| Contig-U16131-1 |
| Contig ID |
Contig-U16131-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1603 |
| Chromosome number (1..6, M) |
5 |
| Chromosome length |
5062330 |
| Start point |
986650 |
| End point |
985048 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
7 |
| Number of EST |
7 |
| Link to clone list |
U16131 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.17 |
| Homology vs DNA |
Query= Contig-U16131-1 (Contig-U16131-1Q) /CSM_Contig/Contig-U16131-1Q.Seq.d
(1613 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ346356) Dictyostelium discoideum cDNA clone:dda30l18, 3' ... 1324 0.0 1
(C90559) Dictyostelium discoideum slug cDNA, clone SSI722. 1132 0.0 1
(AU061552) Dictyostelium discoideum slug cDNA, clone SLE618. 837 0.0 2
(C90400) Dictyostelium discoideum slug cDNA, clone SSI358. 462 e-163 2
(AU074607) Dictyostelium discoideum slug cDNA, clone SSL363. 468 e-127 1
(AU073913) Dictyostelium discoideum slug cDNA, clone SSI722. 222 2e-72 2
(AU038699) Dictyostelium discoideum slug cDNA, clone SSL363. 238 5e-58 1
(CD230006) SS1_40_D06.b1_A012 Salt-stressed seedlings Sorghu... 48 5e-21 5
(BC076901) Xenopus tropicalis histidine ammonia-lyase, mRNA ... 54 8e-15 4
(BC074146) Xenopus laevis MGC81887 protein, mRNA (cDNA clone... 58 7e-14 3
(CV284655) tak67b03.x1 Hydra EST Kiel 7 Hydra magnipapillata... 56 6e-13 4
(BC077229) Xenopus laevis histidine ammonia-lyase, mRNA (cDN... 74 4e-12 3
(CV284884) tak67b03.y1 Hydra EST Kiel 7 Hydra magnipapillata... 56 5e-12 3
(CN775058) tae69b02.y1 Hydra EST Darmstadt I Hydra magnipapi... 56 7e-12 2
(CN770355) tae69b02.x1 Hydra EST Darmstadt I Hydra magnipapi... 56 1e-11 3
(BC080414) Xenopus laevis hypothetical protein LOC100125662,... 62 2e-11 4
(DR882127) JGI_CABK1048.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 54 2e-11 3
(DY566310) AGENCOURT_69652355 NICHD_XGC_Emb10 Xenopus laevis... 72 2e-10 3
(AV382963) Halocynthia roretzi cDNA clone:004E01_5, 5' end, ... 44 3e-09 4
(AF549926) Xenopus laevis clone S10-46-F1 mRNA sequence. 74 2e-08 1
(DY568217) AGENCOURT_69654658 NICHD_XGC_Emb10 Xenopus laevis... 74 2e-08 1
(DC104333) Xenopus laevis NBRP cDNA clone:xl235i16, 5' end. 74 2e-08 1
(DC104219) Xenopus laevis NBRP cDNA clone:xl235c24, 5' end. 74 2e-08 1
(CA986537) AGENCOURT_11301562 NICHD_XGC_Emb1 Xenopus laevis ... 74 2e-08 1
(BP701030) Xenopus laevis NBRP cDNA clone:XL500e02ex, 5' end. 74 2e-08 1
(BP686111) Xenopus laevis NBRP cDNA clone:XL450f10ex, 5' end. 74 2e-08 1
(BJ034563) Xenopus laevis cDNA clone:XL030a19, 5' end, singl... 74 2e-08 1
(DL168799) Methods for Identifying the Target of a Compound ... 60 5e-08 3
(DJ374534) Identification of Essential Genes in Prokaryotes. 60 5e-08 3
(DD121396) STAPHYLOCOCCUS AUREUS PROTEINS AND NUCLEIC ACIDS. 60 5e-08 3
(CS711565) Sequence 4105 from Patent EP1829892. 60 5e-08 3
(AX621142) Sequence 4105 from Patent WO02094868. 60 5e-08 3
(DL171722) Methods for Identifying the Target of a Compound ... 60 5e-08 3
(DJ377457) Identification of Essential Genes in Prokaryotes. 60 5e-08 3
(BC166298) Xenopus tropicalis hypothetical protein LOC100145... 50 1e-07 3
(CU075794) Xenopus tropicalis finished cDNA, clone TNeu041n08. 50 1e-07 3
(BC167682) Xenopus tropicalis cDNA clone MGC:185958 IMAGE:75... 50 1e-07 3
(BC161526) Xenopus tropicalis hypothetical protein LOC100145... 50 1e-07 3
(AR535574) Sequence 136 from patent US 6737248. 60 2e-06 3
(AR354018) Sequence 136 from patent US 6593114. 60 2e-06 3
(DN020968) JGI_CAAR2808.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 54 2e-06 2
(DN032364) JGI_CAAR9306.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 54 2e-06 2
(DN027070) JGI_CAAR6072.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 54 3e-06 2
(DN084122) JGI_CABD14570.fwd NIH_XGC_tropLun1 Xenopus (Silur... 54 3e-06 2
(DR839145) JGI_CABC7804.fwd NIH_XGC_tropFat1 Xenopus (Silura... 54 3e-06 2
(DR841538) JGI_CABC10708.fwd NIH_XGC_tropFat1 Xenopus (Silur... 54 3e-06 2
(CX414672) JGI_XZT5531.fwd NIH_XGC_tropTad5 Xenopus (Siluran... 54 3e-06 2
(DT447544) JGI_CABK7458.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 54 3e-06 2
(DN038818) JGI_CAAR12779.fwd NIH_XGC_tropLiv1 Xenopus (Silur... 54 3e-06 2
(FE236473) CAPG3907.rev CAPG Naegleria gruberi amoeba stage ... 44 4e-06 4
(Z68004) Caenorhabditis elegans Cosmid F47B10. 44 4e-06 2
(FE240899) CAPG6075.rev CAPG Naegleria gruberi amoeba stage ... 44 6e-06 4
(BW639805) Dugesia ryukyuensis mRNA, clone: Dr_sW_016_B16, 5... 50 9e-06 3
(BW640343) Dugesia ryukyuensis mRNA, clone: Dr_sW_017_O05, 5... 50 1e-05 3
(BW638030) Dugesia ryukyuensis mRNA, clone: Dr_sW_010_F10, 5... 50 1e-05 3
(BW637042) Dugesia ryukyuensis mRNA, clone: Dr_sW_007_E18, 5... 50 1e-05 3
(DT935607) BAAC-PNP1281H10.g1 C.remanei EST SB146 Caenorhabd... 42 2e-05 2
(C70456) Caenorhabditis elegans cDNA clone yk409a3 : 5' end,... 44 2e-05 2
(BW635787) Dugesia ryukyuensis mRNA, clone: Dr_sW_003_G12, 5... 40 2e-05 4
(BQ734440) AGENCOURT_8098546 NICHD_XGC_Emb4 Xenopus laevis c... 62 4e-05 2
(DC034608) Xenopus laevis NBRP cDNA clone:xlk56l05ex, 5' end. 58 1e-04 2
(D69326) Caenorhabditis elegans cDNA clone yk68e2 : 5' end, ... 44 3e-04 2
(BD064414) Novel prokaryotic polynucleotides, polypeptides a... 60 3e-04 1
(AR194573) Sequence 122 from patent US 6348582. 60 3e-04 1
(CT762172) Paramecium tetraurelia 5-PRIME EST from clone LK0... 60 3e-04 1
(CP000736) Staphylococcus aureus subsp. aureus JH1, complete... 60 3e-04 1
(CP000730) Staphylococcus aureus subsp. aureus USA300_TCH151... 60 3e-04 1
(CP000703) Staphylococcus aureus subsp. aureus JH9, complete... 60 3e-04 1
(CP000255) Staphylococcus aureus subsp. aureus USA300_FPR375... 60 3e-04 1
(CP000253) Staphylococcus aureus subsp. aureus NCTC 8325, co... 60 3e-04 1
(CP000046) Staphylococcus aureus subsp. aureus COL, complete... 60 3e-04 1
(BX571857) Staphylococcus aureus strain MSSA476, complete ge... 60 3e-04 1
(BX571856) Staphylococcus aureus subsp. aureus strain MRSA25... 60 3e-04 1
(BA000033) Staphylococcus aureus subsp. aureus MW2 DNA, comp... 60 3e-04 1
(BA000018) Staphylococcus aureus subsp. aureus N315 DNA, com... 60 3e-04 1
(BA000017) Staphylococcus aureus subsp. aureus Mu50 DNA, com... 60 3e-04 1
(AP009351) Staphylococcus aureus subsp. aureus str. Newman D... 60 3e-04 1
(AP009324) Staphylococcus aureus subsp. aureus Mu3 DNA, comp... 60 3e-04 1
(AJ938182) Staphylococcus aureus RF122 complete genome. 60 3e-04 1
(FE243114) CAPG749.rev CAPG Naegleria gruberi amoeba stage N... 44 4e-04 3
(BU912346) AGENCOURT_10457668 NICHD_XGC_OO1 Xenopus laevis c... 54 6e-04 2
(CB208753) AGENCOURT_11343850 NICHD_XGC_Tad2 Xenopus laevis ... 58 0.001 1
(CB206913) AGENCOURT_11370350 NICHD_XGC_Tad1 Xenopus laevis ... 58 0.001 1
(BU905495) AGENCOURT_10164226 NICHD_XGC_Kid1 Xenopus laevis ... 58 0.001 1
(CB282118) BT0087 Blomia tropicalis cDNA library Blomia trop... 42 0.004 2
(FF083672) CPAD-aaa15d08.b1 PB2801_EST_CPAD1 Caenorhabditis ... 42 0.004 2
(AL961327) Xenopus tropicalis EST, clone TGas104d10 5'. 56 0.004 1
(BF612103) de91a09.y1 Wellcome CRC pRN3 St19 26 Xenopus laev... 56 0.004 1
(BW637078) Dugesia ryukyuensis mRNA, clone: Dr_sW_007_G12, 5... 50 0.007 2
(BW638683) Dugesia ryukyuensis mRNA, clone: Dr_sW_012_F15, 5... 50 0.008 2
(DT450334) JGI_CABK8969.rev NIH_XGC_tropSpl1 Xenopus (Silura... 54 0.017 1
