| Contig-U16219-1 |
| Contig ID |
Contig-U16219-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
2124 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
2761767 |
| End point |
2761040 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
36 |
| Number of EST |
42 |
| Link to clone list |
U16219 |
| List of clone(s) |
est1=VFN344F,1,123
est2=SSC690E,22,1440
est3=FC-AJ07F,74,700
est4=CFA206F,87,636
est5=VFN760F,123,565
est6=VFF395F,240,769
est7=VFA486E,291,1413
est8=VFF760F,295,740
est9=VSD323F,371,613
est10=VFA836E,393,1391
est11=VSD112E,572,1409
est12=VFH794Z,705,1303
est13=VHF735Z,705,1235
est14=VHK671Z,707,1300
est15=VFK704Z,708,1313
est16=VFF395Z,741,1434
est17=CFA206Z,766,1388
est18=VFN344Z,766,1263
est19=VSG429Z,774,1238
est20=FC-BK04Z,789,1437
est21=VFM471Z,805,1284
est22=VSB536Z,867,1440
est23=VSE346Z,867,1440
est24=VFF760Z,941,1234
est25=VSI185Z,944,1239
est26=VFO453Z,947,1262
est27=VFJ422Z,976,1298
est28=SLC380Z,1005,1440
est29=SLE705Z,1064,1437
est30=VFJ234Z,1140,1239
est31=VFO141Z,1141,1272
est32=SSG345E,1441,2094
est33=VSD323Z,1441,1758
est34=VSG205F,1441,1814
est35=SSC750Z,1457,2094
est36=SSA695Z,1480,2088
est37=SSJ366Z,1485,2110
est38=VSG205Z,1523,1906
est39=SSB691Z,1546,2139
est40=FC-BM04E,1615,2120
est41=SSB187Z,1615,2124
est42=SSG322Z,1706,2122
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.22 |
| Homology vs DNA |
Query= Contig-U16219-1 (Contig-U16219-1Q) /CSM_Contig/Contig-U16219-1Q.Seq.d
(2134 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AB025584) Dictyostelium discoideum DdFHb mRNA for flavohemo... 2353 0.0 1
(C85041) Dictyostelium discoideum slug cDNA, clone SSC690. 1445 0.0 2
(BJ429092) Dictyostelium discoideum cDNA clone:ddv2h10, 3' e... 1312 0.0 2
(BJ428436) Dictyostelium discoideum cDNA clone:ddv11n23, 3' ... 1257 0.0 1
(BJ410919) Dictyostelium discoideum cDNA clone:ddv2h10, 5' e... 1209 0.0 1
(BJ433503) Dictyostelium discoideum cDNA clone:ddv22h01, 3' ... 1195 0.0 1
(BJ434454) Dictyostelium discoideum cDNA clone:ddv16l23, 3' ... 1181 0.0 1
(BJ443357) Dictyostelium discoideum cDNA clone:ddv52m18, 3' ... 1170 0.0 1
(BJ428972) Dictyostelium discoideum cDNA clone:ddv1l22, 3' e... 1170 0.0 3
(BJ371702) Dictyostelium discoideum cDNA clone:ddc1k02, 3' e... 1164 0.0 2
(AU263487) Dictyostelium discoideum vegetative cDNA clone:VS... 1156 0.0 1
(AU284767) Dictyostelium discoideum gamete cDNA clone:FC-BK0... 1136 0.0 1
(AU263488) Dictyostelium discoideum vegetative cDNA clone:VS... 1128 0.0 2
(BJ439996) Dictyostelium discoideum cDNA clone:ddv42f09, 3' ... 1041 0.0 1
(BJ410286) Dictyostelium discoideum cDNA clone:ddv11n23, 5' ... 1011 0.0 2
(AU262079) Dictyostelium discoideum vegetative cDNA clone:VS... 1019 0.0 1
(C89695) Dictyostelium discoideum slug cDNA, clone SSA695. 1019 0.0 1
(C23786) Dictyostelium discoideum gamete cDNA, clone FC-AJ07. 1019 0.0 1
(BJ410801) Dictyostelium discoideum cDNA clone:ddv1l22, 5' e... 1001 0.0 1
(AU263039) Dictyostelium discoideum vegetative cDNA clone:VS... 963 0.0 1
(BJ435503) Dictyostelium discoideum cDNA clone:ddv27h11, 3' ... 952 0.0 1
(BJ358344) Dictyostelium discoideum cDNA clone:ddc1k02, 5' e... 892 0.0 1
(BJ410448) Dictyostelium discoideum cDNA clone:ddv12h15, 5' ... 870 0.0 1
(BJ434987) Dictyostelium discoideum cDNA clone:ddv25n18, 3' ... 864 0.0 1
(AU266467) Dictyostelium discoideum vegetative cDNA clone:VS... 500 0.0 2
(AU034522) Dictyostelium discoideum slug cDNA, clone SLC380. 741 0.0 1
(C25685) Dictyostelium discoideum slug cDNA, clone SSB187. 741 0.0 1
(BJ417729) Dictyostelium discoideum cDNA clone:ddv28h15, 5' ... 735 0.0 1
(AU284822) Dictyostelium discoideum gamete cDNA clone:FC-BM0... 704 0.0 2
(AU039531) Dictyostelium discoideum slug cDNA, clone SLE705. 624 e-174 1
(BJ428610) Dictyostelium discoideum cDNA clone:ddv12h15, 3' ... 565 e-156 1
(BJ436039) Dictyostelium discoideum cDNA clone:ddv29j14, 3' ... 563 e-155 1
(AU263839) Dictyostelium discoideum vegetative cDNA clone:VS... 486 e-132 1
(AU263838) Dictyostelium discoideum vegetative cDNA clone:VS... 476 e-129 1
(BJ432598) Dictyostelium discoideum cDNA clone:ddv19l06, 3' ... 460 e-124 1
(AU268287) Dictyostelium discoideum vegetative cDNA clone:VS... 262 5e-65 1
(BJ331981) Dictyostelium discoideum cDNA clone:dda37f20, 5' ... 147 1e-63 4
(L21009) Dictyostelium discoideum Rab1A mRNA, complete cds. 147 2e-63 4
(AU061016) Dictyostelium discoideum slug cDNA, clone SLC626. 147 2e-61 4
(AU270410) Dictyostelium discoideum vegetative cDNA clone:VS... 147 3e-60 4
(C93909) Dictyostelium discoideum slug cDNA, clone SSL855. 123 2e-55 4
(C93756) Dictyostelium discoideum slug cDNA, clone SSL682. 123 2e-55 4
(AU038347) Dictyostelium discoideum slug cDNA, clone SSH594. 123 2e-55 4
(BJ430080) Dictyostelium discoideum cDNA clone:ddv6c03, 3' e... 123 2e-55 4
(EC824262) SME00007547 esmbsro2 Sawyeria marylandensis cDNA,... 90 1e-50 5
(C93260) Dictyostelium discoideum slug cDNA, clone SSM886. 123 1e-49 4
(L21010) Dictyostelium discoideum Rab1B mRNA, 3' end of cds. 88 3e-49 5
(AB025583) Dictyostelium discoideum DdFHa mRNA for flavohemo... 80 1e-48 8
(BJ435982) Dictyostelium discoideum cDNA clone:ddv29a11, 3' ... 147 6e-46 2
(EE281430) SAAH-aaa93a01.g1 Agen 0058 Schmidtea mediterranea... 135 8e-45 4
(EG347207) SAAH-aaa75a09.g1 Agen 0058 Schmidtea mediterranea... 135 1e-44 4
(DN312681) PL06013B1D07 cDNA from juvenile hermaphodites Sch... 135 2e-44 4
(EG348194) SAAH-aac84f09.g1 Agen 0058 Schmidtea mediterranea... 135 3e-44 4
(EE282655) SAAH-aab11d02.g1 Agen 0058 Schmidtea mediterranea... 135 3e-44 4
(EG351240) SAAH-aad16g09.g1 Agen 0058 Schmidtea mediterranea... 135 3e-44 4
(EE672460) SAAH-aab74f01.g1 Agen 0058 Schmidtea mediterranea... 135 3e-44 4
(EE666041) SAAH-aab55g07.g1 Agen 0058 Schmidtea mediterranea... 135 3e-44 4
(EG350396) SAAH-aad11e09.g1 Agen 0058 Schmidtea mediterranea... 135 4e-44 4
(DN314465) PL06018A2F09 cDNA from juvenile hermaphodites Sch... 135 4e-44 4
(DN308618) PL05017A1F04 cDNA from sexually mature hermaphodi... 135 5e-44 4
(DN313077) PL06014B1F11 cDNA from juvenile hermaphodites Sch... 135 5e-44 4
(EE671325) SAAH-aac56f11.g1 Agen 0058 Schmidtea mediterranea... 135 5e-44 4
(DN302017) PL04024A2H01 cDNA from sexually mature hermaphodi... 135 5e-44 4
(EH011974) USDA-FP_184920 Lysiphlebus testaceipes adult whol... 98 4e-43 4
(EC819807) SME00002670 esmbsro2 Sawyeria marylandensis cDNA,... 90 4e-43 4
(AU071886) Dictyostelium discoideum slug cDNA, clone SSC690. 149 4e-43 2
(EC617428) SAAH-aaa40d06.g1 Agen 0058 Schmidtea mediterranea... 135 6e-43 4
(EC615581) SAAH-aaa66h03.g1 Agen 0058 Schmidtea mediterranea... 135 3e-42 4
(EC821471) SME00006372 esmbsro2 Sawyeria marylandensis cDNA,... 90 1e-41 4
(EC618058) SAAH-aaa63g09.g1 Agen 0058 Schmidtea mediterranea... 135 2e-40 3
(EG413517) SAAH-aab11d02.b1 Agen 0058 Schmidtea mediterranea... 135 5e-39 4
(C90802) Dictyostelium discoideum slug cDNA, clone SSJ166. 88 6e-38 4
(DN297967) PL04011A1H10 cDNA from sexually mature hermaphodi... 100 8e-37 5
(BG661470) kx02c10.y1 Parastrongyloides trichosuri IL SL1 TO... 80 1e-36 5
(EA200507) Sequence 64822 from patent US 7214786. 139 3e-36 3
(AU060180) Dictyostelium discoideum slug cDNA, clone SLA527. 80 4e-36 5
(EG409726) SAAH-aaa40d06.b1 Agen 0058 Schmidtea mediterranea... 135 7e-36 2
(EG416999) SAAH-aab55g07.b1 Agen 0058 Schmidtea mediterranea... 135 7e-36 2
(CN141376) OX1_51_D09.b1_A002 Oxidatively-stressed leaves an... 84 5e-35 6
(C92440) Dictyostelium discoideum slug cDNA, clone SSE547. 123 9e-35 3
(C93305) Dictyostelium discoideum slug cDNA, clone SSM603. 123 9e-35 3
(EG412200) SAAH-aaa93a01.b1 Agen 0058 Schmidtea mediterranea... 131 1e-34 2
(BJ432635) Dictyostelium discoideum cDNA clone:ddv19c10, 3' ... 155 8e-33 1
(BJ416950) Dictyostelium discoideum cDNA clone:ddv27j24, 5' ... 80 6e-32 5
(C23810) Dictyostelium discoideum gamete cDNA, clone FCL-AA17. 80 7e-32 3
(BJ410105) Dictyostelium discoideum cDNA clone:ddv11a08, 5' ... 80 7e-32 3
(C93700) Dictyostelium discoideum slug cDNA, clone SSL623. 101 1e-31 5
(C93361) Dictyostelium discoideum slug cDNA, clone SSM671. 88 1e-30 3
(BW635341) Dugesia ryukyuensis mRNA, clone: Dr_sW_002_B12, 5... 96 1e-29 3
(AU060942) Dictyostelium discoideum slug cDNA, clone SLC331. 88 2e-29 3
(EG017620) EST02254_0906 Sporophyte cDNA Library Porphyra ha... 105 2e-29 2
(BI517122) BB160024B10A11.5 Bee Brain Normalized Library, BB... 70 3e-29 4
(DB736345) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB746228) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB741508) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB754435) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB737308) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB729081) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB754510) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(DB728223) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-28 4
(FE254172) CAPH4918.rev CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE268619) CAZO6855.fwd CAZO Naegleria gruberi Flagellate St... 58 1e-27 6
(FE268618) CAZO6855.rev CAZO Naegleria gruberi Flagellate St... 58 1e-27 6
(EG351239) SAAH-aad16g09.b1 Agen 0058 Schmidtea mediterranea... 107 1e-27 2
(FE248780) CAPH1894.rev CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE253634) CAPH4642.rev CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE252892) CAPH4253.fwd CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE249049) CAPH2054.fwd CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE254800) CAPH524.fwd CAPH Naegleria gruberi amoeba stage N... 58 1e-27 6
(FE254799) CAPH524.rev CAPH Naegleria gruberi amoeba stage N... 58 1e-27 6
