926_4222(CP000926|pid:none) Pseudomonas putida GB-1, comple... 48 0.001
AE008923_3769(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 48 0.001
CP001503_1029(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 48 0.001
AJ010452_1(AJ010452|pid:none) Alopecurus myosuroides mRNA for gl... 47 0.001
EU079444_1(EU079444|pid:none) Drosophila navojoa strain NAV10 gl... 47 0.001
CP000539_3826(CP000539|pid:none) Acidovorax sp. JS42, complete g... 47 0.001
AM236080_891(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 47 0.001
BA000012_3811(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 47 0.001
CP000653_1320(CP000653|pid:none) Enterobacter sp. 638, complete ... 47 0.001
AJ010454_1(AJ010454|pid:none) Alopecurus myosuroides mRNA for gl... 47 0.001
CP001389_702(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 47 0.002
AM746676_5404(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 47 0.002
AE013599_2847(AE013599|pid:none) Drosophila melanogaster chromos... 47 0.002
EU079381_1(EU079381|pid:none) Drosophila mojavensis strain ANZA1... 47 0.002
CP000628_3132(CP000628|pid:none) Agrobacterium radiobacter K84 c... 47 0.002
CP000777_1395(CP000777|pid:none) Leptospira biflexa serovar Pato... 47 0.002
EU079443_1(EU079443|pid:none) Drosophila navojoa strain NAV1 glu... 47 0.002
CP000555_3276(CP000555|pid:none) Methylibium petroleiphilum PM1,... 47 0.002
CP000943_1275(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 47 0.002
CP000628_1024(CP000628|pid:none) Agrobacterium radiobacter K84 c... 47 0.002
FB809761_1(FB809761|pid:none) Sequence 29034 from Patent WO20080... 47 0.002
CP001350_201(CP001350|pid:none) Methylobacterium nodulans ORS 20... 47 0.002
AE005673_2071(AE005673|pid:none) Caulobacter crescentus CB15, co... 47 0.002
EF088687_1(EF088687|pid:none) Vitis vinifera glutathione S-trans... 47 0.002
AP009385_1649(AP009385|pid:none) Burkholderia multivorans ATCC 1... 47 0.002
CP000563_1375(CP000563|pid:none) Shewanella baltica OS155, compl... 47 0.002
CP001252_2906(CP001252|pid:none) Shewanella baltica OS223, compl... 47 0.002
FB809759_1(FB809759|pid:none) Sequence 29032 from Patent WO20080... 47 0.002
CP000155_3040(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 47 0.002
CP000094_3748(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 47 0.002
CP000927_3324(CP000927|pid:none) Caulobacter sp. K31, complete g... 47 0.002
EU079405_1(EU079405|pid:none) Drosophila mojavensis strain DE22 ... 46 0.003
BC129653_1(BC129653|pid:none) Xenopus laevis hypothetical protei... 46 0.003
CP001280_3460(CP001280|pid:none) Methylocella silvestris BL2, co... 46 0.003
AC009525_6(AC009525|pid:none) Arabidopsis thaliana chromosome I ... 46 0.003
(Q9VG98) RecName: Full=Glutathione S-transferase D2; Sh... 46 0.003
CP001389_396(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 46 0.003
CP001196_2746(CP001196|pid:none) Oligotropha carboxidovorans OM5... 46 0.003
CP000086_1080(CP000086|pid:none) Burkholderia thailandensis E264... 46 0.003
CP000884_3314(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 46 0.003
U87958_1(U87958|pid:none) Culicoides variipennis glutathione S t... 46 0.003
FB809773_1(FB809773|pid:none) Sequence 29046 from Patent WO20080... 46 0.003
AP002914_9(AP002914|pid:none) Oryza sativa Japonica Group genomi... 46 0.004
AK229226_1(AK229226|pid:none) Arabidopsis thaliana mRNA for puta... 46 0.004