(DN033227) JGI_CAAR9773.rev NIH_XGC_tropLiv1 Xenopus (Silura... 54 0.017 1
(DN033228) JGI_CAAR9773.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 50 0.025 2
(DN050628) JGI_CABA6389.fwd NIH_XGC_tropKid1 Xenopus (Silura... 50 0.026 2
(DN056273) JGI_CABA9693.fwd NIH_XGC_tropKid1 Xenopus (Silura... 50 0.028 2
(DN038817) JGI_CAAR12779.rev NIH_XGC_tropLiv1 Xenopus (Silur... 50 0.029 2
(DN035766) JGI_CAAR11151.rev NIH_XGC_tropLiv1 Xenopus (Silur... 50 0.030 2
(DN084121) JGI_CABD14570.rev NIH_XGC_tropLun1 Xenopus (Silur... 50 0.031 2
(EK572558) 1095521087586 Global-Ocean-Sampling_GS-32-01-01-1... 40 0.031 3
(CX416513) JGI_XZG64421.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 0.082 3
(EJ123937) 1092343385594 Global-Ocean-Sampling_GS-27-01-01-1... 42 0.12 2
(EL854078) CBXT11237.b1 NICHD_XGC_trop_25 Xenopus (Silurana)... 50 0.26 1
(CX496162) JGI_XZG38019.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX481776) JGI_XZG50550.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX461897) JGI_XZG25014.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX454182) JGI_XZG55272.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX428387) JGI_XZG18726.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX427406) JGI_XZG18149.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX422674) JGI_XZG63089.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(CX417086) JGI_XZG64754.fwd NIH_XGC_tropGas7 Xenopus (Silura... 50 0.26 1
(AL961868) Xenopus tropicalis EST, clone TGas116d18 5'. 50 0.26 1
(AL793026) Xenopus tropicalis EST, clone TNeu131o14 5'. 50 0.26 1
(AL682476) Xenopus tropicalis EST, clone TGas066e16 5'. 50 0.26 1
(AL659861) Xenopus tropicalis EST, clone TNeu036d22 5'. 50 0.26 1
(AL648470) Xenopus tropicalis EST, clone TGas033o19 5'. 50 0.26 1
(CB558513) AGENCOURT_13045812 NICHD_XGC_Kid1 Xenopus laevis ... 50 0.26 1
(BW643908) Dugesia ryukyuensis mRNA, clone: Dr_sW_028_M15, 5... 50 0.26 1
(BW642782) Dugesia ryukyuensis mRNA, clone: Dr_sW_025_G20, 5... 50 0.26 1
(BW642297) Dugesia ryukyuensis mRNA, clone: Dr_sW_023_O09, 5... 50 0.26 1
(BW636140) Dugesia ryukyuensis mRNA, clone: Dr_sW_004_I07, 5... 50 0.26 1
(EY500219) CBBP514.rev CBBP Hirudo medicinalis hermaphrodite... 50 0.26 1
(EK317832) 1095462419254 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.31 3
(BC134685) Bos taurus histidine ammonia-lyase, mRNA (cDNA cl... 38 0.34 3
(FD257090) CBZF7222.b1 CBZF: Normalized blue catfish cDNA li... 42 0.37 2
(AC217570) Populus trichocarpa clone POP028-M02, complete se... 44 0.41 5
(FB641413) Sequence 57136 from Patent WO2004081186. 48 1.0 1
(FB596756) Sequence 12479 from Patent WO2004081186. 48 1.0 1
(AC093772) Homo sapiens BAC clone RP11-125O18 from 4, comple... 48 1.0 1
(AC079414) Homo sapiens chromosome 16 clone RP11-358L22, com... 48 1.0 1
(AC009044) Homo sapiens chromosome 16 clone RP11-190D6, comp... 48 1.0 1
(AC143981) Macaca mulatta clone CH250-271J4, *** SEQUENCING ... 48 1.0 1
(FD518901) RUS33A03w HB (Hordeum vulgare cv. Barke) Hordeum ... 48 1.0 1
(FD517952) RUS49B12w HB (Hordeum vulgare cv. Barke) Hordeum ... 48 1.0 1
(AL792719) Xenopus tropicalis EST, clone TNeu131g11 5'. 38 1.1 2
(AL780953) Xenopus tropicalis EST, clone TNeu084f19 5'. 38 1.1 2
(BQ391734) NISC_mq20d09.y1 NICHD_XGC_Emb5 Xenopus (Silurana)... 38 1.2 2
(CX445819) JGI_XZG21646.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 1.2 2
(DB595191) Halocynthia roretzi cDNA clone:ma311p04, 3' end. 36 1.4 2
(CX442450) JGI_XZG61162.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 1.5 2
(CX513819) JGI_XZG58175.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 1.5 2
(CX444138) JGI_XZG10164.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 1.5 2
(CB209646) AGENCOURT_11302340 NICHD_XGC_Emb1 Xenopus laevis ... 38 1.6 2
(EK265391) 1095462222894 Global-Ocean-Sampling_GS-31-01-01-1... 42 1.7 2
(CP000771) Fervidobacterium nodosum Rt17-B1, complete genome. 32 1.8 2
(AM987167) Dicentrarchus labrax EST, 5'-end sequence, clone ... 32 2.8 2
(DN244778) ACAE-aaa41j18.b1 Hydra EST UCI 5 Hydra magnipapil... 40 2.9 2
(EA202319) Sequence 66634 from patent US 7214786. 40 3.2 2
(BG907623) TaLr1161E08F TaLr1 Triticum aestivum cDNA clone T... 40 3.2 2
(DI116331) Method for diagnosing Human hepatocellular carcin... 32 3.4 4
(EV828840) TT1D120TH Tetrahymena thermophila SB210 cDNA libr... 34 3.7 3
(AY416077) Pan troglodytes HAL gene, VIRTUAL TRANSCRIPT, par... 32 3.9 4
(AY416076) Homo sapiens HAL gene, VIRTUAL TRANSCRIPT, partia... 32 3.9 4
(BX571774) Zebrafish DNA sequence from clone DKEY-250A19 in ... 46 4.1 1
(BV308558) S236P6105RF10.T0 AlaskanMalamute Canis familiaris... 46 4.1 1
(AC198093) Pongo abelii BAC clone CH276-31L11 from chromosom... 46 4.1 1
(AM455668) Vitis vinifera, whole genome shotgun sequence, co... 46 4.1 1
(AM425172) Vitis vinifera contig VV78X218293.12, whole genom... 46 4.1 1
(AC161847) Bos taurus clone CH240-100I5, WORKING DRAFT SEQUE... 46 4.1 1
(AC149569) Papio anubis clone RP41-477D9, WORKING DRAFT SEQU... 46 4.1 1
(CU856295) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.1 1
(AC233146) Colobus guereza clone CH272-280F13, WORKING DRAFT... 46 4.1 1
(AC229710) Medicago truncatula clone mth2-160a14, WORKING DR... 46 4.1 1
(AC223350) Bos taurus clone CH240-421E6, WORKING DRAFT SEQUE... 46 4.1 1
(AC223347) Bos taurus clone CH240-421D22, WORKING DRAFT SEQU... 46 4.1 1
(AC197984) Saimiri boliviensis boliviensis clone CH254-91M15... 46 4.1 1
(AC197649) Nomascus leucogenys leucogenys clone CH271-384E21... 46 4.1 1
(AC186923) Callicebus moloch clone LB5-109P14, WORKING DRAFT... 46 4.1 1
(AC169210) Macaca mulatta clone CH250-91G7, WORKING DRAFT SE... 46 4.1 1
(AC168027) Bos taurus clone CH240-209M24, WORKING DRAFT SEQU... 46 4.1 1
(EJ427362) 1093015234298 Global-Ocean-Sampling_GS-28-01-01-1... 46 4.1 1
(EJ277207) 1095366027048 Global-Ocean-Sampling_GS-27-01-01-1... 46 4.1 1
(CU821866) A BAC library has been constructed from PN40024 g... 46 4.1 1
(CE548209) tigr-gss-dog-17000327424628 Dog Library Canis lup... 46 4.1 1
(CC763815) CH240_41M15.TV CHORI-240 Bos taurus genomic clone... 46 4.1 1
(CX381915) JGI_XZT53363.fwd NIH_XGC_tropTad5 Xenopus (Silura... 46 4.1 1
(CN215697) 29520 Suspension culture Solanum tuberosum cDNA, ... 46 4.1 1
(FC772811) CBBN7295.rev CBBN Lottia gigantea 3,4,5,6.5d Larv... 46 4.1 1
(FC766767) CBBN3357.rev CBBN Lottia gigantea 3,4,5,6.5d Larv... 46 4.1 1
(CP000910) Renibacterium salmoninarum ATCC 33209, complete g... 46 4.1 1
(CP000817) Lysinibacillus sphaericus C3-41, complete genome. 46 4.1 1
(CP000568) Clostridium thermocellum ATCC 27405, complete gen... 46 4.1 1
(CG673448) trs1180 trs Aegilops tauschii genomic clone trs04... 40 4.7 2
(DB598558) Halocynthia roretzi cDNA clone:ma321p01, 3' end. 36 5.0 2
(AL359175) Human DNA sequence from clone RP11-213K14 on chro... 40 5.9 6
(BC096099) Homo sapiens histidine ammonia-lyase, mRNA (cDNA ... 32 6.0 4
(BC096098) Homo sapiens histidine ammonia-lyase, mRNA (cDNA ... 32 6.0 4
(BC096097) Homo sapiens histidine ammonia-lyase, mRNA (cDNA ... 32 6.0 4
(AK298736) Homo sapiens cDNA FLJ59235 complete cds, highly s... 32 8.0 4
(AK303544) Homo sapiens cDNA FLJ61019 complete cds, highly s... 32 9.3 4
>(BJ346356) Dictyostelium discoideum cDNA clone:dda30l18, 3' end,
single read.