(FE254173) CAPH4918.fwd CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE264999) CAZO4201.rev CAZO Naegleria gruberi Flagellate St... 58 1e-27 6
(FE253635) CAPH4642.fwd CAPH Naegleria gruberi amoeba stage ... 58 1e-27 6
(FE259049) CAPH7478.fwd CAPH Naegleria gruberi amoeba stage ... 58 2e-27 6
(FE259048) CAPH7478.rev CAPH Naegleria gruberi amoeba stage ... 58 2e-27 6
(FE258317) CAPH7080.fwd CAPH Naegleria gruberi amoeba stage ... 58 2e-27 6
(FE258316) CAPH7080.rev CAPH Naegleria gruberi amoeba stage ... 58 2e-27 6
(FE248781) CAPH1894.fwd CAPH Naegleria gruberi amoeba stage ... 58 2e-27 6
(FE265000) CAZO4201.fwd CAZO Naegleria gruberi Flagellate St... 58 2e-27 6
(EG016891) EST00157_0906 Sporophyte cDNA Library Porphyra ha... 98 5e-27 2
(AB015237) Dictyostelium discoideum Rab1C mRNA, complete cds. 68 1e-26 3
(C84703) Dictyostelium discoideum slug cDNA, clone SSE658. 68 1e-26 3
(C94280) Dictyostelium discoideum slug cDNA, clone SSK733. 68 1e-26 3
(C90580) Dictyostelium discoideum slug cDNA, clone SSI803. 68 1e-26 3
(C93287) Dictyostelium discoideum slug cDNA, clone SSM526. 68 1e-26 3
(DR108889) USDA-FP_166149 5th-instar Anoplophora glabripenni... 58 3e-26 4
(DB746408) Apis mellifera head cDNA, RIKEN full-length enric... 70 3e-26 4
(DB731601) Apis mellifera head cDNA, RIKEN full-length enric... 70 3e-26 4
(C90430) Dictyostelium discoideum slug cDNA, clone SSI475. 123 8e-26 2
(DY889961) CeleSEQ6957 Cunninghamella elegans pBluescript (E... 46 1e-25 5
(DY894651) CeleSEQ14271 Cunninghamella elegans pBluescript (... 46 1e-25 5
(DY894599) CeleSEQ14208 Cunninghamella elegans pBluescript (... 46 1e-25 5
(AL440480) T3 end of clone BD0AA012F12 of library BD0AA from... 92 2e-25 3
(DB754480) Apis mellifera head cDNA, RIKEN full-length enric... 70 2e-25 3
(BW639370) Dugesia ryukyuensis mRNA, clone: Dr_sW_014_J13, 5... 88 6e-25 3
(C93044) Dictyostelium discoideum slug cDNA, clone SSF625. 68 8e-25 3
(BI512607) BB160009B20B06.5 Bee Brain Normalized Library, BB... 70 8e-25 3
(EG346086) SAAH-aad11e09.b1 Agen 0058 Schmidtea mediterranea... 98 1e-24 2
(BF015269) kq61g06.y1 TBN95TM-SSR Strongyloides stercoralis ... 54 2e-24 5
(BG227915) kq17b05.y1 TBN95TM-SSR Strongyloides stercoralis ... 54 2e-24 5
(BE581827) kq52h08.y1 TBN95TM-SSR Strongyloides stercoralis ... 54 2e-24 5
(BE029154) kp25e11.y1 TBN95TM-SSFH Strongyloides stercoralis... 54 3e-24 5
(BE028821) kp21g10.y1 TBN95TM-SSFH Strongyloides stercoralis... 54 3e-24 5
(BE579611) kq31d08.y1 TBN95TM-SSR Strongyloides stercoralis ... 54 3e-24 5
(BE030324) kp41e10.y1 TBN95TM-SSFH Strongyloides stercoralis... 54 3e-24 5
(AW496604) kp03c10.y1 TBN95TM-SSFH Strongyloides stercoralis... 54 3e-24 5
(BG225865) kp72g04.y1 TBN95TM-SSFH Strongyloides stercoralis... 54 3e-24 5
(AU071405) Dictyostelium discoideum slug cDNA, clone SSB423. 117 4e-24 2
(AU071406) Dictyostelium discoideum slug cDNA, clone SSB424. 117 4e-24 2
(EV222259) 0138148 Brassica napus Root - drought Brassica na... 58 2e-23 5
(EV221967) 0137216 Brassica napus Root - drought Brassica na... 58 2e-23 5
(EV221836) 0136944 Brassica napus Root - drought Brassica na... 58 2e-23 5
(EG410964) SAAH-aaa66h03.b1 Agen 0058 Schmidtea mediterranea... 92 7e-23 2
(EY213692) PRAG-aaa84b09.g1 Sand_fly_EST_Normalized Phleboto... 103 2e-22 2
(ES348794) A12_PPINFL_P31 P. papatasi adult female blood fed... 103 2e-22 2
(FC600365) CAXS12845.fwd CAXS Lottia gigantea from head, foo... 72 3e-22 4
(FC746695) CBBI2684.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 72 3e-22 4
(FC745539) CBBI1500.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 72 3e-22 4
(FC751439) CBBI5755.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 72 4e-22 4
(FE249048) CAPH2054.rev CAPH Naegleria gruberi amoeba stage ... 58 4e-22 5
(FC719068) CBBG12545.fwd CBBG Lottia gigantea 12,15,18h embr... 72 4e-22 4
(FC749958) CBBI4833.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 72 4e-22 4
(FC762795) CBBN13517.fwd CBBN Lottia gigantea 3,4,5,6.5d Lar... 72 4e-22 4
(FC782261) CBGC13600.fwd CBGC Lottia gigantea 15h 18h embryo... 72 4e-22 4
(FC730175) CBBG5833.fwd CBBG Lottia gigantea 12,15,18h embry... 72 4e-22 4
(FC791401) CBGC20961.fwd CBGC Lottia gigantea 15h 18h embryo... 72 4e-22 4
(FC743551) CBBI13770.fwd CBBI Lottia gigantea 26h,37h,61h La... 72 4e-22 4
(FC773943) CBBN8017.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 72 5e-22 4
(FC752901) CBBI6667.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 72 5e-22 4
(FC731043) CBBG6380.fwd CBBG Lottia gigantea 12,15,18h embry... 72 5e-22 4
(FC722993) CBBG15021.fwd CBBG Lottia gigantea 12,15,18h embr... 72 5e-22 4
(FC717441) CBBG11509.fwd CBBG Lottia gigantea 12,15,18h embr... 72 5e-22 4
(FC776452) CBGB461.fwd CBGB Lottia gigantea 3,6,9,12h embryo... 72 5e-22 4
(FC776451) CBGB461.rev CBGB Lottia gigantea 3,6,9,12h embryo... 72 5e-22 4
(FC750361) CBBI5087.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 72 5e-22 4
(FC769053) CBBN4810.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 72 5e-22 4
(FC775033) CBBN8719.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 72 5e-22 4
(FC593706) CAXP7735.fwd CAXP Lottia gigantea from head, foot... 72 5e-22 4
(FC586857) CAXP3871.fwd CAXP Lottia gigantea from head, foot... 72 6e-22 4
(FC558389) CAWF1697.fwd CAWF Lottia gigantea from mantle (H)... 72 6e-22 4
(FC587794) CAXP4338.fwd CAXP Lottia gigantea from head, foot... 72 6e-22 4
(FC576144) CAXP12123.fwd CAXP Lottia gigantea from head, foo... 72 6e-22 4
(FC699139) CAXX7468.fwd CAXX Lottia gigantea from male gonad... 72 6e-22 4
(DV611188) EST1214184 Glossina morsitans morsitans Fat body ... 58 1e-21 4
(DV619962) EST1222958 Glossina morsitans morsitans Fat body ... 58 1e-21 4
(DV615957) EST1218953 Glossina morsitans morsitans Fat body ... 58 1e-21 4
(DV605975) EST1208971 Glossina morsitans morsitans Fat body ... 58 1e-21 4
(DV607448) EST1210444 Glossina morsitans morsitans Fat body ... 58 1e-21 4
(DV605974) EST1208970 Glossina morsitans morsitans Fat body ... 58 1e-21 4
(BX554073) Glossina morsitans morsitans (Tseatse fly) EST fr... 58 1e-21 4
(BX568877) Glossina morsitans morsitans (Tseatse fly) EST fr... 58 1e-21 4
(BP190860) Dugesia japonica cDNA, clone: 05804_HH, expressed... 88 2e-21 2
(EA486040) Sequence 487 from patent US 7348410. 76 2e-21 3
(CS431566) Sequence 487 from Patent EP1710252. 76 2e-21 3
(BD282037) Flea head, nerve cord, hindgut and malpighian tub... 76 2e-21 3
(BF779726) 3233-45 hindgut and Malpighian tubule cDNA librar... 76 2e-21 3
(FG114352) PRAG-aab85b10.g1 Sand_fly_EST_Normalized Phleboto... 96 3e-20 2
(CV650109) F09_01tf_plate_1Os 01tf Festuca arundinacea cDNA,... 82 4e-20 3
(AI783139) BSBmL3SZ15A13SK Brugia malayi infective larva cDN... 64 1e-19 3
(DV611286) EST1214282 Glossina morsitans morsitans Fat body ... 58 2e-19 4
(AM054004) Eudiplodinium maggii EST, clone Eud_E05. 109 4e-19 1
(EY202915) PRAG-aaa86h08.g1 Sand_fly_EST_Normalized Phleboto... 92 6e-19 2
(DW089133) CLPY13252.b1_G02.ab1 CLP(XYZ) lettuce perennis La... 54 7e-19 4
(DT667352) He_wd2b1_09A11_M13R Heliconius erato wing disk 2 ... 74 7e-19 3
(BE224266) kp59a10.y1 TBN95TM-SSFH Strongyloides stercoralis... 50 9e-19 4
(EL603912) He_pwd_0127B12_M13R Heliconius erato pooled wing ... 74 1e-18 3
(EL600912) He_pwd_0219H02_M13R Heliconius erato pooled wing ... 74 1e-18 3
(BJ429793) Dictyostelium discoideum cDNA clone:ddv4l19, 3' e... 82 1e-18 3
(EL599157) He_pwd_0124H05_M13R Heliconius erato pooled wing ... 74 1e-18 3
(EL596264) He_pwd_0165A05_M13R Heliconius erato pooled wing ... 74 1e-18 3
(EL596735) He_pwd_0199E04_M13R Heliconius erato pooled wing ... 74 1e-18 3
(DT662943) He_wd2a1_80A12_M13R Heliconius erato wing disk 2 ... 74 1e-18 3
(DT665802) He_wd2a1_55D07_M13R Heliconius erato wing disk 2 ... 74 1e-18 3
(FC654811) CAXW1385.fwd CAXW Lottia gigantea from female gon... 72 2e-18 3
(DT667178) He_wd2b1_05G02_M13R Heliconius erato wing disk 2 ... 74 2e-18 3
(M34457) Dictyostelium discoideum GTP-binding protein SAS1 g... 80 3e-18 4
(C91481) Dictyostelium discoideum slug cDNA, clone SSK334. 80 3e-18 4
(AU037978) Dictyostelium discoideum slug cDNA, clone SSH118. 80 3e-18 4
(BM165448) EST567971 PyBS Plasmodium yoelii yoelii cDNA clon... 64 3e-18 2
(BJ343136) Dictyostelium discoideum cDNA clone:dda22k04, 3' ... 80 5e-18 3
(BJ414563) Dictyostelium discoideum cDNA clone:ddv19j13, 5' ... 80 6e-18 3
(BJ347346) Dictyostelium discoideum cDNA clone:dda26h20, 3' ... 80 8e-18 3
(BJ434188) Dictyostelium discoideum cDNA clone:ddv16l01, 3' ... 80 9e-18 3
(BJ328400) Dictyostelium discoideum cDNA clone:dda28e03, 5' ... 80 1e-17 3
(BJ412726) Dictyostelium discoideum cDNA clone:ddv9j18, 5' e... 80 1e-17 3
(BJ415110) Dictyostelium discoideum cDNA clone:ddv21o12, 5' ... 80 1e-17 3
(BJ327500) Dictyostelium discoideum cDNA clone:dda20m14, 5' ... 80 1e-17 3
(AU073079) Dictyostelium discoideum slug cDNA, clone SSF883. 66 3e-17 3
(BX538352) Cryptosporidium parvum chromosome 6, complete seq... 94 5e-17 2
(FG542079) OtP016C01_020107e Onthophagus taurus pupal librar... 70 5e-17 2
(FG540972) OtP003E02_011907d Onthophagus taurus pupal librar... 70 5e-17 2
(FG541220) OtP006C03_012207d Onthophagus taurus pupal librar... 70 5e-17 2
(FG541351) OtP007G08_012507d Onthophagus taurus pupal librar... 70 5e-17 2
(FG541895) OtP014B08_013107e Onthophagus taurus pupal librar... 70 5e-17 2
(AQ254251) CpG0727A CpIOWAgDNA1 Cryptosporidium parvum genom... 94 5e-17 2
(CX094135) EHAFU88TR E. histolytica Normalized cDNA library ... 88 7e-17 2
(CX093712) EHAFO92TR E. histolytica Normalized cDNA library ... 88 7e-17 2
(CX083995) EHABK22TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(DB751111) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-16 3