EU079447_1(EU079447|pid:none) Drosophila arizonae strain ARNA22 ... 46 0.004
AE016853_1995(AE016853|pid:none) Pseudomonas syringae pv. tomato... 46 0.004
AJ132398_1(AJ132398|pid:none) Arabidopsis thaliana mRNA for glut... 46 0.004
AF288191_1(AF288191|pid:none) Arabidopsis thaliana chromosome I ... 46 0.004
CP000379_2405(CP000379|pid:none) Burkholderia cenocepacia AU 105... 46 0.004
EF370473_1(EF370473|pid:none) Choristoneura fumiferana glutathio... 46 0.004
(Q52828) RecName: Full=Protein gstA; &X89816_2(X89816|pid:none) 46 0.004
CU633749_1062(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 46 0.004
AC105772_2(AC105772|pid:none) Oryza sativa (japonica cultivar-gr... 46 0.004
BA000012_1591(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 46 0.004
CP000949_3356(CP000949|pid:none) Pseudomonas putida W619, comple... 46 0.004
CP001344_1678(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 45 0.005
CP000010_1547(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 45 0.005
CP000083_2679(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 45 0.005
AB2377(AB2377) glutathione S-transferase [imported] - Nostoc sp.... 45 0.005
CP000124_1450(CP000124|pid:none) Burkholderia pseudomallei 1710b... 45 0.005
AY139996_1(AY139996|pid:none) Arabidopsis thaliana glutathione t... 45 0.005
CU633750_357(CU633750|pid:none) Cupriavidus taiwanensis str. LMG... 45 0.005
CP001103_660(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 45 0.005
AM942759_660(AM942759|pid:none) Proteus mirabilis strain HI4320,... 45 0.006
CP000783_1938(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 45 0.006
AB059484_1(AB059484|pid:none) Cucurbita maxima Pugf mRNA for glu... 45 0.006
AY121705_1(AY121705|pid:none) Drosophila melanogaster RH47312 fu... 45 0.006
AP008231_295(AP008231|pid:none) Synechococcus elongatus PCC 6301... 45 0.006
DQ680337_1(DQ680337|pid:none) Deinopis spinosa elongation factor... 45 0.006
CP001359_3496(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 45 0.006
CP000570_1311(CP000570|pid:none) Burkholderia pseudomallei 668 c... 45 0.006
CP001291_3449(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 45 0.006
CP000248_2749(CP000248|pid:none) Novosphingobium aromaticivorans... 45 0.006
CP001151_1121(CP001151|pid:none) Rhodobacter sphaeroides KD131 c... 45 0.008
AM167904_771(AM167904|pid:none) Bordetella avium 197N complete g... 45 0.008
CP000526_1561(CP000526|pid:none) Burkholderia mallei SAVP1 chrom... 45 0.008
BA000040_4398(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 45 0.008
BX640411_74(BX640411|pid:none) Bordetella pertussis strain Toham... 45 0.008
AM743169_896(AM743169|pid:none) Stenotrophomonas maltophilia K27... 45 0.008
BX571965_1765(BX571965|pid:none) Burkholderia pseudomallei strai... 45 0.008
AM433192_1(AM433192|pid:none) Vitis vinifera contig VV78X179831.... 45 0.008
AJ006502_1(AJ006502|pid:none) Bombyx mori mRNA for glutathione S... 45 0.008
D46681(D46681)glutathione transferase (EC 2.5.1.18) D21 - fruit ... 45 0.008
CP001052_251(CP001052|pid:none) Burkholderia phytofirmans PsJN c... 45 0.008
CP000680_1520(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 45 0.008
Y12295_1(Y12295|pid:none) A.thaliana mRNA for gluthatione transf... 45 0.008
AK222767_1(AK222767|pid:none) Homo sapiens mRNA for methionine-t... 44 0.010