Length = 668
Score = 1324 bits (668), Expect = 0.0
Identities = 668/668 (100%)
Strand = Plus / Minus
Query: 797 atccatcagagattacattggcaaataaagatacaaagaaagttcaagatagttatacat 856
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 668 atccatcagagattacattggcaaataaagatacaaagaaagttcaagatagttatacat 609
Query: 857 tacgttgtgtaccacaagttcatggtatcgttttcgataccattgatttcgttcagggaa 916
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 608 tacgttgtgtaccacaagttcatggtatcgttttcgataccattgatttcgttcagggaa 549
Query: 917 ttataaacaccgagatgaactctgcaactgataatccaatggttttcgacactgatgaat 976
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 548 ttataaacaccgagatgaactctgcaactgataatccaatggttttcgacactgatgaat 489
Query: 977 tatgtggcacaattagtggtggtaacttccatggtgagtatcctgcaaaggcattggatt 1036
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 488 tatgtggcacaattagtggtggtaacttccatggtgagtatcctgcaaaggcattggatt 429
Query: 1037 accttacaattggtattcatgaactttcaaatattagtgaacgtcgtttagaacgtttgg 1096
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 428 accttacaattggtattcatgaactttcaaatattagtgaacgtcgtttagaacgtttgg 369
Query: 1097 taaattcacaattgagtgatggtcttccatcatttttggtaaatggtggtggtttaaatt 1156
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 368 taaattcacaattgagtgatggtcttccatcatttttggtaaatggtggtggtttaaatt 309
Query: 1157 caggtttcatgattgctcattgtacaagtgctgctttggtaagtgaaaataaagttttgg 1216
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 308 caggtttcatgattgctcattgtacaagtgctgctttggtaagtgaaaataaagttttgg 249
Query: 1217 ttcatccttcttctgcagataccattagcacaagtagtgcaaaagaagatcacgtttcaa 1276
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 248 ttcatccttcttctgcagataccattagcacaagtagtgcaaaagaagatcacgtttcaa 189
Query: 1277 tgggtggttggtctgctcgtaaatgtttaaatgttgttgaaaatgttgaaaatgttttag 1336
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 188 tgggtggttggtctgctcgtaaatgtttaaatgttgttgaaaatgttgaaaatgttttag 129
Query: 1337 caatcgaattattagcagcttgtcaaggtttggattttagaagacctttaaaaaccactg 1396
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 128 caatcgaattattagcagcttgtcaaggtttggattttagaagacctttaaaaaccactg 69
Query: 1397 aaccattagaagcagtctatcaattagtacgttcaaaagttacttttatggataaagata 1456
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 68 aaccattagaagcagtctatcaattagtacgttcaaaagttacttttatggataaagata 9
Query: 1457 gattcata 1464
||||||||
Sbjct: 8 gattcata 1
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,745,064,253
Number of extensions: 99964461
Number of successful extensions: 7907742
Number of sequences better than 10.0: 190
Length of query: 1613
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1589
Effective length of database: 96,409,374,237
Effective search space: 153194495662593
Effective search space used: 153194495662593
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.20 |
| Homology vs Protein |
Query= Contig-U16131-1 (Contig-U16131-1Q) /CSM_Contig/Contig-U16131-1Q.Seq.d
(1613 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC115354_1(BC115354|pid:none) Danio rerio hypothetical protein L... 301 3e-80
BC077229_1(BC077229|pid:none) Xenopus laevis histidine ammonia-l... 298 5e-79
BC080414_1(BC080414|pid:none) Xenopus laevis hypothetical protei... 295 3e-78
(A7YWP4) RecName: Full=Histidine ammonia-lyase; Short=H... 291 5e-77
AK303544_1(AK303544|pid:none) Homo sapiens cDNA FLJ61019 complet... 291 6e-77
AB042217_1(AB042217|pid:none) Homo sapiens HAL gene for histidas... 291 6e-77
(P35492) RecName: Full=Histidine ammonia-lyase; Short=H... 288 3e-76
(Q20502) RecName: Full=Probable histidine ammonia-lyase; ... 267 9e-70
BC076901_1(BC076901|pid:none) Xenopus tropicalis histidine ammon... 239 2e-61
CP000478_2355(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 221 6e-56
AK297004_1(AK297004|pid:none) Homo sapiens cDNA FLJ57123 complet... 220 1e-55
(Q1IRT8) RecName: Full=Histidine ammonia-lyase; Short=H... 219 3e-55
CP000924_1464(CP000924|pid:none) Thermoanaerobacter pseudethanol... 217 1e-54
(B6IWC6) RecName: Full=Histidine ammonia-lyase; Short=H... 217 1e-54
(Q1D6R1) RecName: Full=Histidine ammonia-lyase; Short=H... 215 3e-54
CP000923_2118(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 213 1e-53
(B2A3D9) RecName: Full=Histidine ammonia-lyase; Short=H... 213 1e-53
(Q15X40) RecName: Full=Histidine ammonia-lyase; Short=H... 207 1e-51
(Q5QV30) RecName: Full=Histidine ammonia-lyase; Short=H... 205 3e-51
(Q1Q9E4) RecName: Full=Histidine ammonia-lyase; Short=H... 204 1e-50
(Q7P188) RecName: Full=Histidine ammonia-lyase; Short=H... 202 4e-50
(Q67JH4) RecName: Full=Histidine ammonia-lyase; Short=H... 201 5e-50
CP000789_1976(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 201 6e-50
CP000462_356(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 201 8e-50
(Q87Q77) RecName: Full=Histidine ammonia-lyase; Short=H... 201 8e-50
(Q73Q56) RecName: Full=Histidine ammonia-lyase; Short=H... 199 2e-49
(Q7MK58) RecName: Full=Histidine ammonia-lyase; Short=H... 199 2e-49
CP000879_234(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 199 3e-49
(Q6AKP3) RecName: Full=Histidine ammonia-lyase; Short=H... 198 4e-49
CP001131_2031(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 197 7e-49
CP000769_1996(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 197 1e-48
CP000270_2934(CP000270|pid:none) Burkholderia xenovorans LB400 c... 196 2e-48
(A9GFW6) RecName: Full=Histidine ammonia-lyase; Short=H... 196 2e-48
(Q5X5I5) RecName: Full=Histidine ammonia-lyase; Short=H... 196 2e-48
(A5IBM2) RecName: Full=Histidine ammonia-lyase; Short=H... 196 2e-48
FP236842_2356(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 196 2e-48
(Q5WWW8) RecName: Full=Histidine ammonia-lyase; Short=H... 196 2e-48
(Q5ZVR0) RecName: Full=Histidine ammonia-lyase; Short=H... 196 3e-48
CP000447_3915(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 195 5e-48
(B8CGY5) RecName: Full=Histidine ammonia-lyase; Short=H... 194 6e-48
CU468135_2224(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 193 1e-47
(Q9RZ06) RecName: Full=Histidine ammonia-lyase; Short=H... 193 2e-47
CP000358_271(CP000358|pid:none) Deinococcus geothermalis DSM 113... 193 2e-47
CP000771_123(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 193 2e-47
CP000926_5050(CP000926|pid:none) Pseudomonas putida GB-1, comple... 192 2e-47
CP000316_1029(CP000316|pid:none) Polaromonas sp. JS666, complete... 192 3e-47
(P21310) RecName: Full=Histidine ammonia-lyase; Short=H... 192 3e-47
(Q8RDU4) RecName: Full=Histidine ammonia-lyase 2; Short... 192 3e-47
(Q5NZX8) RecName: Full=Histidine ammonia-lyase; Short=H... 192 3e-47
A35251(A35251;S39381) histidine ammonia-lyase (EC 4.3.1.3) - Pse... 192 3e-47
CP000083_875(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 192 4e-47
(A8HA91) RecName: Full=Histidine ammonia-lyase; Short=H... 192 4e-47
(Q6LQ56) RecName: Full=Histidine ammonia-lyase; Short=H... 192 4e-47
CP000090_2695(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 192 4e-47
(Q5E0C6) RecName: Full=Histidine ammonia-lyase; Short=H... 191 5e-47
CP000749_3855(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 191 5e-47
(A9WHT8) RecName: Full=Histidine ammonia-lyase; Short=H... 191 5e-47
CP001635_158(CP001635|pid:none) Variovorax paradoxus S110 chromo... 191 7e-47