(DB734523) Apis mellifera head cDNA, RIKEN full-length enric... 70 1e-16 3
(CX096754) EHAGW91TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX095550) EHAGF29TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX089606) EHAE145TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX087978) EHAD958TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX087205) EHACW03TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX087006) EHACT15TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX083514) EHABC79TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX083384) EHABA95TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX096532) EHAGT80TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX094558) EHAG093TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX089578) EHAE104TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX089231) EHADU91TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX089049) EHADR49TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX093218) EHAFH94TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX098528) EHAHN04TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX089366) EHADX32TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX099079) EHAHU93TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX099390) EHAHZ58TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX085209) EHAC232TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX087202) EHACV95TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX082060) EHAAR08TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX091347) EHAER18TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX089538) EHAE015TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX086526) EHACL32TRB E. histolytica Normalized cDNA library... 88 1e-16 2
(CX085802) EHACA63TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(AB054578) Entamoeba histolytica EhRab1A mRNA for small GTPa... 88 1e-16 2
(CX085623) EHAC819TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(CX087103) EHACU61TR E. histolytica Normalized cDNA library ... 88 1e-16 2
(BJ402782) Dictyostelium discoideum cDNA clone:dds18c10, 3' ... 74 3e-16 3
(BJ397989) Dictyostelium discoideum cDNA clone:dds10d18, 3' ... 74 3e-16 3
(U02926) Dictyostelium discoideum Ax3 Rab2 mRNA, partial cds. 66 2e-15 2
(EB454766) 1099341333909 12-DrosW-std-1P6Kb Drosophila willi... 52 2e-15 5
(EB485357) 1099288469394 12-DrosW-norm-1P5Kb Drosophila will... 52 3e-15 5
(AY324135) Babesia bovis Rab1b mRNA, complete cds. 80 3e-15 2
(EL355840) CCEM12424.b1_P09.ab1 CCE(LMS) endive Cichorium en... 64 3e-15 3
(DV614314) EST1217310 Glossina morsitans morsitans Fat body ... 56 5e-15 3
(FG542174) OtP017C03_020207c Onthophagus taurus pupal librar... 70 1e-14 2
(EB501567) 1099435333319 12-DrosW-norm-1P5Kb Drosophila will... 52 2e-14 4
(CX091910) EHAEZ32TR E. histolytica Normalized cDNA library ... 80 2e-14 2
(EB498428) 1099435220840 12-DrosW-norm-1P5Kb Drosophila will... 54 3e-14 4
(FF455784) G178P60200RF9.T0 Acorn worm gastrula/neurula pCMV... 50 3e-14 3
(FF453379) G178P60166RA10.T0 Acorn worm gastrula/neurula pCM... 50 3e-14 3
(FF436463) G142P60204RD10.T0 Acorn worm juvenile pCMVSport6 ... 50 3e-14 3
(FF429418) G142P60105RE9.T0 Acorn worm juvenile pCMVSport6 l... 50 3e-14 3
(FF470951) G613P6066RC11.T0 Acorn worm blastula/gastrula pCM... 50 3e-14 3
(FF446253) G178P60071RA4.T0 Acorn worm gastrula/neurula pCMV... 50 4e-14 3
(FF438793) G142P60239RB12.T0 Acorn worm juvenile pCMVSport6 ... 50 4e-14 3
(FF466669) G50P6318RA10.T0 Acorn worm gastrula/neurula pCMVS... 50 4e-14 3
(FF434492) G142P60179RF10.T0 Acorn worm juvenile pCMVSport6 ... 50 4e-14 3
(FF431656) G142P60136RF7.T0 Acorn worm juvenile pCMVSport6 l... 50 4e-14 3
(FF429836) G142P60111RD6.T0 Acorn worm juvenile pCMVSport6 l... 50 4e-14 3
(FF440383) G142P60264RG12.T0 Acorn worm juvenile pCMVSport6 ... 50 4e-14 3
(FF432285) G142P60145RF3.T0 Acorn worm juvenile pCMVSport6 l... 50 4e-14 3
(FF430299) G142P60117RB11.T0 Acorn worm juvenile pCMVSport6 ... 50 4e-14 3
(AU051903) Dictyostelium discoideum slug cDNA, clone SSC355. 52 5e-14 5
(EY526965) CAPF4222.rev CAPF Capitella sp. I ECS-2004 whole ... 72 5e-14 3
(CB240449) PopSC00433 Poplar SC cDNA library Populus alba x ... 74 8e-14 3
(AU261752) Dictyostelium discoideum vegetative cDNA clone:VS... 44 9e-14 5
(BJ428239) Dictyostelium discoideum cDNA clone:ddv11a08, 3' ... 44 1e-13 5
(AU052174) Dictyostelium discoideum slug cDNA, clone SLA171. 44 1e-13 5
(AU261452) Dictyostelium discoideum vegetative cDNA clone:VS... 44 2e-13 5
(DB892555) Populus nigra mRNA, clone: PnFL2-101_J04, 5'end. 74 2e-13 3
(CZ535497) SRAA-aac97e12.g1 Strongyloides ratti whole genome... 70 2e-13 2
(CZ535650) SRAA-aac98e12.g1 Strongyloides ratti whole genome... 70 2e-13 2
(CZ545429) SRAA-aad61g07.g1 Strongyloides ratti whole genome... 70 2e-13 2
(CX658065) PO01008H07 Poplar SC cDNA library Populus alba x ... 74 2e-13 3
(BU892724) P068F02 Populus petioles cDNA library Populus tre... 74 2e-13 3
(EB502510) 1099476361079 12-DrosW-norm-1P5Kb Drosophila will... 52 2e-13 4
(CF235600) PtaJXT0024G3G0313 Poplar cDNA library from young ... 74 2e-13 3
(EB485313) 1099288469171 12-DrosW-norm-1P5Kb Drosophila will... 52 2e-13 4
(EB454712) 1099341320890 12-DrosW-std-1P6Kb Drosophila willi... 52 2e-13 4
(EB497961) 1099435218645 12-DrosW-norm-1P5Kb Drosophila will... 52 3e-13 4
(CV245992) WS0259.B21_O24 PT-MB-N-A-15 Populus trichocarpa c... 74 3e-13 3
(DT523466) WS02039.B21_M09 PTxN-IB-N-A-11 Populus trichocarp... 74 3e-13 3
(DT508904) WS02422.BR_E03 PTxD-ICC-N-A-14 Populus trichocarp... 74 3e-13 3
(BE331049) so93e09.y1 Gm-c1041 Glycine max cDNA clone GENOME... 50 3e-13 4
(EB458024) 1099341542629 12-DrosW-std-1P6Kb Drosophila willi... 52 3e-13 4
(BP191197) Dugesia japonica cDNA, clone: 06895_HH, expressed... 80 3e-13 2
(DT518312) WS02436.B21_M18 PTxD-ICC-N-A-14 Populus trichocar... 74 3e-13 3
(CV130827) X9SP05e10 Populus stem seasonal library Populus d... 74 3e-13 3
(DT513512) WS02422.B21_E03 PTxD-ICC-N-A-14 Populus trichocar... 74 3e-13 3
(DT518131) WS02436.B21_E12 PTxD-ICC-N-A-14 Populus trichocar... 74 3e-13 3
(DT520276) WS02447.B21_B14 PTxD-ICC-N-A-14 Populus trichocar... 74 3e-13 3
(EB456325) 1099341391033 12-DrosW-std-1P6Kb Drosophila willi... 52 3e-13 4
(AU264125) Dictyostelium discoideum vegetative cDNA clone:VS... 42 4e-13 5
(DY806949) CTOX15120.b1_P11.ab1 CTO(XYZ) dandelion Taraxacum... 58 4e-13 2
(DY824676) CTOY16290.b1_D17.ab1 CTO(XYZ) dandelion Taraxacum... 58 5e-13 2
(AU037268) Dictyostelium discoideum slug cDNA, clone SSB691. 58 5e-13 3
(FG990779) GLLD910TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 50 5e-13 4
(CA799953) sat64g10.y1 Gm-c1056 Glycine soja cDNA clone SOYB... 50 6e-13 4
(DV500964) He_wd2a1_61C04_M13R Heliconius erato wing disk 2 ... 54 6e-13 3
(BU885863) R037C07 Populus root cDNA library Populus tremula... 74 1e-12 2
(BI127503) G061P58Y Populus cambium cDNA library Populus tre... 74 1e-12 2
(CB239752) RSH16C01 two-month-old roots from clone 'Beaupre'... 74 1e-12 2
(BU829055) K033P82P Populus apical shoot cDNA library Populu... 74 1e-12 2
(BG838245) Gc01_10g12_R Gc01_AAFC_ECORC_cold_stressed_Glycin... 50 1e-12 4
(CN518320) GQ0094.B3_K05 GQ009 Populus trichocarpa x Populus... 74 1e-12 2
(BU828462) K023P51P Populus apical shoot cDNA library Populu... 74 1e-12 2
(CK103808) G133P57.5pR Populus tension wood cDNA library Pop... 74 1e-12 2
(CX654284) PO02017A09 Poplar SC cDNA library Populus alba x ... 74 1e-12 2
(CX184474) G06_45-14_14.ab1 leaf inoculated with Marssonia p... 74 1e-12 2
(AJ409198) Plasmodium falciparum mRNA for putative GTPase (r... 62 1e-12 2
(CX096630) EHAGV28TR E. histolytica Normalized cDNA library ... 88 2e-12 1
(BP504686) Hydra magnipapillata cDNA, clone:hm_02110. 80 2e-12 3
(EF070546) Maconellicoccus hirsutus clone WHMH3840 putative ... 80 2e-12 3
(CA302020) taa09b02.y1 Hydra cDNA library Hydra magnipapilla... 80 2e-12 3
(DN244570) ACAD-aab41e09.g1 Hydra_EST_UCI-8 Hydra magnipapil... 80 2e-12 3
(EB491863) 1099341406766 12-DrosW-norm-1P5Kb Drosophila will... 54 2e-12 3
(EH213073) USDA-FP_175861 WHMH (pink hibiscus mealybug) Maco... 80 2e-12 3
(DT607268) ACAG-aaa33g11.g1 Hydra_EST_UCI-9 Hydra magnipapil... 80 2e-12 3
(DN816628) ACAC-aac45o05.g1 Hydra EST UCI 7 Hydra magnipapil... 80 2e-12 3
(EB492867) 1099341489740 12-DrosW-norm-1P5Kb Drosophila will... 52 3e-12 3
(BJ359917) Dictyostelium discoideum cDNA clone:ddc3a07, 5' e... 62 4e-12 3
(AU263986) Dictyostelium discoideum vegetative cDNA clone:VS... 82 4e-12 2
(AU264263) Dictyostelium discoideum vegetative cDNA clone:VS... 82 4e-12 2
(EB494285) 1099435179131 12-DrosW-norm-1P5Kb Drosophila will... 52 4e-12 3
(DW113074) CLRY1165.b1_I03.ab1 CLR(XYZ) lettuce serriola Lac... 58 4e-12 3
(AU038248) Dictyostelium discoideum slug cDNA, clone SSH468. 82 5e-12 2
(C93969) Dictyostelium discoideum slug cDNA, clone SSC869. 82 5e-12 2
(BG227442) kq07b02.y1 TBN95TM-SSR Strongyloides stercoralis ... 54 5e-12 3
(EL361439) CCEM6066.b1_D06.ab1 CCE(LMS) endive Cichorium end... 50 5e-12 5
(C93090) Dictyostelium discoideum slug cDNA, clone SSF791. 82 5e-12 2
(EC755914) PPE00011196 Agencourt Biosciences Agen-0020 Non-n... 80 7e-12 3
(DY658473) SC_CP_10_A09 SC_CP Senecio cambrensis cDNA 5', mR... 46 8e-12 5
(FD644666) MF1_17_A02.b2_F001 Limnanthes alba EST Library MF... 46 9e-12 3
(DV463593) MTUNUL1.P17.H11 NUL Populus fremontii x Populus a... 74 9e-12 3
(BI974614) sai70g11.y1 Gm-c1068 Glycine max cDNA clone GENOM... 50 1e-11 4
(AW760498) sl51b01.y1 Gm-c1027 Glycine max cDNA clone GENOME... 50 1e-11 4
(BW637752) Dugesia ryukyuensis mRNA, clone: Dr_sW_009_H12, 5... 56 1e-11 3
(M34456) Dictyostelium discoideum GTP-binding protein SAS2 m... 64 1e-11 5