AE015451_1806(AE015451|pid:none) Pseudomonas putida KT2440 compl... 44 0.010
CP000949_1179(CP000949|pid:none) Pseudomonas putida W619, comple... 44 0.010
(P56192) RecName: Full=Methionyl-tRNA synthetase, cytoplasmic; ... 44 0.010
AK122956_1(AK122956|pid:none) Homo sapiens cDNA FLJ16674 fis, cl... 44 0.010
CP000133_809(CP000133|pid:none) Rhizobium etli CFN 42, complete ... 44 0.010
DQ901400_1(DQ901400|pid:none) Pyrus communis glutathione S-trans... 44 0.010
AE016825_1775(AE016825|pid:none) Chromobacterium violaceum ATCC ... 44 0.010
CP001339_871(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 44 0.010
CP000158_2524(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 44 0.010
CP000949_1428(CP000949|pid:none) Pseudomonas putida W619, comple... 44 0.010
AF243377_1(AF243377|pid:none) Glycine max glutathione S-transfer... 44 0.010
AE016825_2745(AE016825|pid:none) Chromobacterium violaceum ATCC ... 44 0.010
CU928158_926(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 44 0.013
CP000388_1121(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 44 0.013
DQ680331_1(DQ680331|pid:none) Argiope argentata elongation facto... 44 0.013
AF386788_1(AF386788|pid:none) Drosophila simulans glutathione S-... 44 0.013
CP001074_894(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 44 0.013
CP001408_1979(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 44 0.013
CP001344_301(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 44 0.013
CP000769_354(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co... 44 0.013
AM167904_448(AM167904|pid:none) Bordetella avium 197N complete g... 44 0.013
(P46429) RecName: Full=Glutathione S-transferase 2; EC=... 44 0.013
AL591688_791(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 44 0.013
CP001349_5159(CP001349|pid:none) Methylobacterium nodulans ORS 2... 44 0.013
(P20432) RecName: Full=Glutathione S-transferase 1-1; E... 44 0.013
BA000022_2306(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 44 0.013
CP000926_1390(CP000926|pid:none) Pseudomonas putida GB-1, comple... 44 0.017
AM746676_8864(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 44 0.017
CP000927_790(CP000927|pid:none) Caulobacter sp. K31, complete ge... 44 0.017
CP000655_1976(CP000655|pid:none) Polynucleobacter necessarius su... 44 0.017
CU633749_1049(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 44 0.017
(P42760) RecName: Full=Glutathione S-transferase 1; EC=... 44 0.017
CP000830_240(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 44 0.017
(P30110) RecName: Full=Glutathione S-transferase 1; EC=... 44 0.017
CP000494_3523(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 44 0.017
AB019225_3(AB019225|pid:none) Arabidopsis thaliana genomic DNA, ... 44 0.017
AM270358_39(AM270358|pid:none) Aspergillus niger contig An16c006... 44 0.017
CU928158_1499(CU928158|pid:none) Escherichia fergusonii ATCC 354... 44 0.017
CP000388_3791(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 44 0.017
AM270333_1(AM270333|pid:none) Aspergillus niger contig An15c0060... 43 0.023
S51566(S51566;S42468)glutathione transferase (EC 2.5.1.18) 2 - h... 43 0.023
EU272038_1(EU272038|pid:none) Chimonanthus praecox glutathione S... 43 0.023
(Q2T9L8) RecName: Full=Methionyl-tRNA synthetase, cytoplasmic; ... 43 0.023
CP000240_1238(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 43 0.023