(Q88CZ7) RecName: Full=Histidine ammonia-lyase; Short=H... 191 7e-47
CP001337_1606(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 191 7e-47
CP000563_4179(CP000563|pid:none) Shewanella baltica OS155, compl... 190 1e-46
CU466930_490(CU466930|pid:none) Candidatus Cloacamonas acidamino... 190 1e-46
CP000753_97(CP000753|pid:none) Shewanella baltica OS185, complet... 190 1e-46
(A6TSX0) RecName: Full=Histidine ammonia-lyase; Short=H... 190 1e-46
CP000606_3749(CP000606|pid:none) Shewanella loihica PV-4, comple... 189 2e-46
(Q1GSH0) RecName: Full=Histidine ammonia-lyase; Short=H... 189 3e-46
(Q8EKJ4) RecName: Full=Histidine ammonia-lyase; Short=H... 189 3e-46
AE017261_107(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 189 3e-46
CP000086_1792(CP000086|pid:none) Burkholderia thailandensis E264... 188 4e-46
(Q2RUU3) RecName: Full=Histidine ammonia-lyase; Short=H... 188 4e-46
CP001114_1685(CP001114|pid:none) Deinococcus deserti VCD115, com... 188 4e-46
(Q8XW29) RecName: Full=Histidine ammonia-lyase; Short=H... 188 4e-46
(Q87UM1) RecName: Full=Histidine ammonia-lyase; Short=H... 188 4e-46
CP000155_3959(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 188 4e-46
AL646052_2644(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 188 4e-46
CP000681_80(CP000681|pid:none) Shewanella putrefaciens CN-32, co... 188 4e-46
CP000444_95(CP000444|pid:none) Shewanella sp. MR-7, complete gen... 188 6e-46
CT573326_4730(CT573326|pid:none) Pseudomonas entomophila str. L4... 188 6e-46
CP000884_148(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 188 6e-46
CP000058_4646(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 188 6e-46
CP001185_93(CP001185|pid:none) Thermosipho africanus TCF52B, com... 187 7e-46
(A3NXA3) RecName: Full=Histidine ammonia-lyase; Short=H... 187 7e-46
(A3NBH0) RecName: Full=Histidine ammonia-lyase; Short=H... 187 7e-46
(Q978N8) RecName: Full=Probable histidine ammonia-lyase; ... 187 7e-46
CP000010_562(CP000010|pid:none) Burkholderia mallei ATCC 23344 c... 187 7e-46
CP001472_2882(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 187 7e-46
AM412319_2(AM412319|pid:none) [Polyangium] brachysporum glidobac... 187 7e-46
(Q5FRR8) RecName: Full=Histidine ammonia-lyase; Short=H... 187 7e-46
CP000124_2757(CP000124|pid:none) Burkholderia pseudomallei 1710b... 187 7e-46
(A1TRE4) RecName: Full=Histidine ammonia-lyase; Short=H... 186 2e-45
(Q983I0) RecName: Full=Histidine ammonia-lyase; Short=H... 186 2e-45
(Q7N296) RecName: Full=Histidine ammonia-lyase; Short=H... 186 2e-45
(A0K8U6) RecName: Full=Histidine ammonia-lyase; Short=H... 186 3e-45
CP000958_2169(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 186 3e-45
(A4JG46) RecName: Full=Histidine ammonia-lyase; Short=H... 185 5e-45
(Q39EP0) RecName: Full=Histidine ammonia-lyase; Short=H... 184 6e-45
CP000353_1422(CP000353|pid:none) Ralstonia metallidurans CH34 me... 184 6e-45
CP000716_1730(CP000716|pid:none) Thermosipho melanesiensis BI429... 184 8e-45
CU207366_1482(CU207366|pid:none) Gramella forsetii KT0803 comple... 184 1e-44
CP000076_399(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 184 1e-44
CP001349_994(CP001349|pid:none) Methylobacterium nodulans ORS 20... 184 1e-44
(Q664B8) RecName: Full=Histidine ammonia-lyase; Short=H... 183 1e-44
(B7V3J1) RecName: Full=Histidine ammonia-lyase; Short=H... 183 1e-44
(Q02ER8) RecName: Full=Histidine ammonia-lyase; Short=H... 183 1e-44
CP000720_4025(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 183 1e-44
CP000091_2161(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 183 1e-44
CP001340_1008(CP001340|pid:none) Caulobacter crescentus NA1000, ... 183 1e-44
AM181176_357(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 183 2e-44
(Q0BDK6) RecName: Full=Histidine ammonia-lyase; Short=H... 183 2e-44
(Q6FZP9) RecName: Full=Histidine ammonia-lyase; Short=H... 182 3e-44
CP000744_5754(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 182 3e-44
AP009385_2113(AP009385|pid:none) Burkholderia multivorans ATCC 1... 182 3e-44
(Q9HLI6) RecName: Full=Probable histidine ammonia-lyase; ... 182 3e-44
CP000159_702(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 182 4e-44
(A1JSW6) RecName: Full=Histidine ammonia-lyase; Short=H... 181 9e-44
CP000943_1558(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 181 9e-44
(Q8K5L5) RecName: Full=Histidine ammonia-lyase; Short=H... 179 3e-43
(Q8NZ46) RecName: Full=Histidine ammonia-lyase; Short=H... 179 3e-43
CP000259_1787(CP000259|pid:none) Streptococcus pyogenes MGAS9429... 179 3e-43
AM295250_2454(AM295250|pid:none) Staphylococcus carnosus subsp. ... 179 3e-43
(A3CL24) RecName: Full=Histidine ammonia-lyase; Short=H... 179 3e-43
CP000387_409(CP000387|pid:none) Streptococcus sanguinis SK36, co... 179 3e-43
(B5XIY2) RecName: Full=Histidine ammonia-lyase; Short=H... 178 4e-43
(Q6G3U8) RecName: Full=Histidine ammonia-lyase; Short=H... 178 4e-43
(A2RGS5) RecName: Full=Histidine ammonia-lyase; Short=H... 178 4e-43
(P58083) RecName: Full=Histidine ammonia-lyase; Short=H... 178 4e-43
(B0SYU6) RecName: Full=Histidine ammonia-lyase; Short=H... 177 1e-42
(A4W8B5) RecName: Full=Histidine ammonia-lyase; Short=H... 176 2e-42
(Q6GD82) RecName: Full=Histidine ammonia-lyase; Short=H... 176 3e-42
(A5INP9) RecName: Full=Histidine ammonia-lyase; Short=H... 176 3e-42
CP001638_267(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 176 3e-42
(Q2YUR3) RecName: Full=Histidine ammonia-lyase; Short=H... 176 3e-42
(Q6GKT7) RecName: Full=Histidine ammonia-lyase; Short=H... 175 4e-42
(A6QD47) RecName: Full=Histidine ammonia-lyase; Short=H... 175 4e-42
AM398681_819(AM398681|pid:none) Flavobacterium psychrophilum JIP... 175 4e-42
CP000680_4041(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 175 4e-42
AM743169_2937(AM743169|pid:none) Stenotrophomonas maltophilia K2... 175 4e-42
CP001407_3577(CP001407|pid:none) Bacillus cereus 03BB102, comple... 175 5e-42
CP001176_3609(CP001176|pid:none) Bacillus cereus B4264, complete... 175 5e-42
(B7ISJ2) RecName: Full=Histidine ammonia-lyase; Short=H... 175 5e-42
(Q6HFE9) RecName: Full=Histidine ammonia-lyase; Short=H... 175 5e-42
(Q637H8) RecName: Full=Histidine ammonia-lyase; Short=H... 175 5e-42
CP000634_784(CP000634|pid:none) Agrobacterium vitis S4 chromosom... 175 5e-42
(Q733H8) RecName: Full=Histidine ammonia-lyase; Short=H... 175 5e-42
(B7HKJ1) RecName: Full=Histidine ammonia-lyase; Short=H... 175 5e-42
CP000685_2565(CP000685|pid:none) Flavobacterium johnsoniae UW101... 174 8e-42
(B5XZ79) RecName: Full=Histidine ammonia-lyase; Short=H... 174 1e-41
CP000139_328(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 174 1e-41
(Q57RG6) RecName: Full=Histidine ammonia-lyase; Short=H... 173 1e-41
CP001127_875(CP001127|pid:none) Salmonella enterica subsp. enter... 173 1e-41
(B0RUX3) RecName: Full=Histidine ammonia-lyase; Short=H... 173 1e-41
CP001111_2545(CP001111|pid:none) Stenotrophomonas maltophilia R5... 173 2e-41
(Q8ZQQ9) RecName: Full=Histidine ammonia-lyase; Short=H... 173 2e-41
(Q8Z896) RecName: Full=Histidine ammonia-lyase; Short=H... 173 2e-41
CS354251_2(CS354251|pid:none) Sequence 113 from Patent WO2006024... 173 2e-41
(A5FZB9) RecName: Full=Histidine ammonia-lyase; Short=H... 173 2e-41