(BI425805) sah72f05.y1 Gm-c1049 Glycine max cDNA clone GENOM... 50 1e-11 4
(BE023346) sm70g01.y1 Gm-c1028 Glycine max cDNA clone GENOME... 50 1e-11 3
(BF068879) st04b01.y1 Gm-c1065 Glycine max cDNA clone GENOME... 50 1e-11 4
(BI425913) sah73h06.y1 Gm-c1049 Glycine max cDNA clone GENOM... 50 1e-11 4
(FE252891) CAPH4253.rev CAPH Naegleria gruberi amoeba stage ... 54 1e-11 3
(CA800814) sat25c03.y1 Gm-c1056 Glycine soja cDNA clone SOYB... 50 1e-11 4
(BM568233) sal01g08.y1 Gm-c1057 Glycine soja cDNA clone SOYB... 50 1e-11 4
(AW397121) sg67b08.y1 Gm-c1007 Glycine max cDNA clone GENOME... 50 2e-11 3
(CA283671) SCSBSD1057H07.g SD1 Saccharum officinarum cDNA cl... 46 2e-11 3
(FG539665) OtL008G09_121306d Onthophagus taurus larval libra... 70 2e-11 2
(BG047357) saa83d10.y1 Gm-c1063 Glycine max cDNA clone GENOM... 50 2e-11 3
(BM885070) sal94e07.y1 Gm-c1063 Glycine max cDNA clone SOYBE... 50 2e-11 3
(AJ805249) Antirrhinum majus EST, clone 018_5_12_f16. 46 2e-11 5
(AU270190) Dictyostelium discoideum vegetative cDNA clone:VS... 80 2e-11 3
(BM092508) sah14f08.y3 Gm-c1086 Glycine max cDNA clone GENOM... 50 2e-11 3
(EE658925) CHES3527.b1_M17.ab1 CHE(LMS) serpentine sunflower... 44 2e-11 4
(CA783999) sat92b01.y1 Gm-c1062 Glycine max cDNA clone SOYBE... 50 2e-11 4
(FG542297) OtP018F10_020207d Onthophagus taurus pupal librar... 70 2e-11 2
(BE661071) 487 GmaxSC Glycine max cDNA, mRNA sequence. 50 2e-11 4
(CX082008) EHAAQ33TR E. histolytica Normalized cDNA library ... 70 2e-11 2
(FG988190) GLLCE70TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 50 2e-11 4
(C89776) Dictyostelium discoideum slug cDNA, clone SSG832. 80 3e-11 3
(FK019691) GLNDD36TF JCVI-SOY3 Glycine max cDNA 5', mRNA seq... 50 3e-11 4
(AU037253) Dictyostelium discoideum slug cDNA, clone SSB671. 80 3e-11 3
(BJ439952) Dictyostelium discoideum cDNA clone:ddv42m04, 3' ... 44 3e-11 4
(CA783639) sat51b09.y1 Gm-c1056 Glycine soja cDNA clone SOYB... 50 3e-11 4
(DW089374) CLPY13475.b1_E09.ab1 CLP(XYZ) lettuce perennis La... 50 3e-11 4
(AJ774565) Populus euphratica EST, clone P0000300021H01F1. 66 3e-11 3
(CA783453) sat48d07.y1 Gm-c1056 Glycine soja cDNA clone SOYB... 50 3e-11 4
(BE657372) GM700001B20A10 Gm-r1070 Glycine max cDNA clone Gm... 50 3e-11 3
(CN628809) tae96c10.y1 Hydra EST Darmstadt I Hydra magnipapi... 80 4e-11 2
(DW089785) CLPY13853.b1_I07.ab1 CLP(XYZ) lettuce perennis La... 54 4e-11 4
(BU894535) X010H02 Populus wood cDNA library Populus tremula... 66 4e-11 3
(DW094549) CLPY5704.b1_P10.ab1 CLP(XYZ) lettuce perennis Lac... 54 4e-11 4
(AJ794345) Antirrhinum majus EST, clone 018_3_04_p22. 46 4e-11 5
(EH676262) CCIL1406.b1_K16.ab1 CCI(LMS) chicory Cichorium in... 64 4e-11 3
(AJ792676) Antirrhinum majus EST, clone 018_2_12_e09. 46 5e-11 5
(AJ792682) Antirrhinum majus EST, clone 018_2_12_e15. 46 5e-11 5
(EH687489) CCIM12233.b1_B12.ab1 CCI(LMS) chicory Cichorium i... 64 5e-11 3
(EH689052) CCIM13663.b1_M08.ab1 CCI(LMS) chicory Cichorium i... 64 5e-11 3
(CV261602) WS02017.B21_D20 PTxN-IB-N-A-11 Populus trichocarp... 66 5e-11 3
(CO509829) tai58e03.y1 Hydra EST UCI 5 ALP Hydra magnipapill... 80 6e-11 2
(X72688) L.stagnalis LS-rab1 mRNA. 48 6e-11 3
(CV542526) RTS_121_E10 Phaseolus vulgaris P- root EST librar... 52 6e-11 4
(CN635937) 124F08_546145 Douglas-fir cDNA library PmIFG_73-6... 46 6e-11 3
(C89790) Dictyostelium discoideum slug cDNA, clone SSG849. 66 7e-11 2
(BJ432827) Dictyostelium discoideum cDNA clone:ddv20a02, 3' ... 44 7e-11 4
(C92753) Dictyostelium discoideum slug cDNA, clone SSF195. 66 8e-11 2
(EY513033) CAPF11110.fwd CAPF Capitella sp. I ECS-2004 whole... 72 8e-11 2
(EY513032) CAPF11110.rev CAPF Capitella sp. I ECS-2004 whole... 72 8e-11 2
(DW277785) UI-S-HH0-add-k-04-0-UI.s1 UI-S-HH0 Euprymna scolo... 72 8e-11 2
(DW278328) UI-S-HH0-adh-i-19-0-UI.s1 UI-S-HH0 Euprymna scolo... 72 9e-11 2
(DW261255) UI-S-GG1-abe-i-21-0-UI.s1 UI-S-GG1 Euprymna scolo... 72 9e-11 2
(FF427326) G142P60074RE8.T0 Acorn worm juvenile pCMVSport6 l... 46 9e-11 3
(EB454853) 1099341335637 12-DrosW-std-1P6Kb Drosophila willi... 46 9e-11 3
(DW261429) UI-S-GG1-abe-j-21-0-UI.s1 UI-S-GG1 Euprymna scolo... 72 9e-11 2
(EY526966) CAPF4222.fwd CAPF Capitella sp. I ECS-2004 whole ... 72 1e-10 2
(DY827204) CTOY2879.b1_N23.ab1 CTO(XYZ) dandelion Taraxacum ... 58 1e-10 2
(EY526247) CAPF3825.fwd CAPF Capitella sp. I ECS-2004 whole ... 72 1e-10 2
(AU264264) Dictyostelium discoideum vegetative cDNA clone:VS... 82 1e-10 1
(C24651) Dictyostelium discoideum slug cDNA, clone SL-X053. 82 1e-10 1
(BJ432673) Dictyostelium discoideum cDNA clone:ddv19l07, 3' ... 82 1e-10 1
(DN289460) PL030001A10C08 cDNA from sexually mature hermapho... 74 1e-10 3
(DN291505) PL030007B10D03 cDNA from sexually mature hermapho... 74 1e-10 3
(DN298115) PL04011B2A03 cDNA from sexually mature hermaphodi... 74 1e-10 3
(BJ433900) Dictyostelium discoideum cDNA clone:ddv23d10, 3' ... 44 1e-10 4
(DN306154) PL05010B1C04 cDNA from sexually mature hermaphodi... 74 1e-10 3
(DN291494) PL030007B10B12 cDNA from sexually mature hermapho... 74 1e-10 3
(EH431849) NPE00000671 Neocallimastix patriciarum ZAP II cDN... 52 1e-10 3
(EE672448) SAAH-aab74d12.g1 Agen 0058 Schmidtea mediterranea... 74 1e-10 3
(BJ430109) Dictyostelium discoideum cDNA clone:ddv6j02, 3' e... 44 1e-10 4
(FG087575) CMRC-FF-IH0-ach-h-13-0-CMRC.r1 Ceratitis capitata... 56 1e-10 2
(BJ430327) Dictyostelium discoideum cDNA clone:ddv6i24, 3' e... 44 1e-10 4
(CA756042) BR030033000_PLATE_H01_8_014.ab1 OA Oryza sativa J... 64 1e-10 2
(BJ435811) Dictyostelium discoideum cDNA clone:ddv28b13, 3' ... 44 1e-10 4
(BJ433862) Dictyostelium discoideum cDNA clone:ddv23m04, 3' ... 44 1e-10 4
(EG349745) SAAH-aad07a01.g1 Agen 0058 Schmidtea mediterranea... 74 1e-10 3
(EE667023) SAAH-aab91a02.g1 Agen 0058 Schmidtea mediterranea... 74 1e-10 3
(BJ416800) Dictyostelium discoideum cDNA clone:ddv27h11, 5' ... 60 1e-10 2
(AU269072) Dictyostelium discoideum vegetative cDNA clone:VS... 44 1e-10 4
(DN311098) PL06009A2A08 cDNA from juvenile hermaphodites Sch... 74 1e-10 3
(BJ432176) Dictyostelium discoideum cDNA clone:ddv17m21, 3' ... 44 2e-10 4
(BJ433412) Dictyostelium discoideum cDNA clone:ddv21d20, 3' ... 44 2e-10 4
(BJ346793) Dictyostelium discoideum cDNA clone:dda25f06, 3' ... 44 2e-10 4
(BJ435706) Dictyostelium discoideum cDNA clone:ddv27p24, 3' ... 44 2e-10 4
(BB908253) Trifolium pratense cDNA clone:RCE06834. 42 2e-10 4
(DN310577) PL06007B2C12 cDNA from juvenile hermaphodites Sch... 74 2e-10 3
(DY826724) CTOY2339.b1_E09.ab1 CTO(XYZ) dandelion Taraxacum ... 62 2e-10 3
(BJ432787) Dictyostelium discoideum cDNA clone:ddv19e23, 3' ... 44 2e-10 4
(BJ435366) Dictyostelium discoideum cDNA clone:ddv26l23, 3' ... 44 2e-10 4
(BB916883) Trifolium pratense cDNA clone:RCE22373. 42 2e-10 4
(BB905089) Trifolium pratense cDNA clone:RCE03121. 42 2e-10 4
(DN313825) PL06016B1G06 cDNA from juvenile hermaphodites Sch... 74 2e-10 3
(BB923352) Trifolium pratense cDNA clone:RCE30918. 42 2e-10 4
(BB920532) Trifolium pratense cDNA clone:RCE26581. 42 2e-10 4
(DN310033) PL06006A2D04 cDNA from juvenile hermaphodites Sch... 74 2e-10 3
(AJ775307) Populus euphratica EST, clone P0000300030G07F1. 66 2e-10 2
(BU496114) PfESToac04a09.y1 Plasmodium falciparum 3D7 asexua... 54 2e-10 2
(BJ432255) Dictyostelium discoideum cDNA clone:ddv18l05, 3' ... 44 2e-10 4
(AU264124) Dictyostelium discoideum vegetative cDNA clone:VS... 44 2e-10 4
(BJ435390) Dictyostelium discoideum cDNA clone:ddv27a03, 3' ... 44 2e-10 4
(AU267101) Dictyostelium discoideum vegetative cDNA clone:VS... 44 2e-10 4
(AU061041) Dictyostelium discoideum slug cDNA, clone SLC715. 44 2e-10 4
(BJ435680) Dictyostelium discoideum cDNA clone:ddv27j24, 3' ... 44 2e-10 4
(BJ345037) Dictyostelium discoideum cDNA clone:dda21k10, 3' ... 44 2e-10 4
(FG093523) s13dLA68E07RT028_529817 Lupinus albus L. (white l... 42 2e-10 4
(BJ434077) Dictyostelium discoideum cDNA clone:ddv23g21, 3' ... 44 2e-10 4
(BJ432315) Dictyostelium discoideum cDNA clone:ddv18h07, 3' ... 44 2e-10 4
(BJ347419) Dictyostelium discoideum cDNA clone:dda27e05, 3' ... 44 2e-10 4
(BU830783) T013B03 Populus apical shoot cDNA library Populus... 66 2e-10 2
(BJ432710) Dictyostelium discoideum cDNA clone:ddv19c14, 3' ... 44 2e-10 4
(BM274623) PfESToaa48c09.y1 Plasmodium falciparum 3D7 gameto... 54 3e-10 2
(EL409825) CFFS7438.b1_L11.ab1 CFF(LMS) safflower Carthamus ... 42 3e-10 5
(BJ347087) Dictyostelium discoideum cDNA clone:dda26g02, 3' ... 44 3e-10 4
(BM274795) PfESToaa75a07.y1 Plasmodium falciparum 3D7 gameto... 54 3e-10 2
(BU495713) PfESToab76f12.y1 Plasmodium falciparum 3D7 asexua... 54 3e-10 2
(CA855937) PfESToac51g08.y1 Plasmodium falciparum 3D7 gameto... 54 3e-10 2
(BM276497) PfESToaa84b06.y1 Plasmodium falciparum 3D7 gameto... 54 3e-10 2
(AF201953) Plasmodium falciparum isolate FCC1/HN Rab1 protei... 54 3e-10 2
(DT668940) He_wd2a1_18E10_M13R Heliconius erato wing disk 2 ... 52 3e-10 3
(EC823968) SME00004112 esmbsro2 Sawyeria marylandensis cDNA,... 66 3e-10 3
(EY526246) CAPF3825.rev CAPF Capitella sp. I ECS-2004 whole ... 70 3e-10 2
(GE304875) OXAY-aaa64d09.g1 Oxytricha_pSMART_OXAY Sterkiella... 56 3e-10 2
(AJ237914) Plasmodium falciparum putative rab1A gene. 54 4e-10 2
(CX082834) EHAB260TR E. histolytica Normalized cDNA library ... 80 4e-10 1
(EH733573) CNMM6382.b1_K12.ab1 CNM(LMS) spotted knapweed Cen... 42 4e-10 4
(EH725171) CNMM11599.b1_M19.ab1 CNM(LMS) spotted knapweed Ce... 42 4e-10 4
(U41269) Plasmodium falciparum Rab1 protein (PfRab1) gene, c... 54 5e-10 2
(CN584962) USDA-FP_128031 Acyrthosiphon pisum, Pea Aphid Acy... 48 5e-10 3
(CN756496) ID0AAA18DE04RM1 ApMS Acyrthosiphon pisum cDNA clo... 48 5e-10 3
>(AB025584) Dictyostelium discoideum DdFHb mRNA for flavohemoglobin,
complete cds.
