Contig-U16093-1 |
Contig ID |
Contig-U16093-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
gap included |
Contig length |
1020 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
4899973 |
End point |
4899063 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
29 |
Number of EST |
31 |
Link to clone list |
U16093 |
List of clone(s) |
est1=SSH884Z,1,594 est2=VSH825F,47,557 est3=SLD255E,52,728 est4=SLD679F,52,378 est5=SSJ541F,52,858 est6=VSD723F,52,705 est7=VSD875Z,60,700 est8=SSA331F,71,673 est9=SSA525F,77,690 est10=SSA536Z,85,740 est11=SSJ840E,96,715 est12=SSD536F,97,635 est13=FC-AN11E,124,751 est14=FC-AU02F,124,469 est15=SSF221F,125,801 est16=VSF294Z,136,699 est17=VSE134Z,147,737 est18=SSF161Z,154,717 est19=SSJ286E,236,736 est20=SSM178Z,291,840 est21=VSB223Z,299,856 est22=SSK446Z,302,845 est23=SSB346Z,328,737 est24=VSB544E,336,763 est25=FC-AU02Z,344,746 est26=SSL251F,352,730 est27=SSM858Z,402,746 est28=SSB545Z,404,818 est29=SSK127E,423,751 est30=SSG227E,482,720 est31=SLD679Z,859,1020
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 3.12 |
Homology vs DNA |
Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d (1030 letters)
Database: ddbj_B 98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AU076328) Dictyostelium discoideum slug cDNA, clone SSA331. 519 0.0 3 (AU264463) Dictyostelium discoideum vegetative cDNA clone:VS... 519 0.0 3 (C89661) Dictyostelium discoideum slug cDNA, clone SSA536. 519 0.0 3 (C91224) Dictyostelium discoideum slug cDNA, clone SSJ840. 519 0.0 3 (C22927) Dictyostelium discoideum gamete cDNA, clone FC-AN11. 519 0.0 2 (AU264693) Dictyostelium discoideum vegetative cDNA clone:VS... 496 0.0 3 (AU265008) Dictyostelium discoideum vegetative cDNA clone:VS... 505 0.0 2 (AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 359 0.0 7 (AU262896) Dictyostelium discoideum vegetative cDNA clone:VS... 519 0.0 2 (C92591) Dictyostelium discoideum slug cDNA, clone SSF161. 519 0.0 2 (AU038572) Dictyostelium discoideum slug cDNA, clone SSH884. 375 0.0 3 (AU052401) Dictyostelium discoideum slug cDNA, clone SLD255. 519 0.0 2 (AU268034) Dictyostelium discoideum vegetative cDNA clone:VS... 363 0.0 3 (C90901) Dictyostelium discoideum slug cDNA, clone SSJ286. 509 e-173 2 (AU261902) Dictyostelium discoideum vegetative cDNA clone:VS... 519 e-151 2 (AU262086) Dictyostelium discoideum vegetative cDNA clone:VS... 519 e-143 1 (AU038944) Dictyostelium discoideum slug cDNA, clone SSM178. 519 e-143 1 (C91563) Dictyostelium discoideum slug cDNA, clone SSK446. 519 e-143 1 (C93235) Dictyostelium discoideum slug cDNA, clone SSM858. 517 e-142 1 (AU037159) Dictyostelium discoideum slug cDNA, clone SSB545. 496 e-136 1 (C91363) Dictyostelium discoideum slug cDNA, clone SSK127. 478 e-130 1 (C24393) Dictyostelium discoideum gamete cDNA, clone FC-AU02. 472 e-128 1 (AU051864) Dictyostelium discoideum slug cDNA, clone SSB346. 359 e-123 2 (AU072154) Dictyostelium discoideum slug cDNA, clone SSD536. 414 e-111 1 (AU061287) Dictyostelium discoideum slug cDNA, clone SLD679. 363 e-106 2 (AU061115) Dictyostelium discoideum slug cDNA, clone SLD255. 363 e-106 2 (AU072685) Dictyostelium discoideum slug cDNA, clone SSA525. 363 e-106 2 (C24392) Dictyostelium discoideum gamete cDNA, clone FC-AU02. 361 e-103 2 (AU074553) Dictyostelium discoideum slug cDNA, clone SSL251. 