CP000140_3551(CP000140|pid:none) Parabacteroides distasonis ATCC... 172 2e-41
(Q5PG61) RecName: Full=Histidine ammonia-lyase; Short=H... 172 3e-41
(Q8U8Z7) RecName: Full=Histidine ammonia-lyase; Short=H... 172 3e-41
(A8AJ15) RecName: Full=Histidine ammonia-lyase; Short=H... 172 3e-41
CP000542_3568(CP000542|pid:none) Verminephrobacter eiseniae EF01... 172 3e-41
AE013598_2359(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 172 4e-41
(A6T6L1) RecName: Full=Histidine ammonia-lyase; Short=H... 172 4e-41
(Q9KWE4) RecName: Full=Histidine ammonia-lyase; Short=H... 171 7e-41
(Q5L310) RecName: Full=Histidine ammonia-lyase; Short=H... 171 9e-41
CP000739_1066(CP000739|pid:none) Sinorhizobium medicae WSM419 pl... 171 9e-41
AP008229_2278(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 170 1e-40
CP000812_521(CP000812|pid:none) Thermotoga lettingae TMO, comple... 170 1e-40
(O31197) RecName: Full=Histidine ammonia-lyase; Short=H... 170 2e-40
AM420293_6222(AM420293|pid:none) Saccharopolyspora erythraea NRR... 170 2e-40
AM039952_1678(AM039952|pid:none) Xanthomonas campestris pv. vesi... 169 3e-40
(Q162E2) RecName: Full=Histidine ammonia-lyase; Short=H... 169 4e-40
(A4IK90) RecName: Full=Histidine ammonia-lyase; Short=H... 169 4e-40
CP001075_78(CP001075|pid:none) Rhizobium etli CIAT 652 plasmid p... 169 4e-40
AP006841_4137(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 168 5e-40
CP000628_3456(CP000628|pid:none) Agrobacterium radiobacter K84 c... 168 6e-40
(A7ZAE4) RecName: Full=Histidine ammonia-lyase; Short=H... 168 6e-40
CP000560_3522(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 168 6e-40
AM236085_211(AM236085|pid:none) Rhizobium leguminosarum bv. vici... 167 1e-39
CP000137_72(CP000137|pid:none) Rhizobium etli CFN 42 plasmid p42... 167 1e-39
CP000472_131(CP000472|pid:none) Shewanella piezotolerans WP3, co... 167 1e-39
AF032903_2(AF032903|pid:none) Sinorhizobium meliloti imidazolone... 166 2e-39
(A3PK23) RecName: Full=Histidine ammonia-lyase; Short=H... 166 2e-39
(Q2YIL6) RecName: Full=Histidine ammonia-lyase; Short=H... 165 5e-39
(Q8FVB4) RecName: Full=Histidine ammonia-lyase; Short=H... 165 5e-39
(A5VVJ6) RecName: Full=Histidine ammonia-lyase; Short=H... 164 9e-39
(Q8YD09) RecName: Full=Bifunctional imidazolonepropionase/histid... 164 1e-38
(Q11E18) RecName: Full=Histidine ammonia-lyase; Short=H... 164 1e-38
CP000377_3004(CP000377|pid:none) Silicibacter sp. TM1040, comple... 163 1e-38
(A9WVU3) RecName: Full=Histidine ammonia-lyase; Short=H... 163 2e-38
(Q5LRD8) RecName: Full=Histidine ammonia-lyase; Short=H... 162 3e-38
CP000003_1774(CP000003|pid:none) Streptococcus pyogenes MGAS1039... 162 3e-38
CP000269_515(CP000269|pid:none) Janthinobacterium sp. Marseille,... 161 6e-38
CP000509_4345(CP000509|pid:none) Nocardioides sp. JS614, complet... 159 3e-37
(A4YNK7) RecName: Full=Histidine ammonia-lyase; Short=H... 158 5e-37
(Q0AP92) RecName: Full=Histidine ammonia-lyase; Short=H... 158 6e-37
CP000474_379(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 157 1e-36
EU016618_29(EU016618|pid:none) Uncultured marine microorganism H... 156 2e-36
AP009380_1638(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 156 2e-36
CP000454_375(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 155 4e-36
DQ413451_1(DQ413451|pid:none) Staphylococcus aureus strain C101 ... 155 5e-36
DQ413452_1(DQ413452|pid:none) Staphylococcus aureus strain C2 Hu... 154 9e-36
(A5EQB7) RecName: Full=Histidine ammonia-lyase; Short=H... 153 2e-35
CP000352_231(CP000352|pid:none) Ralstonia metallidurans CH34, co... 153 2e-35
CP001628_214(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 153 2e-35
CP000910_1298(CP000910|pid:none) Renibacterium salmoninarum ATCC... 153 2e-35
AP006618_1235(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 152 3e-35
(Q89GV3) RecName: Full=Histidine ammonia-lyase; Short=H... 151 6e-35
AP009152_2297(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 151 8e-35
BA000030_3331(BA000030|pid:none) Streptomyces avermitilis MA-468... 150 1e-34
CP000431_2125(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 150 2e-34
AM236080_4468(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 149 2e-34
AE004091_5089(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 149 4e-34
CP001618_1827(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 147 8e-34
(B0R544) RecName: Full=Probable histidine ammonia-lyase; ... 147 1e-33
AE004437_936(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 147 1e-33
(Q9EWW1) RecName: Full=Histidine ammonia-lyase; Short=H... 146 2e-33
AP009493_2611(AP009493|pid:none) Streptomyces griseus subsp. gri... 145 3e-33
(P24221) RecName: Full=Histidine ammonia-lyase; Short=H... 145 3e-33
CP000094_365(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 145 5e-33
CP000076_398(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 144 7e-33
AY596297_1597(AY596297|pid:none) Haloarcula marismortui ATCC 430... 144 7e-33
AE016853_5148(AE016853|pid:none) Pseudomonas syringae pv. tomato... 144 9e-33
CP000850_2021(CP000850|pid:none) Salinispora arenicola CNS-205, ... 142 3e-32
CT573326_2406(CT573326|pid:none) Pseudomonas entomophila str. L4... 142 4e-32
CP000850_971(CP000850|pid:none) Salinispora arenicola CNS-205, c... 139 3e-31
CP000826_795(CP000826|pid:none) Serratia proteamaculans 568, com... 139 4e-31
AY271660_31(AY271660|pid:none) Actinomadura madurae strain ATCC ... 138 7e-31
CP000667_1092(CP000667|pid:none) Salinispora tropica CNB-440, co... 137 1e-30
AY048670_33(AY048670|pid:none) Streptomyces globisporus enediyne... 134 7e-30
CP000507_3375(CP000507|pid:none) Shewanella amazonensis SB2B, co... 129 2e-28
AM179409_8(AM179409|pid:none) Chondromyces crocatus chondramide ... 129 3e-28
CP000961_4551(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 128 5e-28
CP000628_3460(CP000628|pid:none) Agrobacterium radiobacter K84 c... 128 7e-28
CP000851_3875(CP000851|pid:none) Shewanella pealeana ATCC 700345... 128 7e-28
CP001389_2688(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 127 2e-27
CP000521_494(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 126 2e-27
FM212244_1(FM212244|pid:none) Myxococcus sp. Mx-B0 tam gene for ... 126 2e-27
AY192157_8(AY192157|pid:none) Pantoea agglomerans andrimid biosy... 125 3e-27
CP000821_319(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 125 3e-27
CP001139_842(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 124 8e-27
CP000386_1718(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 124 1e-26
CP000020_845(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 122 4e-26
AE017340_133(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 120 1e-25
CP000852_1513(CP000852|pid:none) Caldivirga maquilingensis IC-16... 120 2e-25
CP000472_286(CP000472|pid:none) Shewanella piezotolerans WP3, co... 120 2e-25
CP000503_292(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 119 4e-25
CP000563_332(CP000563|pid:none) Shewanella baltica OS155, comple... 119 4e-25
CP000144_584(CP000144|pid:none) Rhodobacter sphaeroides 2.4.1 ch... 119 4e-25
CP000753_331(CP000753|pid:none) Shewanella baltica OS185, comple... 119 4e-25
CP000578_259(CP000578|pid:none) Rhodobacter sphaeroides ATCC 170... 119 4e-25