Length = 1665
Score = 2353 bits (1187), Expect = 0.0
Identities = 1190/1191 (99%)
Strand = Plus / Plus
Query: 187 ctgtaccacttttggagaaatatggagttgagatcactagcctcttctataagaatatgt 246
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 166 ctgtaccacttttggagaaatatggagttgagatcactagcctcttctataagaatatgt 225
Query: 247 ttgaagcacaaccacaatttttaaatatattcaatcattcaaatcaaagaaatcagaaac 306
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 226 ttgaagcacaaccacaatttttaaatatattcaatcattcaaatcaaagaaatcagaaac 285
Query: 307 aaccggtggctttggccaatacaattttacaatctgcaattcatattgaaaaattaaatg 366
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 286 aaccggtggctttggccaatacaattttacaatctgcaattcatattgaaaaattaaatg 345
Query: 367 aaatcaatttaatgccaatcgttcataaacacgttgcattaggtattacacctgaaatgt 426
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 346 aaatcaatttaatgccaatcgttcataaacacgttgcattaggtattacacctgaaatgt 405
Query: 427 atccaattgttggtgctcatttattgggtgctatgaaaactgtaatgcaagatgaagcaa 486
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 406 atccaattgttggtgctcatttattgggtgctatgaaaactgtaatgcaagatgaagcaa 465
Query: 487 ctcctgaaattatggctgcatggactgaggcatatagagcagttgcacaagcatttatgg 546
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 466 ctcctgaaattatggctgcatggactgaggcatatagagcagttgcacaagcatttatgg 525
Query: 547 atgcagaagaagatttatactttgagactgaggaacaaattggtggttggaaagatacga 606
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 526 atgcagaagaagatttatactttgagactgaggaacaaattggtggttggaaagatacga 585
Query: 607 gagagtttgtagttgatagaattgaagaagagacaccattaattaaatcattttacttta 666
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 586 gagagtttgtagttgatagaattgaagaagagacaccattaattaaatcattttacttta 645
Query: 667 aagcatatgatggtaaagagatagctacttatattcctggacaatatattactgtaaaga 726
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 646 aagcatatgatggtaaagagatagctacttatattcctggacaatatattactgtaaaga 705
Query: 727 ttacattaccgggtgatggtgttgatgtaccaactgataagatgagaacttatgtcagac 786
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 706 ttacattaccgggtgatggtgttgatgtaccaactgataagatgagaacttatgtcagac 765
Query: 787 attacagtttatcagataaaccaaatgatgaatactatcgtatttcaataaagaaagaac 846
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 766 attacagtttatcagataaaccaaatgatgaatactatcgtatttcaataaagaaagaac 825
Query: 847 tcggtaagaatacaccaaatggtatagtatcaaatcattttcataataatattaaagtgg 906
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 826 tcggtaagaatacaccaaatggtatagtatcaaatcattttcataataatattaaagtgg 885
Query: 907 gtgatgtagtaccaatgtcggtcccagcaggcgatttcgtggtaaataacgattctgaga 966
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 886 gtgatgtagtaccaatgtcggtcccagcaggcgatttcgtggtaaataacgattctgaga 945
Query: 967 ctccaatccttttaatttgtggtggtgttggtattaacccgttatttagtatgcttaaag 1026
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 946 ctccaatccttttaatttgtggtggtgttggtattaacccgttatttagtatgcttaaag 1005
Query: 1027 agacattggtccaacaaccagatagaaaaataaatttcattttctcaactcattgcgaat 1086
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1006 agacattggtccaacaaccagatagaaaaataaatttcattttctcaactcattgcgaat 1065
Query: 1087 caagtcaaccatttaaagaggaacttaaacaattggaagacgattataaagaaactggta 1146
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1066 caagtcaaccatttaaagaggaacttaaacaattggaagacgattataaagaaactggta 1125
Query: 1147 atcttaaaatcaatttagtatactctgaaaatcaaggtcatatcaataaagaaatcattg 1206
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1126 atcttaaaatcaatttagtatactctgaaaatcaaggtcatatcaataaagaaatcattg 1185
Query: 1207 aaaaatattcaactcaacatgttgatcaagctgaaatcgctgaaaccgacgtttacattt 1266
||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||
Sbjct: 1186 aaaaatattcaactcaacatgttgatcaagctgaaatcgatgaaaccgacgtttacattt 1245
Query: 1267 gtggtcctgtaccttttatgatgcaagttaacaaagatttattacaattaggtttccata 1326
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1246 gtggtcctgtaccttttatgatgcaagttaacaaagatttattacaattaggtttccata 1305
Query: 1327 aagaaaatgtacattatgaattatttggtccattaactccagtcctcgaag 1377
|||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1306 aagaaaatgtacattatgaattatttggtccattaactccagtcctcgaag 1356
Score = 65.9 bits (33), Expect = 6e-06
Identities = 33/33 (100%)
Strand = Plus / Plus
Query: 42 aaaaactttatattcaaaaagaatcttaaaatc 74
|||||||||||||||||||||||||||||||||
Sbjct: 21 aaaaactttatattcaaaaagaatcttaaaatc 53
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 2,366,711,957
Number of extensions: 146677538
Number of successful extensions: 12687913
Number of sequences better than 10.0: 4867
Length of query: 2134
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 2110
Effective length of database: 96,409,374,237
Effective search space: 203423779640070
Effective search space used: 203423779640070
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 7.21 |
| Homology vs Protein |
Query= Contig-U16219-1 (Contig-U16219-1Q) /CSM_Contig/Contig-U16219-1Q.Seq.d
(2134 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB025584_1(AB025584|pid:none) Dictyostelium discoideum DdFHb mRN... 841 0.0
CP001186_1337(CP001186|pid:none) Bacillus cereus G9842, complete... 336 2e-90
CP001407_1354(CP001407|pid:none) Bacillus cereus 03BB102, comple... 335 4e-90
(Q6HLA6) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 335 5e-90
CP000903_1350(CP000903|pid:none) Bacillus weihenstephanensis KBA... 334 7e-90
(Q73B49) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 333 2e-89
CP000485_1227(CP000485|pid:none) Bacillus thuringiensis str. Al ... 333 2e-89
(Q81T23) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 332 3e-89
(Q81FW4) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 332 3e-89
CP001176_1375(CP001176|pid:none) Bacillus cereus B4264, complete... 332 4e-89
CP000764_1120(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 317 9e-85
AP006627_349(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 315 4e-84
BA000043_1737(BA000043|pid:none) Geobacillus kaustophilus HTA426... 315 6e-84
AP008955_1144(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 314 9e-84
CP000817_4223(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 309 2e-82
(Q9RC40) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 305 4e-81
CP000560_2581(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 298 5e-79
AE017333_923(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 285 5e-75
(Q7WUM8) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 281 7e-74
AF013572_1(AF013572|pid:none) Bombyx mori small GTP-binding prot... 278 6e-73
AY328026_1(AY328026|pid:none) Sinorhizobium meliloti strain FC1 ... 278 7e-73
CP000388_3441(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 277 1e-72
(Q01890) RecName: Full=Ras-like GTP-binding protein YPT1; &JC53... 276 3e-72
S06147(S06147;S03189)GTP-binding protein rab1B - rat 276 3e-72
AE014297_3082(AE014297|pid:none) Drosophila melanogaster chromos... 276 3e-72
(Q39571) RecName: Full=GTP-binding protein YPTC1; &DQ222936_1(D... 275 4e-72
(Q2HJH2) RecName: Full=Ras-related protein Rab-1B; &BC105393_1(... 275 4e-72
(Q5RE13) RecName: Full=Ras-related protein Rab-1B; &(Q9H0U4) Re... 275 4e-72
(Q9D1G1) RecName: Full=Ras-related protein Rab-1B; &AB232584_1(... 275 5e-72
AK042020_1(AK042020|pid:none) Mus musculus 3 days neonate thymus... 275 5e-72
CR533462_1(CR533462|pid:none) Homo sapiens full open reading fra... 275 5e-72
EF103367_1(EF103367|pid:none) Haliotis discus discus Ras-related... 275 5e-72
(Q05974) RecName: Full=Ras-related protein Rab-1A; &S38339(S383... 275 5e-72
(P22125) RecName: Full=Ras-related protein ORAB-1; &M38393_1(M3... 275 6e-72
(P10536) RecName: Full=Ras-related protein Rab-1B; &X13905_1(X1... 275 6e-72
BC045014_1(BC045014|pid:none) Xenopus laevis RAB1, member RAS on... 275 6e-72
AL606522_3(AL606522|pid:none) Mouse DNA sequence from clone RP23... 274 8e-72
DQ214474_1(DQ214474|pid:none) Taeniopygia guttata clone 0063P003... 274 8e-72
BT051367_1(BT051367|pid:none) Medicago truncatula clone MTYF1_F2... 274 8e-72
D12548_1(D12548|pid:none) Pisum sativum mRNA for GTP-binding pro... 274 8e-72
GN106077_1(GN106077|pid:none) Sequence 10858 from Patent WO20090... 274 8e-72
(P62820) RecName: Full=Ras-related protein Rab-1A; AltName: Full... 274 8e-72
BT070553_1(BT070553|pid:none) Picea sitchensis clone WS02735_N04... 274 1e-71
CP000749_65(CP000749|pid:none) Marinomonas sp. MWYL1, complete g... 273 1e-71
(Q52NJ2) RecName: Full=Ras-related protein Rab-1A; &AY996813_1(... 273 2e-71
AK151085_1(AK151085|pid:none) Mus musculus bone marrow macrophag... 273 2e-71
AM494964_85(AM494964|pid:none) Leishmania braziliensis chromosom... 273 2e-71
BT078127_1(BT078127|pid:none) Lepeophtheirus salmonis Pacific fo... 273 2e-71
BT059700_1(BT059700|pid:none) Salmo salar clone ssal-rgf-002-342... 273 2e-71
Z73932_1(Z73932|pid:none) L.japonicus mRNA for small GTP-binding... 273 2e-71
BC097013_1(BC097013|pid:none) Danio rerio zgc:86773, mRNA (cDNA ... 272 4e-71
DQ214475_1(DQ214475|pid:none) Taeniopygia guttata clone 0058P004... 272 4e-71
AJ307662_21(AJ307662|pid:none) Oryza sativa genomic DNA fragment... 271 5e-71
AK129477_1(AK129477|pid:none) Mus musculus mRNA for mKIAA3012 pr... 271 5e-71
AK059888_1(AK059888|pid:none) Oryza sativa Japonica Group cDNA c... 271 5e-71
BT077899_1(BT077899|pid:none) Lepeophtheirus salmonis Pacific fo... 271 5e-71
AE017352_188(AE017352|pid:none) Cryptococcus neoformans var. neo... 271 7e-71
BT070586_1(BT070586|pid:none) Picea sitchensis clone WS02737_M21... 271 9e-71
CU207211_606(CU207211|pid:none) Herminiimonas arsenicoxydans chr... 271 9e-71
EF144402_1(EF144402|pid:none) Populus trichocarpa clone PX0019_E... 271 9e-71
EF146669_1(EF146669|pid:none) Populus trichocarpa clone WS01211_... 270 1e-70
D38625(D38625)GTP-binding protein o-rab1 - electric ray (Discopy... 270 2e-70
J02998_1(J02998|pid:none) Rat ras-related protein mRNA, clone NT... 270 2e-70
GN106121_1(GN106121|pid:none) Sequence 10902 from Patent WO20090... 270 2e-70
BT034664_1(BT034664|pid:none) Zea mays full-length cDNA clone ZM... 270 2e-70
CP000587_71(CP000587|pid:none) Ostreococcus lucimarinus CCE9901 ... 270 2e-70
BT057068_1(BT057068|pid:none) Salmo salar clone ssal-eve-570-039... 270 2e-70
AC183496_25(AC183496|pid:none) Brassica oleracea, *** SEQUENCING... 270 2e-70
AJ278659_1(AJ278659|pid:none) Aspergillus niger srgB gene for a ... 270 2e-70
AF244545_1(AF244545|pid:none) Aspergillus awamori YptA (yptA) ge... 269 3e-70
(P33723) RecName: Full=GTP-binding protein ypt1; &AL356324_15(A... 268 5e-70
GN105983_1(GN105983|pid:none) Sequence 10764 from Patent WO20090... 268 5e-70
GN106013_1(GN106013|pid:none) Sequence 10794 from Patent WO20090... 268 5e-70
AC183493_34(AC183493|pid:none) Brassica oleracea Contig B, compl... 268 5e-70
CR382130_329(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 268 5e-70
BT077861_1(BT077861|pid:none) Lepeophtheirus salmonis Pacific fo... 268 6e-70
AF101310_4(AF101310|pid:none) Caenorhabditis elegans cosmid C39F... 268 6e-70
GM977161_1(GM977161|pid:none) Sequence 69 from Patent WO20081456... 268 6e-70
AF108883_1(AF108883|pid:none) Capsicum annuum small GTP-binding ... 268 8e-70
GN106155_1(GN106155|pid:none) Sequence 10936 from Patent WO20090... 268 8e-70
CP001323_241(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 268 8e-70
GN105859_1(GN105859|pid:none) Sequence 10640 from Patent WO20090... 268 8e-70
GN106117_1(GN106117|pid:none) Sequence 10898 from Patent WO20090... 268 8e-70
AJ277108_1(AJ277108|pid:none) Trichoderma reesei ypt1 gene for s... 268 8e-70
CS559708_1(CS559708|pid:none) Sequence 295 from Patent WO2006032... 267 1e-69