>(Q6PE25) RecName: Full=Elongation factor 1-gamma;
Short=EF-1-gamma; AltName: Full=eEF-1B gamma;
&AY394968_1(AY394968|pid:none)
&BC058315_1(BC058315|pid:none)
Length = 442

Score = 318 bits (814), Expect = 4e-85
Identities = 185/448 (41%), Positives = 254/448 (56%), Gaps = 42/448 (9%)
Frame = +1

Query: 55 LYTYPQNSRAFKSLIAAKYVNVDIEV----PAFNFETDRLTEEFKTNFPLGKVPALLTEQ 222
LYTYP+N RAFK+ IAA+Y +++ PAF F + F NFPLGKVPA +
Sbjct: 6 LYTYPENWRAFKAQIAAQYSGARLKIASAPPAFTFGQTNRSPAFLGNFPLGKVPAYQGDD 65

Query: 223 G-PLFESNTMARYVARLNNSTIYGSDAYTAALNDQWIDYAANEIDPNAIPWLYAILGYYD 399
G LFESN +A Y L+N + GS +A QW+ +A +E+ P A W++ LG
Sbjct: 66 GFCLFESNAIAHY---LSNDVLRGSTPQASAQVLQWVSFADSEVIPPASAWVFPTLGIMQ 122

Query: 400 YNAKDSNKAKENMKKVLAFLDAQLLNKPFLTGFRVALADIIVVCSLFNFYKMVFEPTFRS 579
+N + + +AKE +K+VLA L+ L + FL G R++LADI VVCSL YK V EP FR
Sbjct: 123 FNKQATEQAKEEVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLWLYKQVLEPAFRQ 182

Query: 580 PYVNVNRWFTTCINQPNFKAVIGEFALCEKMMVYXXXXXXXXXXXXXXXXXXXXXXDAG- 756
PY NV RWF TC+NQP FK V+GE LCEKM + G
Sbjct: 183 PYPNVTRWFVTCVNQPQFKTVLGEVKLCEKMAQFDAKKFAEMQPKKEAPIKKEKGGKEGG 242

Query: 757 ----------------------DDEVDE-------KPKKKNPLDELAPSTFVLDEFKRTY 849
++E+DE +PK K+P L S+FV+DEFKR Y
Sbjct: 243 KQQPQQQEKKEKKKEEKKAAPAEEEMDECEAALASEPKAKDPFAHLPKSSFVMDEFKRKY 302

Query: 850 SNNE-VSMSIPWFFEHFDKEGFSVYQCTYQYNHELGPVFKTCNLVGGFFQRLETLHKYAF 1026
SN + +++++P+F++HFD+EGFS++ Y++ EL F +CNL+ G FQRL+ L K AF
Sbjct: 303 SNEDTMTVALPYFWDHFDREGFSIWYAEYRFPEELTMAFMSCNLITGMFQRLDKLRKNAF 362

Query: 1027 ASMIIFGEEQGGAVKDQTVSGLWVFRGQDLPADMKD--CDDSLVYDWKKLDVAAD--KAI 1194
AS+I+F GA D +SG+WVFRGQDL + D D Y W+KLDV ++ K +
Sbjct: 363 ASVILF-----GANNDSCISGIWVFRGQDLAFPLSDDWQIDYESYTWRKLDVDSEECKTM 417

Query: 1195 IESFLAWEDKNGGF--AGKKFLQGKLYK 1272
++ + AWE G F GK F QGK++K
Sbjct: 418 VKEYFAWE---GEFKHVGKPFNQGKIFK 442

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 2,229,742,072
Number of extensions: 44473523
Number of successful extensions: 123778
Number of sequences better than 10.0: 882
Number of HSP's gapped: 122845
Number of HSP's successfully gapped: 956
Length of query: 444
Length of database: 1,061,185,681
Length adjustment: 132
Effective length of query: 312
Effective length of database: 629,750,545
Effective search space: 196482170040
Effective search space used: 196482170040
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.65 gvh: 0.47 alm: 0.31 top: 0.47 tms: 0.07 mit: 0.35 mip: 0.06
nuc: 0.12 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 1.00 tyr: 0.00 leu: 0.06 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 1.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 0.00

24.0 %: mitochondrial
20.0 %: endoplasmic reticulum
20.0 %: cytoplasmic
16.0 %: nuclear
4.0 %: Golgi
4.0 %: peroxisomal
4.0 %: vacuolar
4.0 %: plasma membrane
4.0 %: vesicles of secretory system

>> prediction for Contig-U16276-1 is mit

VS (DIR, S) 4
VH (FL, L) 1
VF (FL, S) 71
AH (FL, L) 0
AF (FL, S) 6
SL (DIR, L) 48
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 13
CH (FL, L) 0
CF (FL, S) 2
FCL (DIR, L) 0
FC (DIR, S) 6
FC-IC (SUB) 0