CP000633_387(CP000633|pid:none) Agrobacterium vitis S4 chromosom... 118 5e-25
FM178379_2097(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 118 5e-25
AL591688_2712(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 118 7e-25
BA000031_889(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221... 117 9e-25
BA000037_1074(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 117 1e-24
CP000891_340(CP000891|pid:none) Shewanella baltica OS195, comple... 116 2e-24
CP000685_1104(CP000685|pid:none) Flavobacterium johnsoniae UW101... 116 2e-24
CP001252_336(CP001252|pid:none) Shewanella baltica OS223, comple... 116 2e-24
CP000447_346(CP000447|pid:none) Shewanella frigidimarina NCIMB 4... 116 3e-24
AM236085_221(AM236085|pid:none) Rhizobium leguminosarum bv. vici... 115 4e-24
CP001503_1722(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 115 4e-24
CP001053_828(CP001053|pid:none) Burkholderia phytofirmans PsJN c... 115 6e-24
CP000738_2556(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 114 8e-24
CP000606_3510(CP000606|pid:none) Shewanella loihica PV-4, comple... 114 8e-24
AM743169_4303(AM743169|pid:none) Stenotrophomonas maltophilia K2... 114 1e-23
CP001111_3911(CP001111|pid:none) Stenotrophomonas maltophilia R5... 113 2e-23
CR378675_112(CR378675|pid:none) Photobacterium profundum SS9 chr... 112 3e-23
BA000012_117(BA000012|pid:none) Mesorhizobium loti MAFF303099 DN... 112 4e-23
AM747722_115(AM747722|pid:none) Burkholderia cenocepacia J2315 c... 112 4e-23
CP001069_975(CP001069|pid:none) Ralstonia pickettii 12J chromoso... 111 7e-23
CP000383_2095(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 111 9e-23
CP000380_262(CP000380|pid:none) Burkholderia cenocepacia AU 1054... 111 9e-23
CR954247_387(CR954247|pid:none) Pseudoalteromonas haloplanktis s... 110 1e-22
AE007870_791(AE007870|pid:none) Agrobacterium tumefaciens str. C... 110 2e-22
CP000644_833(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 109 3e-22
CP000943_166(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 109 3e-22
AM398681_2224(AM398681|pid:none) Flavobacterium psychrophilum JI... 109 3e-22
CP000094_433(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 108 6e-22
CP000058_411(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 107 1e-21
CP000442_262(CP000442|pid:none) Burkholderia ambifaria AMMD chro... 107 1e-21
CP001027_103(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 107 1e-21
CP001037_1885(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 106 3e-21
CP000023_1213(CP000023|pid:none) Streptococcus thermophilus LMG ... 105 4e-21
CP000544_1789(CP000544|pid:none) Halorhodospira halophila SL1, c... 105 5e-21
CP000441_384(CP000441|pid:none) Burkholderia ambifaria AMMD chro... 105 5e-21
CP000076_464(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 104 1e-20
CP000875_1874(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 103 2e-20
CP000024_1235(CP000024|pid:none) Streptococcus thermophilus CNRZ... 103 2e-20
CP000117_3967(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 102 3e-20
CP000616_487(CP000616|pid:none) Burkholderia vietnamiensis G4 ch... 102 5e-20
CT573326_319(CT573326|pid:none) Pseudomonas entomophila str. L48... 101 7e-20
CP000629_1089(CP000629|pid:none) Agrobacterium radiobacter K84 c... 101 7e-20
AM236086_744(AM236086|pid:none) Rhizobium leguminosarum bv. vici... 100 2e-19
CP000159_697(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 99 3e-19
EU643477_18(EU643477|pid:none) Adineta vaga clone Av_TEL_K_A ret... 94 1e-17
CP000390_2519(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 94 1e-17
(P45725) RecName: Full=Phenylalanine ammonia-lyase 3; E... 92 5e-17
AL391716_15(AL391716|pid:none) Arabidopsis thaliana DNA chromoso... 92 5e-17
AF250769_1(AF250769|pid:none) Uncultured bacterium pCosHE1 putat... 91 1e-16
CP000386_572(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 91 1e-16
AB042520_1(AB042520|pid:none) Catharanthus roseus mRNA for pheny... 91 2e-16
FB793308_1(FB793308|pid:none) Sequence 12581 from Patent WO20080... 89 5e-16
AY803282_1(AY803282|pid:none) Selaginella kraussiana phenylalani... 89 6e-16
FJ944018_1(FJ944018|pid:none) Litchi chinensis cultivar Nuo Mi C... 88 8e-16
AB283040_1(AB283040|pid:none) Lotus japonicus LjPAL10 mRNA for p... 88 1e-15
AY724736_1(AY724736|pid:none) Taxus chinensis phenylalanine amin... 87 2e-15
S48726(S48726;S56035)phenylalanine ammonia-lyase (EC 4.3.1.5) 3 ... 87 2e-15
(P45729) RecName: Full=Phenylalanine ammonia-lyase 3; E... 87 2e-15
AY724738_1(AY724738|pid:none) Taxus canadensis phenylalanine ami... 87 2e-15
AY724737_1(AY724737|pid:none) Taxus x media phenylalanine aminom... 87 2e-15
CP000487_134(CP000487|pid:none) Campylobacter fetus subsp. fetus... 87 2e-15
(P31426) RecName: Full=Phenylalanine ammonia-lyase 2; E... 86 3e-15
AX366860_1(AX366860|pid:none) Sequence 12 from Patent WO0208402. 86 3e-15
AF480620_1(AF480620|pid:none) Populus tremuloides phenylalanine ... 86 3e-15
FB793532_1(FB793532|pid:none) Sequence 12805 from Patent WO20080... 86 4e-15
AM464698_1(AM464698|pid:none) Vitis vinifera contig VV78X153564.... 86 4e-15
(P45734) RecName: Full=Phenylalanine ammonia-lyase; EC=... 86 4e-15
(O23924) RecName: Full=Phenylalanine ammonia-lyase; EC=... 86 4e-15
AY724735_1(AY724735|pid:none) Taxus chinensis phenylalanine amin... 86 5e-15
EF192469_1(EF192469|pid:none) Vitis vinifera phenylalanin ammoni... 86 5e-15
DQ978787_1(DQ978787|pid:none) Rhizophora mangle putative phenyla... 86 5e-15
AY860427_1(AY860427|pid:none) Rhizophora mangle phenylalanine am... 86 5e-15
AF325496_1(AF325496|pid:none) Ipomoea nil phenylalanine ammonia-... 85 7e-15
DQ073808_1(DQ073808|pid:none) Trifolium pratense phenylalanine a... 85 7e-15
(P45732) RecName: Full=Phenylalanine ammonia-lyase; EC=... 85 7e-15
AY694188_1(AY694188|pid:none) Camellia sinensis phenylalanine am... 85 7e-15
FJ197127_1(FJ197127|pid:none) Garcinia mangostana phenylalanine ... 85 9e-15
AY453842_1(AY453842|pid:none) Stellaria longipes phenylalanine a... 85 9e-15
EU603320_1(EU603320|pid:none) Populus trichocarpa isolate PAL5 p... 85 9e-15
(P25872) RecName: Full=Phenylalanine ammonia-lyase; EC=... 85 9e-15
EU603321_1(EU603321|pid:none) Populus trichocarpa isolate PAL2 p... 85 9e-15
AF237955_1(AF237955|pid:none) Rubus idaeus phenylalanine ammonia... 85 9e-15
DQ073811_1(DQ073811|pid:none) Trifolium pratense phenylalanine a... 85 9e-15
EU603322_1(EU603322|pid:none) Populus trichocarpa isolate PAL4 p... 85 9e-15
AF383151_1(AF383151|pid:none) Manihot esculenta phenylalanine am... 85 9e-15
AB300199_1(AB300199|pid:none) Ephedra sinica Espal1 mRNA for phe... 84 1e-14
DQ883805_1(DQ883805|pid:none) Jatropha curcas phenylalanine ammo... 84 1e-14
EF567076_1(EF567076|pid:none) Astragalus membranaceus phenylalan... 84 1e-14
CP000431_2557(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 84 1e-14
AB283034_1(AB283034|pid:none) Lotus japonicus LjPAL4 mRNA for ph... 84 1e-14
AY541031_1(AY541031|pid:none) Allium cepa phenylalanine lyase mR... 84 1e-14
AB283036_1(AB283036|pid:none) Lotus japonicus LjPAL6 mRNA for ph... 84 1e-14
AB300201_1(AB300201|pid:none) Ephedra sinica Espal3 mRNA for phe... 84 2e-14
FB793296_1(FB793296|pid:none) Sequence 12569 from Patent WO20080... 84 2e-14