AF324990_1(AF324990|pid:none) Arabidopsis thaliana AT5g47200 (AT... 267 1e-69
BT039522_1(BT039522|pid:none) Zea mays full-length cDNA clone ZM... 267 1e-69
CS560194_1(CS560194|pid:none) Sequence 781 from Patent WO2006032... 267 1e-69
BT076429_1(BT076429|pid:none) Caligus rogercresseyi clone crog-e... 267 1e-69
EF145603_1(EF145603|pid:none) Populus trichocarpa clone WS01126_... 267 1e-69
Y08425_1(Y08425|pid:none) N.plumbaginifolia mRNA for small GTP-b... 267 1e-69
AY060495_1(AY060495|pid:none) Arabidopsis thaliana AT4g17530/dl4... 267 1e-69
L12031_1(L12031|pid:none) Leishmania major V121 GTP-binding prot... 267 1e-69
DQ414556_1(DQ414556|pid:none) Suberites domuncula Rab1 gene, com... 266 2e-69
(P11620) RecName: Full=GTP-binding protein ypt1; &AL136536_10(A... 266 2e-69
GM977157_1(GM977157|pid:none) Sequence 65 from Patent WO20081456... 266 2e-69
GN106111_1(GN106111|pid:none) Sequence 10892 from Patent WO20090... 266 2e-69
AP008208_2028(AP008208|pid:none) Oryza sativa (japonica cultivar... 266 2e-69
CP000269_615(CP000269|pid:none) Janthinobacterium sp. Marseille,... 266 3e-69
(P34139) RecName: Full=Ras-related protein Rab-1A; 266 3e-69
AJ810707_1(AJ810707|pid:none) Poa pratensis mRNA for RAB1-like (... 265 4e-69
GN106197_1(GN106197|pid:none) Sequence 10978 from Patent WO20090... 265 5e-69
EU284879_1(EU284879|pid:none) TSA: Elaeis guineensis EgEfMPOB000... 265 7e-69
GN105857_1(GN105857|pid:none) Sequence 10638 from Patent WO20090... 265 7e-69
GN106151_1(GN106151|pid:none) Sequence 10932 from Patent WO20090... 264 9e-69
(P40392) RecName: Full=Ras-related protein RIC1; &AK243597_1(AK... 264 1e-68
BT052509_1(BT052509|pid:none) Medicago truncatula clone MTYFD_FE... 264 1e-68
GN105977_1(GN105977|pid:none) Sequence 10758 from Patent WO20090... 264 1e-68
AP009484_684(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 263 2e-68
BT081293_1(BT081293|pid:none) Caligus clemensi clone ccle-evs-51... 262 3e-68
S34253(S34253) GTP-binding protein, ras-related - common tobacco... 262 4e-68
EF086613_1(EF086613|pid:none) Picea sitchensis clone WS02920_I20... 262 4e-68
EF091876_1(EF091876|pid:none) Solanum tuberosum ras-related GTP ... 262 4e-68
CU928169_706(CU928169|pid:none) Kluyveromyces thermotolerans str... 262 4e-68
GN106165_1(GN106165|pid:none) Sequence 10946 from Patent WO20090... 261 6e-68
BC150404_1(BC150404|pid:none) Danio rerio zgc:171927, mRNA (cDNA... 261 6e-68
AC104285_6(AC104285|pid:none) Oryza sativa (japonica cultivar-gr... 261 7e-68
D12549_1(D12549|pid:none) Pisum sativum mRNA for GTP-binding pro... 261 7e-68
(Q92928) RecName: Full=Putative Ras-related protein Rab-1C; ... 261 9e-68
AC159407_36(AC159407|pid:none) Trypanosoma brucei chromosome 8 c... 261 9e-68
DQ372931_1(DQ372931|pid:none) Pinus pinaster Rab1 mRNA, complete... 260 1e-67
CR954246_2802(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 260 1e-67
(P34140) RecName: Full=Ras-related protein Rab-1B; 259 2e-67
B86153(B86153) ARA-5 [imported] - Arabidopsis thaliana &U89959_... 259 2e-67
GM977149_1(GM977149|pid:none) Sequence 57 from Patent WO20081456... 259 3e-67
GN080095_1(GN080095|pid:none) Sequence 698 from Patent WO2009027... 258 5e-67
GN080135_1(GN080135|pid:none) Sequence 738 from Patent WO2009027... 258 5e-67
CP000462_637(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 258 6e-67
GN106059_1(GN106059|pid:none) Sequence 10840 from Patent WO20090... 258 8e-67
GN105853_1(GN105853|pid:none) Sequence 10634 from Patent WO20090... 258 8e-67
GN080089_1(GN080089|pid:none) Sequence 692 from Patent WO2009027... 258 8e-67
FM954973_553(FM954973|pid:none) Vibrio splendidus LGP32 chromoso... 257 1e-66
CP000626_1088(CP000626|pid:none) Vibrio cholerae O395 chromosome... 256 2e-66
CP001252_3216(CP001252|pid:none) Shewanella baltica OS223, compl... 256 2e-66
GN106061_1(GN106061|pid:none) Sequence 10842 from Patent WO20090... 256 2e-66
CP000753_1062(CP000753|pid:none) Shewanella baltica OS185, compl... 256 3e-66
GM977155_1(GM977155|pid:none) Sequence 63 from Patent WO20081456... 256 3e-66
CP001616_1820(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 256 3e-66
GM977145_1(GM977145|pid:none) Sequence 53 from Patent WO20081456... 255 4e-66
CP000469_3153(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 254 7e-66
CP000116_2329(CP000116|pid:none) Thiobacillus denitrificans ATCC... 254 9e-66
CP000891_1110(CP000891|pid:none) Shewanella baltica OS195, compl... 254 1e-65
BX294154_248(BX294154|pid:none) Rhodopirellula baltica SH 1 comp... 253 2e-65
AM398681_1804(AM398681|pid:none) Flavobacterium psychrophilum JI... 253 2e-65
CP000083_815(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 253 2e-65
(Q7UIY1) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 253 2e-65
CP000563_1001(CP000563|pid:none) Shewanella baltica OS155, compl... 253 2e-65
GN106103_1(GN106103|pid:none) Sequence 10884 from Patent WO20090... 252 4e-65
CP000446_2985(CP000446|pid:none) Shewanella sp. MR-4, complete g... 252 4e-65
CR382124_213(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 252 4e-65
AC140549_18(AC140549|pid:none) Medicago truncatula clone mth2-28... 252 4e-65
GM977167_1(GM977167|pid:none) Sequence 75 from Patent WO20081456... 252 4e-65
AP007162_533(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 251 6e-65
AM939900_1(AM939900|pid:none) Botryotinia fuckeliana fhg1 gene f... 251 8e-65
Z73931_1(Z73931|pid:none) L.japonicus mRNA for small GTP-binding... 251 8e-65
EF147099_1(EF147099|pid:none) Populus trichocarpa clone WS01227_... 251 8e-65
EU069503_1(EU069503|pid:none) Gymnochlora stellata Rab1B mRNA, c... 251 8e-65
D12547_1(D12547|pid:none) Pisum sativum mRNA for GTP-binding pro... 251 8e-65
(Q7NSD8) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 251 1e-64
CP000644_607(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 250 1e-64
CP000472_4087(CP000472|pid:none) Shewanella piezotolerans WP3, c... 250 2e-64
AY321327_1(AY321327|pid:none) Rattus norvegicus Ac2-048 mRNA, co... 250 2e-64
GN105981_1(GN105981|pid:none) Sequence 10762 from Patent WO20090... 250 2e-64
FM992688_325(FM992688|pid:none) Candida dubliniensis CD36 chromo... 249 2e-64
AF330211_1(AF330211|pid:none) Candida albicans small GTP-binding... 249 2e-64
D01027_1(D01027|pid:none) Arabidopsis thaliana mRNA for small GT... 249 3e-64
L48181_1(L48181|pid:none) Brassica campestris L. pekinensis ypt-... 249 3e-64
CP000497_244(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 249 3e-64
(Q8GAZ4) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 249 3e-64
AM902716_2627(AM902716|pid:none) Bordetella petrii strain DSM 12... 249 3e-64
FN392321_231(FN392321|pid:none) Pichia pastoris GS115 chromosome... 249 4e-64
AC183498_22(AC183498|pid:none) Brassica oleracea, *** SEQUENCING... 249 4e-64
BT071594_1(BT071594|pid:none) Picea sitchensis clone WS02926_J12... 248 6e-64
CP000438_2375(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 247 1e-63
AE016815_434(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 247 1e-63
(Q9ZRE2) RecName: Full=Ras-related protein RABD1; AltName: Full=... 247 1e-63
CP000510_2738(CP000510|pid:none) Psychromonas ingrahamii 37, com... 246 2e-63
U09005_5(U09005|pid:none) Vibrio parahaemolyticus BB22 HflK (hfl... 246 3e-63
CU928171_789(CU928171|pid:none) Kluyveromyces thermotolerans str... 246 3e-63
FN320591_1(FN320591|pid:none) Schistosoma japonicum isolate Anhu... 245 4e-63
(P40609) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 245 5e-63
(Q9I0H4) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 245 5e-63
(Q9RYR5) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 244 7e-63
CP000926_841(CP000926|pid:none) Pseudomonas putida GB-1, complet... 244 1e-62
L21010_1(L21010|pid:none) Dictyostelium discoideum Rab1B mRNA, 3... 243 2e-62
CR382122_601(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 243 2e-62
CR380957_540(CR380957|pid:none) Candida glabrata strain CBS138 c... 243 2e-62
AY223134_1(AY223134|pid:none) Schistosoma japonicum SJCHGC02833 ... 243 2e-62
(Q88PP0) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 243 2e-62
AM270398_5(AM270398|pid:none) Aspergillus niger contig An18c0050... 243 3e-62
DQ397201_1(DQ397201|pid:none) Saccharum officinarum small GTP bi... 243 3e-62
CP000744_2503(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 243 3e-62
(P01123) RecName: Full=GTP-binding protein YPT1; AltName: Full=R... 242 5e-62
X00209_2(X00209|pid:none) Yeast YP2 gene The YP2 protein shows h... 242 5e-62
GM977163_1(GM977163|pid:none) Sequence 71 from Patent WO20081456... 242 5e-62
CP000020_2341(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 241 6e-62
FM178379_2769(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 241 8e-62
AM747720_3291(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 241 1e-61
(P20790) RecName: Full=Ras-related protein Rab-8A; AltName: Full... 240 1e-61
CR382129_796(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 240 1e-61
CP000937_1813(CP000937|pid:none) Francisella philomiragia subsp.... 240 1e-61
(Q7N215) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 240 2e-61
AJ578496_1(AJ578496|pid:none) Aspergillus fumigatus mRNA for put... 239 2e-61
CP000943_5325(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 239 2e-61
(P20791) RecName: Full=Ras-related protein Rab-8B; AltName: Full... 238 5e-61
CP001025_647(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 238 5e-61
CP000529_1292(CP000529|pid:none) Polaromonas naphthalenivorans C... 238 7e-61
CP000440_623(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 238 7e-61
(Q7MH09) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 238 9e-61
CP001510_699(CP001510|pid:none) Methylobacterium extorquens AM1,... 238 9e-61
CP000151_641(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 237 1e-60
CP001615_1408(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 237 1e-60
CP001349_2066(CP001349|pid:none) Methylobacterium nodulans ORS 2... 237 1e-60
CP000271_687(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 236 2e-60
FN315276_1(FN315276|pid:none) Schistosoma japonicum isolate Anhu... 236 2e-60
CP000789_86(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chro... 236 2e-60
AF542024_1(AF542024|pid:none) Griffithsia japonica GTP-binding p... 236 2e-60
AM910992_200(AM910992|pid:none) Plasmodium knowlesi strain H chr... 236 3e-60
CP001298_880(CP001298|pid:none) Methylobacterium chloromethanicu... 236 3e-60
CP000094_4647(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 235 6e-60
AB241242_1(AB241242|pid:none) Symbiotic protist of Reticuliterme... 235 6e-60
CP000058_1196(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 235 6e-60
CT573326_861(CT573326|pid:none) Pseudomonas entomophila str. L48... 234 7e-60
CP000886_364(CP000886|pid:none) Salmonella enterica subsp. enter... 234 9e-60
AB054578_1(AB054578|pid:none) Entamoeba histolytica EhRab1A mRNA... 234 1e-59
CP001157_4927(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 234 1e-59
CP000680_3553(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 233 2e-59
CP001138_2533(CP001138|pid:none) Salmonella enterica subsp. ente... 233 2e-59
CP000378_251(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 233 2e-59
AB241241_1(AB241241|pid:none) Symbiotic protist of Reticuliterme... 233 2e-59
(Q8Z4M3) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 232 4e-59
GN105821_1(GN105821|pid:none) Sequence 10602 from Patent WO20090... 232 4e-59
AC125368_16(AC125368|pid:none) Medicago truncatula clone mth2-13... 232 4e-59
CP001127_2611(CP001127|pid:none) Salmonella enterica subsp. ente... 232 4e-59
CP001113_2591(CP001113|pid:none) Salmonella enterica subsp. ente... 232 5e-59
CP000958_702(CP000958|pid:none) Burkholderia cenocepacia MC0-3 c... 232 5e-59
(Q57LF5) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 231 6e-59
AJ627189_1(AJ627189|pid:none) Aspergillus niger fhb gene for fla... 231 6e-59
GN106091_1(GN106091|pid:none) Sequence 10872 from Patent WO20090... 231 6e-59
S57478(S57478) GTP-binding protein GTP13 - garden pea &Z49902_1... 231 6e-59
GN106033_1(GN106033|pid:none) Sequence 10814 from Patent WO20090... 231 6e-59
GM977153_1(GM977153|pid:none) Sequence 61 from Patent WO20081456... 231 8e-59
AF020388_1(AF020388|pid:none) Salmonella typhimurium flavohemogl... 231 8e-59
CP000614_682(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 231 1e-58
CP001120_2649(CP001120|pid:none) Salmonella enterica subsp. ente... 231 1e-58
CP000880_305(CP000880|pid:none) Salmonella enterica subsp. arizo... 231 1e-58
CP000857_1065(CP000857|pid:none) Salmonella enterica subsp. ente... 230 1e-58
AM933173_2501(AM933173|pid:none) Salmonella enterica subsp. ente... 230 2e-58
CP001068_3561(CP001068|pid:none) Ralstonia pickettii 12J chromos... 230 2e-58
AB079020_1(AB079020|pid:none) Nicotiana tabacum mRNA for ras-rel... 230 2e-58
GN106127_1(GN106127|pid:none) Sequence 10908 from Patent WO20090... 230 2e-58
GN106049_1(GN106049|pid:none) Sequence 10830 from Patent WO20090... 230 2e-58
Z73946_1(Z73946|pid:none) L.japonicus mRNA for small GTP-binding... 230 2e-58
AB015475_6(AB015475|pid:none) Arabidopsis thaliana genomic DNA, ... 230 2e-58
CP000927_849(CP000927|pid:none) Caulobacter sp. K31, complete ge... 229 3e-58
(P26353) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 229 3e-58
AL646052_3397(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 229 3e-58
GN106051_1(GN106051|pid:none) Sequence 10832 from Patent WO20090... 229 3e-58
FN357538_13(FN357538|pid:none) Schistosoma mansoni genome sequen... 229 3e-58
(Q7TTP2) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 229 4e-58
BT035355_1(BT035355|pid:none) Zea mays full-length cDNA clone ZM... 228 5e-58
CP000813_878(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 228 5e-58
AM920427_1462(AM920427|pid:none) Penicillium chrysogenum Wiscons... 228 7e-58
AC117265_12(AC117265|pid:none) Oryza sativa (japonica cultivar-g... 228 7e-58
AF096249_1(AF096249|pid:none) Lycopersicon esculentum ethylene-r... 228 7e-58
BX571965_2867(BX571965|pid:none) Burkholderia pseudomallei strai... 228 7e-58
GN106009_1(GN106009|pid:none) Sequence 10790 from Patent WO20090... 228 9e-58
CP000124_3286(CP000124|pid:none) Burkholderia pseudomallei 1710b... 228 9e-58
DQ222937_1(DQ222937|pid:none) Chlamydomonas incerta YptC1 (yptC1... 228 9e-58
AB079024_1(AB079024|pid:none) Nicotiana tabacum mRNA for ras-rel... 228 9e-58
GN106011_1(GN106011|pid:none) Sequence 10792 from Patent WO20090... 228 9e-58
CP000667_2890(CP000667|pid:none) Salinispora tropica CNB-440, co... 228 9e-58
AE015929_440(AE015929|pid:none) Staphylococcus epidermidis ATCC ... 227 1e-57
GN105943_1(GN105943|pid:none) Sequence 10724 from Patent WO20090... 227 1e-57
AL162751_30(AL162751|pid:none) Arabidopsis thaliana DNA chromoso... 227 1e-57
EF144772_1(EF144772|pid:none) Populus trichocarpa clone WS01118_... 227 1e-57
BT070243_1(BT070243|pid:none) Picea sitchensis clone WS02711_M12... 227 1e-57
(Q7TTP0) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 227 2e-57
AJ001367_1(AJ001367|pid:none) Daucus carota mRNA for Rab8-like s... 227 2e-57
CP001029_891(CP001029|pid:none) Methylobacterium populi BJ001, c... 226 2e-57
(Q9URY5) RecName: Full=Flavohemoprotein; EC=1.14.12.17;... 226 2e-57
S57474(S57474) GTP-binding protein - garden pea &Z49899_1(Z4989... 226 2e-57
CP001016_1936(CP001016|pid:none) Beijerinckia indica subsp. indi... 226 2e-57
AY576526_1(AY576526|pid:none) Oryza sativa (japonica cultivar-gr... 226 3e-57
(Q47266) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 226 3e-57
CP000010_2109(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 226 3e-57
CU928162_2915(CU928162|pid:none) Escherichia coli ED1a chromosom... 226 3e-57
CP000243_2821(CP000243|pid:none) Escherichia coli UTI89, complet... 226 3e-57
GM977111_1(GM977111|pid:none) Sequence 19 from Patent WO20081456... 226 3e-57
AE017343_437(AE017343|pid:none) Cryptococcus neoformans var. neo... 226 3e-57
AK104346_1(AK104346|pid:none) Oryza sativa Japonica Group cDNA c... 226 3e-57
GN106021_1(GN106021|pid:none) Sequence 10802 from Patent WO20090... 225 4e-57
AY087058_1(AY087058|pid:none) Arabidopsis thaliana clone 3115 mR... 225 4e-57
S33900(S33900;JQ2233) GTP-binding protein ypt2 - tomato &X69980... 225 4e-57
CU928163_2823(CU928163|pid:none) Escherichia coli UMN026 chromos... 225 6e-57
AB016807_1(AB016807|pid:none) Fusarium oxysporum mRNA for flavoh... 225 6e-57
CP001510_3498(CP001510|pid:none) Methylobacterium extorquens AM1... 225 6e-57
FM180568_2829(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 224 8e-57
(O76173) RecName: Full=Ras-related protein Rab-1C; &AB015237_1(... 224 8e-57
(Q8FF30) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 224 8e-57
AJ272025_1(AJ272025|pid:none) Colletotrichum lindemuthianum pt1 ... 224 8e-57
GM977141_1(GM977141|pid:none) Sequence 49 from Patent WO20081456... 224 8e-57
(P24232) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 224 1e-56
AP009240_2840(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 224 1e-56
(Q7ABK6) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 224 1e-56
CP001063_2510(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 224 1e-56
CU928164_2738(CU928164|pid:none) Escherichia coli IAI39 chromoso... 224 1e-56
CU468135_1012(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 224 1e-56
AE017343_725(AE017343|pid:none) Cryptococcus neoformans var. neo... 223 2e-56
CU928158_591(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 223 2e-56
AM181176_5025(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 223 2e-56
CP000034_2549(CP000034|pid:none) Shigella dysenteriae Sd197, com... 223 2e-56
(Q7C0F9) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 223 2e-56
AY205596_1(AY205596|pid:none) Cryptococcus neoformans var. grubi... 223 2e-56
CP000038_2462(CP000038|pid:none) Shigella sonnei Ss046, complete... 223 3e-56
CP000647_2826(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 222 4e-56
FJ874761_1(FJ874761|pid:none) Fusarium lichenicola culture-colle... 222 4e-56
BT070448_1(BT070448|pid:none) Picea sitchensis clone WS0272_O15 ... 222 5e-56
CP000076_4968(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 222 5e-56
CP000964_1220(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 222 5e-56
AB241230_1(AB241230|pid:none) Dinenympha exilis RsSmRab1_2 mRNA ... 222 5e-56
DQ393575_1(DQ393575|pid:none) Metarhizium anisopliae RAB/GTPase ... 221 8e-56
CP000304_3051(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 221 1e-55
AC183495_42(AC183495|pid:none) Brassica oleracea Contig A, compl... 221 1e-55
CP000036_2391(CP000036|pid:none) Shigella boydii Sb227, complete... 221 1e-55
CR954205_238(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 220 1e-55
EU069501_1(EU069501|pid:none) Gymnochlora stellata Rab1A1 mRNA, ... 220 1e-55
AY896243_1(AY896243|pid:none) Trichomonas vaginalis strain G3 sm... 220 1e-55
AB241243_1(AB241243|pid:none) Symbiotic protist of Reticuliterme... 220 2e-55
GM977117_1(GM977117|pid:none) Sequence 25 from Patent WO20081456... 219 2e-55
CR932686_1(CR932686|pid:none) Paramecium tetraurelia, Small GTPa... 219 3e-55
CP000699_3148(CP000699|pid:none) Sphingomonas wittichii RW1, com... 219 4e-55
BC142846_1(BC142846|pid:none) Danio rerio RAB8B, member RAS onco... 218 7e-55
(Q6D245) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 218 7e-55
CU633457_160(CU633457|pid:none) Podospora anserina genomic DNA c... 217 1e-54
AB241220_1(AB241220|pid:none) Pyrsonympha grandis RsSmRab1_1 mRN... 217 2e-54
CP001349_5462(CP001349|pid:none) Methylobacterium nodulans ORS 2... 217 2e-54
AJ514261_1(AJ514261|pid:none) Pseudomonas stutzeri hmpA gene, OR... 216 2e-54
AM295250_679(AM295250|pid:none) Staphylococcus carnosus subsp. c... 216 3e-54
BT080552_1(BT080552|pid:none) Caligus clemensi clone ccle-evs-51... 215 5e-54
BT081291_1(BT081291|pid:none) Caligus clemensi clone ccle-evs-51... 215 5e-54
AF389109_1(AF389109|pid:none) Entamoeba histolytica small GTP-bi... 215 6e-54
AJ278658_1(AJ278658|pid:none) Aspergillus niger srgA gene for a ... 215 6e-54
BX538352_67(BX538352|pid:none) Cryptosporidium parvum chromosome... 214 8e-54
(Q92930) RecName: Full=Ras-related protein Rab-8B; &AB038995_1(... 214 1e-53
AL939130_104(AL939130|pid:none) Streptomyces coelicolor A3(2) co... 214 1e-53
CP000352_3368(CP000352|pid:none) Ralstonia metallidurans CH34, c... 213 2e-53
AY232027_1(AY232027|pid:none) Drosophila yakuba clone yak-ad_Rab... 213 2e-53
BC127330_1(BC127330|pid:none) Xenopus tropicalis RAB8B, member R... 213 2e-53
BC135798_1(BC135798|pid:none) Xenopus tropicalis RAB8B, member R... 212 4e-53
CP000941_38(CP000941|pid:none) Xylella fastidiosa M12, complete ... 212 4e-53
CR382139_1062(CR382139|pid:none) Debaryomyces hansenii strain CB... 212 5e-53
(P22128) RecName: Full=Ras-related protein Rab-8; AltName: Full=... 212 5e-53
CP000497_627(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 212 5e-53
T33855(T33855)hypothetical protein D1037.4 - Caenorhabditis eleg... 212 5e-53
AB112929_1(AB112929|pid:none) Caenorhabditis elegans rab8 mRNA f... 212 5e-53
BC129421_1(BC129421|pid:none) Danio rerio zgc:158741, mRNA (cDNA... 211 7e-53
AY324134_1(AY324134|pid:none) Babesia bovis Rab1a mRNA, complete... 211 7e-53
(Q2HJI8) RecName: Full=Ras-related protein Rab-8B; &BC105330_1(... 211 7e-53
BC078493_1(BC078493|pid:none) Xenopus laevis MGC85265 protein, m... 211 7e-53
BT080187_1(BT080187|pid:none) Caligus clemensi clone ccle-evs-50... 211 9e-53
(Q9PH91) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 211 9e-53
CP000090_3197(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 211 1e-52
BC134059_1(BC134059|pid:none) Danio rerio RAB8A, member RAS onco... 210 1e-52
(Q87F90) RecName: Full=Flavohemoprotein; AltName: Full=Hemoglobi... 210 2e-52
AP008934_2410(AP008934|pid:none) Staphylococcus saprophyticus su... 209 3e-52
AY439005_1(AY439005|pid:none) Fucus distichus Rab family GTPase ... 209 3e-52
(Q58DS5) RecName: Full=Ras-related protein Rab-13; &BT021522_1(... 209 3e-52
AY893729_1(AY893729|pid:none) Synthetic construct Homo sapiens c... 209 3e-52
AP006716_1899(AP006716|pid:none) Staphylococcus haemolyticus JCS... 209 3e-52
BC094846_1(BC094846|pid:none) Homo sapiens RAB13, member RAS onc... 209 3e-52
(P51153) RecName: Full=Ras-related protein Rab-13; AltName: Full... 209 3e-52
AB112933_1(AB112933|pid:none) Drosophila melanogaster rab8 mRNA ... 209 4e-52
AM910992_188(AM910992|pid:none) Plasmodium knowlesi strain H chr... 208 6e-52
CR932510_1(CR932510|pid:none) Paramecium tetraurelia, Small GTPa... 208 7e-52
CR932696_1(CR932696|pid:none) Paramecium tetraurelia, Small GTPa... 208 7e-52
(P35280) RecName: Full=Ras-related protein Rab-8A; &(P55258) Re... 208 7e-52
(Q5R4A3) RecName: Full=Ras-related protein Rab-8A; &CR861352_1(... 208 7e-52
S53268_1(S53268|pid:none) Homo sapiens RAS-related protein MEL (... 208 7e-52
I78851(I78851) GTP-binding protein MEL - mouse &S53270_1(S53270... 208 7e-52
AP008957_5543(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 208 7e-52
AY892042_1(AY892042|pid:none) Synthetic construct Homo sapiens c... 208 7e-52
AP008213_447(AP008213|pid:none) Oryza sativa (japonica cultivar-... 208 7e-52