EU603319_1(EU603319|pid:none) Populus trichocarpa isolate PAL1 p... 84 2e-14
AC150977_6(AC150977|pid:none) Medicago truncatula clone mth2-32m... 84 2e-14
AM460221_1(AM460221|pid:none) Vitis vinifera contig VV78X085000.... 83 3e-14
AX370659_1(AX370659|pid:none) Sequence 9 from Patent WO0210407. 83 3e-14
(P11544) RecName: Full=Phenylalanine ammonia-lyase; EC=... 83 3e-14
AB300202_1(AB300202|pid:none) Ephedra sinica Espal4 mRNA for phe... 83 3e-14
EU404160_1(EU404160|pid:none) Stylosanthes guianensis phenylalan... 83 3e-14
AB089813_1(AB089813|pid:none) Daucus carota gDcPAL3 gene for phe... 83 3e-14
(P45733) RecName: Full=Phenylalanine ammonia-lyase; EC=... 83 3e-14
DQ073809_1(DQ073809|pid:none) Trifolium pratense phenylalanine a... 83 3e-14
AB289452_1(AB289452|pid:none) Nicotiana tabacum NtPAL mRNA for p... 83 3e-14
A29607(A29607) phenylalanine ammonia-lyase (EC 4.3.1.5) - fungus... 83 3e-14
AX370681_1(AX370681|pid:none) Sequence 31 from Patent WO0210407. 83 3e-14
AB015870_1(AB015870|pid:none) Vitis vinifera gVvPAL1 gene for ph... 83 3e-14
AC144928_6(AC144928|pid:none) Medicago truncatula clone mth2-8a1... 83 3e-14
(O23865) RecName: Full=Phenylalanine ammonia-lyase 1; E... 83 3e-14
DQ445051_1(DQ445051|pid:none) Arnebia euchroma phenylalanine amm... 82 4e-14
AP007151_456(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 82 4e-14
AM418586_1(AM418586|pid:none) Cynara scolymus pal3a gene for phe... 82 4e-14
AB283032_1(AB283032|pid:none) Lotus japonicus LjPAL2 mRNA for ph... 82 4e-14
AB283038_1(AB283038|pid:none) Lotus japonicus LjPAL8 mRNA for ph... 82 4e-14
AB283035_1(AB283035|pid:none) Lotus japonicus LjPAL5 mRNA for ph... 82 4e-14
AY372451_1(AY372451|pid:none) Populus balsamifera subsp. trichoc... 82 4e-14
(Q43052) RecName: Full=Phenylalanine ammonia-lyase G2B; ... 82 6e-14
AY803286_1(AY803286|pid:none) Ophioglossum reticulatum phenylala... 82 6e-14
AF480619_1(AF480619|pid:none) Populus tremuloides phenylalanine ... 82 7e-14
AJ278116_1(AJ278116|pid:none) Betula pendula partial pal1 gene f... 82 7e-14
(P14166) RecName: Full=Phenylalanine ammonia-lyase; EC=... 82 7e-14
FJ593634_1(FJ593634|pid:none) Phyllostachys dulcis phenylalanine... 82 7e-14
FJ596640_1(FJ596640|pid:none) Phyllostachys angusta phenylalanin... 82 7e-14
(P19143) RecName: Full=Phenylalanine ammonia-lyase class 3; ... 82 7e-14
(P26600) RecName: Full=Phenylalanine ammonia-lyase; Sho... 81 1e-13
AJ278454_1(AJ278454|pid:none) Juglans nigra mRNA for partial phe... 81 1e-13
AJ238753_1(AJ238753|pid:none) Citrus clementina X Citrus reticul... 81 1e-13
CP000822_2853(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 81 1e-13
AY986506_1(AY986506|pid:none) Astragalus membranaceus var. mongh... 81 1e-13
EU972101_1(EU972101|pid:none) Zea mays clone 375012 phenylalanin... 81 1e-13
(P35510) RecName: Full=Phenylalanine ammonia-lyase 1; E... 81 1e-13
L33677_1(L33677|pid:none) Arabidopsis thaliana (strain Landsberg... 81 1e-13
(P35513) RecName: Full=Phenylalanine ammonia-lyase; EC=... 81 1e-13
D30656_1(D30656|pid:none) Populus sieboldii x Populus grandident... 81 1e-13
BT054938_1(BT054938|pid:none) Zea mays full-length cDNA clone ZM... 81 1e-13
AY321088_1(AY321088|pid:none) Pinus pinaster phenylalanine ammon... 81 1e-13
FJ594466_1(FJ594466|pid:none) Euphorbia pulcherrima cultivar Ear... 81 1e-13
(P27990) RecName: Full=Phenylalanine ammonia-lyase; EC=... 81 1e-13
AF460203_1(AF460203|pid:none) Coffea canephora phenylalanine amm... 81 1e-13
(P19142) RecName: Full=Phenylalanine ammonia-lyase class 2; ... 80 2e-13
AM484129_3(AM484129|pid:none) Vitis vinifera contig VV78X269098.... 80 2e-13
FB793476_1(FB793476|pid:none) Sequence 12749 from Patent WO20080... 80 2e-13
CP000851_3559(CP000851|pid:none) Shewanella pealeana ATCC 700345... 80 2e-13
AP008208_1905(AP008208|pid:none) Oryza sativa (japonica cultivar... 80 2e-13
AY450643_1(AY450643|pid:none) Bambusa oldhamii phenylalanine amm... 80 2e-13
CP000390_2604(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 80 2e-13
(Q42667) RecName: Full=Phenylalanine ammonia-lyase; EC=... 80 2e-13
CU633457_126(CU633457|pid:none) Podospora anserina genomic DNA c... 80 2e-13
FB793298_1(FB793298|pid:none) Sequence 12571 from Patent WO20080... 80 2e-13
DQ468345_1(DQ468345|pid:none) Isatis tinctoria phenylalanine amm... 80 3e-13
AM236080_373(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 80 3e-13
(P10248) RecName: Full=Phenylalanine ammonia-lyase; EC=... 80 3e-13
CP001074_381(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 80 3e-13
AF353967_1(AF353967|pid:none) Pinus sylvestris isolate Bro1 phen... 79 4e-13
AF353981_1(AF353981|pid:none) Pinus sylvestris isolate Kir30 phe... 79 4e-13
(O04058) RecName: Full=Phenylalanine ammonia-lyase; EC=... 79 4e-13
EU957015_1(EU957015|pid:none) Zea mays clone 1580529 phenylalani... 79 4e-13
AP008218_991(AP008218|pid:none) Oryza sativa (japonica cultivar-... 79 4e-13
EF189195_1(EF189195|pid:none) Saccharum officinarum phenylalanin... 79 4e-13
AF383152_1(AF383152|pid:none) Manihot esculenta phenylalanine am... 79 4e-13
EU402423_1(EU402423|pid:none) Brassica rapa subsp. campestris ph... 79 4e-13
AB283031_1(AB283031|pid:none) Lotus japonicus LjPAL1 mRNA for ph... 79 5e-13
FB793542_1(FB793542|pid:none) Sequence 12815 from Patent WO20080... 79 5e-13
AJ289609_1(AJ289609|pid:none) Betula pendula partial pal2 gene f... 79 5e-13
AY803283_1(AY803283|pid:none) Equisetum arvense phenylalanine am... 79 6e-13
AM270302_30(AM270302|pid:none) Aspergillus niger contig An13c008... 79 6e-13
EF070337_1(EF070337|pid:none) Rudbeckia hirta phenylalanine ammo... 79 6e-13
AM265583_1(AM265583|pid:none) Picea abies partial mRNA for pheny... 79 6e-13
AY641535_1(AY641535|pid:none) Pinus pinaster phenylalanine ammon... 79 6e-13
AF401636_1(AF401636|pid:none) Rehmannia glutinosa phenylalanine ... 79 6e-13
AM420293_4758(AM420293|pid:none) Saccharopolyspora erythraea NRR... 79 6e-13
AP007164_528(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 79 6e-13
AF411134_1(AF411134|pid:none) Lactuca sativa phenylalanine ammon... 78 8e-13
AM418587_1(AM418587|pid:none) Cynara scolymus partial pal3b gene... 78 8e-13
S28185(S28185)phenylalanine ammonia-lyase (EC 4.3.1.5) - rice 78 8e-13
EF462460_1(EF462460|pid:none) Salvia miltiorrhiza phenylalanine ... 78 8e-13
AF218453_1(AF218453|pid:none) Coffea arabica clone 369.1.6r phen... 78 1e-12
AC133008_20(AC133008|pid:none) Oryza sativa (japonica cultivar-g... 78 1e-12
FB793534_1(FB793534|pid:none) Sequence 12807 from Patent WO20080... 78 1e-12
EU402424_1(EU402424|pid:none) Brassica rapa subsp. campestris ph... 78 1e-12
AF460204_1(AF460204|pid:none) Coffea canephora phenylalanine amm... 78 1e-12
(P45731) RecName: Full=Phenylalanine ammonia-lyase G1; ... 78 1e-12
FB793304_1(FB793304|pid:none) Sequence 12577 from Patent WO20080... 77 1e-12
M83314_1(M83314|pid:none) Lycopersicon esculentum phenylalanine ... 77 1e-12
(P35511) RecName: Full=Phenylalanine ammonia-lyase; Sho... 77 1e-12
CP001191_4320(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 77 1e-12
AY795079_1(AY795079|pid:none) Brassica napus phenylalanine ammon... 77 2e-12
AY803279_1(AY803279|pid:none) Huperzia lucidula phenylalanine am... 77 2e-12