(Q9TVU5) RecName: Full=Ras-related protein Rab-1; AltName: Full=... 208 7e-52
CP000285_449(CP000285|pid:none) Chromohalobacter salexigens DSM ... 208 7e-52
CR932639_1(CR932639|pid:none) Paramecium tetraurelia, Small GTPa... 208 7e-52
AK147178_1(AK147178|pid:none) Mus musculus 17 days pregnant adul... 208 7e-52
S51495(S51495;S70850)GTP-binding protein RYL1 - yeast (Yarrowia ... 207 1e-51
AP009324_239(AP009324|pid:none) Staphylococcus aureus subsp. aur... 207 2e-51
(Q5KTJ6) RecName: Full=Ras-related protein Rab-13; &AB158369_1(... 207 2e-51
AB232608_1(AB232608|pid:none) Mus musculus mRNA for Rab13, compl... 206 2e-51
(Q9DD03) RecName: Full=Ras-related protein Rab-13; &AK002303_1(... 206 2e-51
B38625(B38625)GTP-binding protein ora2 - electric ray (Discopyge... 206 2e-51
AB006189_1(AB006189|pid:none) Drosophila melanogaster mRNA for R... 206 2e-51
BC060015_1(BC060015|pid:none) Xenopus laevis hypothetical protei... 206 3e-51
EU960755_1(EU960755|pid:none) Zea mays clone 228324 unknown mRNA. 206 4e-51
CR859178_1(CR859178|pid:none) Pongo abelii mRNA; cDNA DKFZp459K2... 206 4e-51
(P61026) RecName: Full=Ras-related protein Rab-10; &(P61027) Re... 206 4e-51
AK008725_1(AK008725|pid:none) Mus musculus adult male stomach cD... 206 4e-51
AM260479_3440(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 206 4e-51
AC139707_26(AC139707|pid:none) Medicago truncatula clone mth2-16... 205 5e-51
(P24409) RecName: Full=Ras-related protein Rab-10; &D36364(D363... 205 5e-51
CP001600_3079(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 205 5e-51
AY231907_1(AY231907|pid:none) Drosophila yakuba clone yak-em_Rab... 205 6e-51
CR932581_1(CR932581|pid:none) Paramecium tetraurelia, Small GTPa... 205 6e-51
L21011_1(L21011|pid:none) Dictyostelium discoideum RabA mRNA, 3'... 204 8e-51
AP009152_328(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 204 8e-51
AL136650_1(AL136650|pid:none) Homo sapiens mRNA; cDNA DKFZp564L1... 204 8e-51
DQ414573_1(DQ414573|pid:none) Suberites domuncula Rab35 gene, co... 204 1e-50
BC009227_1(BC009227|pid:none) Homo sapiens RAB13, member RAS onc... 204 1e-50
BA000033_216(BA000033|pid:none) Staphylococcus aureus subsp. aur... 204 1e-50
BC124978_1(BC124978|pid:none) Xenopus laevis hypothetical protei... 204 1e-50
CR933412_1(CR933412|pid:none) Paramecium tetraurelia, Small GTPa... 204 1e-50
AJ938182_179(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 204 1e-50
BT044760_1(BT044760|pid:none) Salmo salar clone ssal-rgf-502-322... 204 1e-50
(P34141) RecName: Full=Ras-related protein RabA; 204 1e-50
CR933446_1(CR933446|pid:none) Paramecium tetraurelia, Small GTPa... 204 1e-50
FN392319_960(FN392319|pid:none) Pichia pastoris GS115 chromosome... 204 1e-50
AJ237914_1(AJ237914|pid:none) Plasmodium falciparum putative rab... 203 2e-50
AF201953_1(AF201953|pid:none) Plasmodium falciparum isolate FCC1... 203 2e-50
BC077124_1(BC077124|pid:none) Danio rerio zgc:100812, mRNA (cDNA... 203 2e-50
DQ443136_1(DQ443136|pid:none) Bombyx mori small GTP binding prot... 203 2e-50
BT076103_1(BT076103|pid:none) Caligus rogercresseyi clone crog-e... 203 2e-50
CR382125_525(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 203 2e-50
(P22127) RecName: Full=Ras-related protein Rab-10; Shor... 202 3e-50
EF125738_1(EF125738|pid:none) Nyctotherus ovalis Rab A61 gene, c... 202 4e-50
(P07560) RecName: Full=Ras-related protein SEC4; AltName: Full=S... 202 4e-50
Z73945_1(Z73945|pid:none) L.japonicus mRNA for small GTP-binding... 202 5e-50
AP011115_1974(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 202 5e-50
U41269_1(U41269|pid:none) Plasmodium falciparum Rab1 protein (Pf... 202 5e-50
DQ414563_1(DQ414563|pid:none) Suberites domuncula Rab10 gene, co... 201 7e-50
BC061274_1(BC061274|pid:none) Xenopus tropicalis hypothetical pr... 201 1e-49
CP001189_1491(CP001189|pid:none) Gluconacetobacter diazotrophicu... 200 2e-49
AK297598_1(AK297598|pid:none) Homo sapiens cDNA FLJ52970 complet... 200 2e-49
FN357316_32(FN357316|pid:none) Schistosoma mansoni genome sequen... 199 3e-49
FN359283_3(FN359283|pid:none) Schistosoma mansoni genome sequenc... 199 3e-49
T28971(T28971) hypothetical protein T23H2.5 - Caenorhabditis ele... 199 4e-49
DQ286060_1(DQ286060|pid:none) Hydra vulgaris RAS related GTP-bin... 198 6e-49
(Q558I0) RecName: Full=Ras-related protein RabF1; 198 6e-49
CU458896_3107(CU458896|pid:none) Mycobacterium abscessus chromos... 198 8e-49
DQ021097_1(DQ021097|pid:none) Vibrio cholerae isolate SIMP/77 fe... 198 8e-49
AP009493_2266(AP009493|pid:none) Streptomyces griseus subsp. gri... 198 8e-49
AY893660_1(AY893660|pid:none) Synthetic construct Homo sapiens c... 196 3e-48
CR932504_1(CR932504|pid:none) Paramecium tetraurelia, Small GTPa... 196 4e-48
CU633749_2916(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 195 5e-48
(P35281) RecName: Full=Ras-related protein Rab-10; &M83677_1(M8... 195 6e-48
CR932630_1(CR932630|pid:none) Paramecium tetraurelia, Small GTPa... 194 8e-48
AB018117_6(AB018117|pid:none) Arabidopsis thaliana genomic DNA, ... 194 8e-48
DQ440351_1(DQ440351|pid:none) Aedes aegypti clone AET-452 RAB pr... 194 1e-47
BC057747_1(BC057747|pid:none) Xenopus laevis hypothetical protei... 194 1e-47
BC041759_1(BC041759|pid:none) Xenopus laevis similar to RAB35, m... 192 3e-47
BC068969_1(BC068969|pid:none) Xenopus laevis similar to RAB35, m... 192 3e-47
BC099268_1(BC099268|pid:none) Xenopus laevis similar to RAB35, m... 192 3e-47
AJ851375_1(AJ851375|pid:none) Gallus gallus mRNA for hypothetica... 192 4e-47
AL117202_29(AL117202|pid:none) Caenorhabditis elegans YAC Y47D3A... 191 7e-47
AC116984_79(AC116984|pid:none) Dictyostelium discoideum chromoso... 191 9e-47
CR932703_1(CR932703|pid:none) Paramecium tetraurelia, Small GTPa... 190 2e-46
CP000088_421(CP000088|pid:none) Thermobifida fusca YX, complete ... 189 3e-46
CR932644_1(CR932644|pid:none) Paramecium tetraurelia, Small GTPa... 189 4e-46
BT078096_1(BT078096|pid:none) Lepeophtheirus salmonis Pacific fo... 189 4e-46
AY896281_1(AY896281|pid:none) Trichomonas vaginalis strain G3 sm... 189 4e-46
BT051484_1(BT051484|pid:none) Medicago truncatula clone MTYF1_F2... 189 5e-46
S26964(S26964;S60514)flavohemoglobin - yeast (Pichia norvegensis) 188 6e-46
CR933428_1(CR933428|pid:none) Paramecium tetraurelia, Small GTPa... 188 6e-46
CR932657_1(CR932657|pid:none) Paramecium tetraurelia, Small GTPa... 188 8e-46
AY813938_1(AY813938|pid:none) Schistosoma japonicum SJCHGC06150 ... 187 1e-45
(Q504M8) RecName: Full=Ras-related protein Rab-26; &AB232621_1(... 186 2e-45
BC075754_1(BC075754|pid:none) Danio rerio zgc:86635, mRNA (cDNA ... 186 3e-45
CP000499_197(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 186 4e-45
CR932579_1(CR932579|pid:none) Paramecium tetraurelia, Small GTPa... 185 5e-45
GN080133_1(GN080133|pid:none) Sequence 736 from Patent WO2009027... 185 5e-45
BC071442_1(BC071442|pid:none) Danio rerio zgc:86773, mRNA (cDNA ... 185 5e-45
GN080127_1(GN080127|pid:none) Sequence 730 from Patent WO2009027... 185 5e-45
GN080113_1(GN080113|pid:none) Sequence 716 from Patent WO2009027... 185 7e-45
BC135626_1(BC135626|pid:none) Xenopus tropicalis RAB3A, member R... 184 1e-44
BT064760_1(BT064760|pid:none) Zea mays full-length cDNA clone ZM... 184 1e-44
(Q39570) RecName: Full=GTP-binding protein YPTC4; &JC4106(JC410... 184 1e-44
FM992695_689(FM992695|pid:none) Candida dubliniensis CD36 chromo... 184 1e-44
M19885_1(M19885|pid:none) Bovine GTP-binding protein (smg p25A) ... 183 2e-44
(Q54E92) RecName: Full=Ras-related protein RabG1; 183 2e-44
(Q96AX2) RecName: Full=Ras-related protein Rab-37; &AK098068_1(... 183 3e-44
(Q8K386) RecName: Full=Ras-related protein Rab-15; &AB232610_1(... 183 3e-44
(P11023) RecName: Full=Ras-related protein Rab-3A; AltName: Full... 183 3e-44
AF169950_1(AF169950|pid:none) Tetrahymena thermophila putative i... 182 3e-44
CR933476_1(CR933476|pid:none) Paramecium tetraurelia, Small GTPa... 182 3e-44
BT087588_1(BT087588|pid:none) Zea mays full-length cDNA clone ZM... 182 3e-44
(P59190) RecName: Full=Ras-related protein Rab-15; &AX399903_1(... 182 3e-44
AF014120_1(AF014120|pid:none) Strongylocentrotus purpuratus GTP-... 182 3e-44
(P35289) RecName: Full=Ras-related protein Rab-15; &BC094954_1(... 182 3e-44
AF254795_1(AF254795|pid:none) Homo sapiens GTP-binding protein R... 182 3e-44
BC075980_1(BC075980|pid:none) Danio rerio RAB3A, member RAS onco... 182 3e-44
CR382138_325(CR382138|pid:none) Debaryomyces hansenii strain CBS... 182 6e-44
BC066913_1(BC066913|pid:none) Homo sapiens RAB26, member RAS onc... 182 6e-44
(Q9ULW5) RecName: Full=Ras-related protein Rab-26; &AY646153_1(... 182 6e-44
U28944_14(U28944|pid:none) Caenorhabditis elegans cosmid C18A3, ... 181 7e-44
(Q94986) RecName: Full=Ras-related protein Rab-3; &AB112928_1(A... 181 7e-44
DQ836048_1(DQ836048|pid:none) Trichomonas vaginalis small Rab GT... 181 7e-44
EU090128_1(EU090128|pid:none) Aiptasia pulchella Rab3 mRNA, comp... 181 1e-43
S01765(S01765;C39963) GTP-binding protein rab3 - rat &X06889_1(... 181 1e-43
JC5066(JC5066) GTP-binding protein rab 3C - rat &U54807_1(U5480... 181 1e-43
>AB025584_1(AB025584|pid:none) Dictyostelium discoideum DdFHb mRNA for
flavohemoglobin, complete cds.
Length = 423
Score = 841 bits (2172), Expect = 0.0
Identities = 416/417 (99%), Positives = 416/417 (99%)
Frame = +3
Query: 150 MLSQKSIQIIKSTVPLLEKYGVEITSLFYKNMFEAQPQFLNIFNHSNQRNQKQPVALANT 329
MLSQKSIQIIKSTVPLLEKYGVEITSLFYKNMFEAQPQFLNIFNHSNQRNQKQPVALANT
Sbjct: 1 MLSQKSIQIIKSTVPLLEKYGVEITSLFYKNMFEAQPQFLNIFNHSNQRNQKQPVALANT 60
Query: 330 ILQSAIHIEKLNEINLMPIVHKHVALGITPEMYPIVGAHLLGAMKTVMQDEATPEIMAAW 509
ILQSAIHIEKLNEINLMPIVHKHVALGITPEMYPIVGAHLLGAMKTVMQDEATPEIMAAW
Sbjct: 61 ILQSAIHIEKLNEINLMPIVHKHVALGITPEMYPIVGAHLLGAMKTVMQDEATPEIMAAW 120
Query: 510 TEAYRAVAQAFMDAEEDLYFETEEQIGGWKDTREFVVDRIEEETPLIKSFYFKAYDGKEI 689
TEAYRAVAQAFMDAEEDLYFETEEQIGGWKDTREFVVDRIEEETPLIKSFYFKAYDGKEI
Sbjct: 121 TEAYRAVAQAFMDAEEDLYFETEEQIGGWKDTREFVVDRIEEETPLIKSFYFKAYDGKEI 180
Query: 690 ATYIPGQYITVKITLPGDGVDVPTDKMRTYVRHYSLSDKPNDEYYRISIKKELGKNTPNG 869
ATYIPGQYITVKITLPGDGVDVPTDKMRTYVRHYSLSDKPNDEYYRISIKKELGKNTPNG
Sbjct: 181 ATYIPGQYITVKITLPGDGVDVPTDKMRTYVRHYSLSDKPNDEYYRISIKKELGKNTPNG 240
Query: 870 IVSNHFHNNIKVGDVVPMSVPAGDFVVNNDSETPILLICGGVGINPLFSMLKETLVQQPD 1049
IVSNHFHNNIKVGDVVPMSVPAGDFVVNNDSETPILLICGGVGINPLFSMLKETLVQQPD
Sbjct: 241 IVSNHFHNNIKVGDVVPMSVPAGDFVVNNDSETPILLICGGVGINPLFSMLKETLVQQPD 300
Query: 1050 RKINFIFSTHCESSQPFKEELKQLEDDYKETGNLKINLVYSENQGHINKEIIEKYSTQHV 1229
RKINFIFSTHCESSQPFKEELKQLEDDYKETGNLKINLVYSENQGHINKEIIEKYSTQHV
Sbjct: 301 RKINFIFSTHCESSQPFKEELKQLEDDYKETGNLKINLVYSENQGHINKEIIEKYSTQHV 360
Query: 1230 DQAEIAETDVYICGPVPFMMQVNKDLLQLGFHKENVHYELFGPLTPVLEENQMLRGV 1400
DQAEI ETDVYICGPVPFMMQVNKDLLQLGFHKENVHYELFGPLTPVLEENQMLRGV
Sbjct: 361 DQAEIDETDVYICGPVPFMMQVNKDLLQLGFHKENVHYELFGPLTPVLEENQMLRGV 417
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 3,122,375,243
Number of extensions: 62886974
Number of successful extensions: 180274
Number of sequences better than 10.0: 5665
Number of HSP's gapped: 175451
Number of HSP's successfully gapped: 5719
Length of query: 711
Length of database: 1,051,180,864
Length adjustment: 136
Effective length of query: 575
Effective length of database: 611,008,840
Effective search space: 351330083000
Effective search space used: 351330083000
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
7 |
| VH (FL, L) |
2 |
| VF (FL, S) |
13 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
2 |
| SS (DIR, S) |
8 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
1 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
3 |
| FC-IC (SUB) |
0 |