EU970905_1(EU970905|pid:none) Zea mays clone 353699 phenylalanin... 77 2e-12
DQ341308_1(DQ341308|pid:none) Brassica napus phenylalanine ammon... 77 2e-12
FB793372_1(FB793372|pid:none) Sequence 12645 from Patent WO20080... 77 2e-12
(Q01861) RecName: Full=Phenylalanine ammonia-lyase 1; E... 77 2e-12
FB793300_1(FB793300|pid:none) Sequence 12573 from Patent WO20080... 77 2e-12
AY860428_1(AY860428|pid:none) Rhizophora mangle phenylalanine am... 77 2e-12
FJ596641_1(FJ596641|pid:none) Pleioblastus maculosoides phenylal... 77 2e-12
FJ593636_1(FJ593636|pid:none) Phyllostachys iridescens phenylala... 77 2e-12
AJ810175_1(AJ810175|pid:none) Beta vulgaris pal gene for phenyla... 77 2e-12
FJ594467_1(FJ594467|pid:none) Phyllostachys edulis phenylalanine... 77 2e-12
(P45724) RecName: Full=Phenylalanine ammonia-lyase 2; E... 77 2e-12
AY092957_1(AY092957|pid:none) Arabidopsis thaliana phenylalanine... 77 2e-12
BT062346_1(BT062346|pid:none) Zea mays full-length cDNA clone ZM... 76 3e-12
FB793292_1(FB793292|pid:none) Sequence 12565 from Patent WO20080... 76 3e-12
X62747_1(X62747|pid:none) A.thaliana PAL1 gene for phenylalanine... 76 3e-12
AF165998_1(AF165998|pid:none) Vigna unguiculata phenylalanine am... 76 4e-12
FB793538_1(FB793538|pid:none) Sequence 12811 from Patent WO20080... 76 4e-12
AY055752_1(AY055752|pid:none) Brassica rapa subsp. pekinensis ph... 76 4e-12
AY803289_1(AY803289|pid:none) Pellia epiphylla phenylalanine amm... 76 4e-12
(Q42858) RecName: Full=Phenylalanine ammonia-lyase; EC=... 76 4e-12
EF678408_1(EF678408|pid:none) Picea sitchensis clone WS0291_C05 ... 76 4e-12
FB793352_1(FB793352|pid:none) Sequence 12625 from Patent WO20080... 76 4e-12
FJ715635_1(FJ715635|pid:none) Bambusa oldhamii phenylalanine amm... 76 4e-12
(Q42609) RecName: Full=Phenylalanine ammonia-lyase; EC=... 75 5e-12
EF110924_1(EF110924|pid:none) Astragalus membranaceus var. mongh... 75 5e-12
(P45727) RecName: Full=Phenylalanine ammonia-lyase; EC=... 75 7e-12
AP009325_8(AP009325|pid:none) Musa balbisiana genomic DNA, BAC c... 75 7e-12
AM418560_1(AM418560|pid:none) Cynara scolymus partial pal1 gene ... 75 7e-12
AM454539_1(AM454539|pid:none) Vitis vinifera contig VV78X235714.... 74 1e-11
BT041432_1(BT041432|pid:none) Zea mays full-length cDNA clone ZM... 74 1e-11
EF501766_1(EF501766|pid:none) Scutellaria baicalensis phenylalan... 74 2e-11
FJ864336_1(FJ864336|pid:none) Populus simonii x Populus nigra ph... 74 2e-11
AJ276132_1(AJ276132|pid:none) Beta vulgaris partial mRNA for phe... 74 2e-11
AY803280_1(AY803280|pid:none) Lycopodium tristachyum phenylalani... 74 2e-11
FB793306_1(FB793306|pid:none) Sequence 12579 from Patent WO20080... 74 2e-11
AE014299_2979(AE014299|pid:none) Shewanella oneidensis MR-1, com... 74 2e-11
EU856392_1(EU856392|pid:none) Musa acuminata cultivar Calcutta 4... 74 2e-11
(Q96V77) RecName: Full=Phenylalanine ammonia-lyase; EC=... 74 2e-11
AE014299_3210(AE014299|pid:none) Shewanella oneidensis MR-1, com... 74 2e-11
FB793354_1(FB793354|pid:none) Sequence 12627 from Patent WO20080... 74 2e-11
AY803288_1(AY803288|pid:none) Pteridium aquilinum phenylalanine ... 74 2e-11
FB793360_1(FB793360|pid:none) Sequence 12633 from Patent WO20080... 73 3e-11
AY803285_1(AY803285|pid:none) Botrychium virginianum phenylalani... 73 3e-11
AF306551_1(AF306551|pid:none) Ustilago maydis phenylalanine ammo... 73 3e-11
CP000390_2600(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 73 3e-11
EU071050_1(EU071050|pid:none) Ginkgo biloba phenylalanine ammoni... 73 3e-11
CP000931_3916(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 73 3e-11
DQ078280_1(DQ078280|pid:none) Ulmus pumila phenylalanine ammonia... 73 3e-11
EU856393_1(EU856393|pid:none) Musa acuminata AAA Group cultivar ... 73 3e-11
L33678_1(L33678|pid:none) Arabidopsis thaliana (strain Columbia)... 72 4e-11
EF549578_1(EF549578|pid:none) Phyllostachys edulis phenylalanine... 72 4e-11
AF304366_1(AF304366|pid:none) Rubus idaeus phenylalanine ammonia... 72 4e-11
AE006469_168(AE006469|pid:none) Sinorhizobium meliloti 1021 plas... 72 4e-11
EU955384_1(EU955384|pid:none) Zea mays clone 1530368 phenylalani... 72 6e-11
AY803287_1(AY803287|pid:none) Blechnum spicant phenylalanine amm... 72 6e-11
CP000317_276(CP000317|pid:none) Polaromonas sp. JS666 plasmid 1,... 72 6e-11
CP000628_446(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 72 8e-11
AB041361_1(AB041361|pid:none) Dianthus caryophyllus Dcpal1 mRNA ... 72 8e-11
AY803284_1(AY803284|pid:none) Psilotum nudum phenylalanine ammon... 72 8e-11
BA000030_3511(BA000030|pid:none) Streptomyces avermitilis MA-468... 72 8e-11
>BC115354_1(BC115354|pid:none) Danio rerio hypothetical protein
LOC100004331, mRNA (cDNA clone MGC:136980 IMAGE:8000404),
complete cds.
Length = 654
Score = 301 bits (772), Expect = 3e-80
Identities = 160/258 (62%), Positives = 193/258 (74%)
Frame = +1
Query: 748 N*IERKGRSCID*XXXXPSEITLANKDTKKVQDSYTLRCVPQVHGIVFDTIDFVQGIINT 927
N + + RS +D PSEI +++ +VQD+YT+RC PQVHGIV DTI+FV+ IINT
Sbjct: 362 NEVAMRFRSLLD-SDHHPSEIAESHRFCDRVQDAYTMRCCPQVHGIVNDTIEFVKKIINT 420
Query: 928 EMNSATDNPMVFDTDELCGTISGGNFHGEYPAKALDYLTIGIHELSNISERRLERLVNSQ 1107
E+NSATDNPMVF E TISGGNFHGEYPAKALDYL IG+HEL++ISERR+ERL N
Sbjct: 421 EINSATDNPMVFA--ERGETISGGNFHGEYPAKALDYLAIGVHELASISERRIERLCNPS 478
Query: 1108 LSDGLPSFLVNGGGLNSGFMIAHCTSAALVSENKVLVHPSSADTISTSSAKEDHVSMGGW 1287
LS+ LP+FLVN GGLNSGFMIAHCT+AALVSENKVL HPSS D++STS+A EDHVSMGGW
Sbjct: 479 LSE-LPAFLVNEGGLNSGFMIAHCTAAALVSENKVLCHPSSIDSLSTSAATEDHVSMGGW 537
Query: 1288 SARKCXXXXXXXXXXXXXXXXAACQGLDFRRPLKTTEPLEAVYQLVRSKVTFMDKDRFIQ 1467
+ARK AACQG++F RPL+TT PLE VY LVR+ V KDRF+
Sbjct: 538 AARKALRVVEHVEQVLAIELLAACQGIEFLRPLRTTTPLEKVYDLVRAAVKPWIKDRFMA 597
Query: 1468 PDIEEVYKLIRSGQVLNV 1521
PDIE V++L+ +V N+
Sbjct: 598 PDIEAVHRLLVDQKVWNI 615
Score = 206 bits (525), Expect = 2e-51
Identities = 110/212 (51%), Positives = 143/212 (67%)
Frame = +2
Query: 149 VYLNGNTLKIEDLINIGYRGYNVSITQEVEELIQKGRNVIDDILKSEKTVYGINTGFGLF 328
+ L+GN+L DL+N+G Y + +T E E+ + + R ++D I+K K VYGI TGFG F
Sbjct: 114 ITLDGNSLTSTDLVNLGKGLYKIKLTPEAEQKVVESRELLDTIVKENKVVYGITTGFGKF 173
Query: 329 SDVIIPPDQVKMLQVNLIRSHSSGVGTPLTPERTRMLLALRINVLTKGYSGITLETVKRA 508
+ +IP ++K LQ NL+RSHSSG+G+PL+PERTRMLLALRINVL KG+SG++ ET+
Sbjct: 174 ARTVIPVSKLKELQENLLRSHSSGLGSPLSPERTRMLLALRINVLAKGHSGVSPETLHSM 233
Query: 509 IKILNGNCLPLVPEKGTVGASGDLAPLSHLALGMMGEGKMYDFGDSGNTFTSNLDVDVLE 688
I+ N +CL VPEKGTVGASGDLAPLSHLALG+MGEGKM+ SG
Sbjct: 234 IQAFNASCLSYVPEKGTVGASGDLAPLSHLALGLMGEGKMWS-PKSG------------- 279
Query: 689 YRNFKFSPANEILKRQNLTPIELNAKEGLALI 784
++ A +L+ L PI L KEGLALI
Sbjct: 280 -----WADAKYVLEAHGLKPISLKPKEGLALI 306
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,353,507,869
Number of extensions: 46004531
Number of successful extensions: 122696
Number of sequences better than 10.0: 594
Number of HSP's gapped: 121233
Number of HSP's successfully gapped: 1098
Length of query: 537
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 404
Effective length of database: 620,718,517
Effective search space: 250770280868
Effective search space used: 250770280868
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
1 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
3 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
1 |
| FC (DIR, S) |
1 |
| FC-IC (SUB) |
0 |