379 e-100 1 (AU074110) Dictyostelium discoideum slug cDNA, clone SSJ541. 339 4e-99 2 (C89711) Dictyostelium discoideum slug cDNA, clone SSG227. 361 3e-95 1 (AU072844) Dictyostelium discoideum slug cDNA, clone SSF221. 202 2e-47 1 (AU052646) Dictyostelium discoideum slug cDNA, clone SLD679. 198 3e-46 1 (AU265007) Dictyostelium discoideum vegetative cDNA clone:VS... 56 4e-05 2 (AM848091) Nicotiana tabacum EST, clone nt002175091. 42 1e-04 2 (AM820119) Nicotiana tabacum EST, clone nt002162050. 42 1e-04 2 (DW273701) UI-S-GS1-act-m-08-0-UI.s1 UI-S-GS1 Euprymna scolo... 44 2e-04 2 (DY894386) CeleSEQ13945 Cunninghamella elegans pBluescript (... 38 0.28 3 (DY891950) CeleSEQ8718 Cunninghamella elegans pBluescript (E... 38 0.34 3 (FE248298) CAPH1605.rev CAPH Naegleria gruberi amoeba stage ... 38 0.47 2 (FE258248) CAPH7046.rev CAPH Naegleria gruberi amoeba stage ... 38 0.47 2 (FE259435) CAPH7689.rev CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FE250643) CAPH2973.fwd CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FE259436) CAPH7689.fwd CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FE250642) CAPH2973.rev CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FE250422) CAPH2842.rev CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FE258249) CAPH7046.fwd CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FE250423) CAPH2842.fwd CAPH Naegleria gruberi amoeba stage ... 38 0.48 2 (FC815833) Sr_pAMT7_04e21_T7 S. ratti mixed stage pAMP Stron... 48 0.66 1 (FC810427) Sr_pASP6_04e21_SP6 S. ratti mixed stage pAMP Stro... 48 0.66 1 (CU914218) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 2.6 1 (CL323722) RPCI44_458N18.r RPCI-44 Sus scrofa genomic clone ... 46 2.6 1 (FE658507) CBYZ9670.g1 CBYZ Panicum virgatum Kanlow 4 day ol... 46 2.6 1 (FE635929) CBYY13209.g1 CBYY Panicum virgatum Kanlow crown P... 46 2.6 1 (ES748739) BGBV-aad38e03.g1 Snail_EST_pSMART Biomphalaria gl... 36 6.2 2
>(AU076328) Dictyostelium discoideum slug cDNA, clone SSA331. Length = 600
Score = 519 bits (262), Expect(3) = 0.0 Identities = 262/262 (100%) Strand = Plus / Plus
Query: 401 gggatccagcttccgattatatggccggttacatgatgtttggtgccggtatcactgttg 460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 329 gggatccagcttccgattatatggccggttacatgatgtttggtgccggtatcactgttg 388
Query: 461 gtctttgtaatgttttttcaggtgtttgcgtaggtattgctggtagtggttgtgcattgg 520 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 389 gtctttgtaatgttttttcaggtgtttgcgtaggtattgctggtagtggttgtgcattgg 448
Query: 521 gtgacgctcaaaatccatcactttttgttaaaatgcttattattgaaattttcgctggtg 580 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 449 gtgacgctcaaaatccatcactttttgttaaaatgcttattattgaaattttcgctggtg 508
Query: 581 ccttaggtctttacgctgttattgtcggtattcttatgacaactaacgctcttggtgtca 640 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 509 ccttaggtctttacgctgttattgtcggtattcttatgacaactaacgctcttggtgtca 568
Query: 641 cacaacaacctgcactcaaacc 662 |||||||||||||||||||||| Sbjct: 569 cacaacaacctgcactcaaacc 590
Score = 363 bits (183), Expect(3) = 0.0 Identities = 183/183 (100%) Strand = Plus / Plus
Query: 123 agataataactattatgatcaaggtacttatttccttgtaactatatccccatcaacatg 182 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 51 agataataactattatgatcaaggtacttatttccttgtaactatatccccatcaacatg 110
Query: 183 ggctgcacttggtattggcctttcattagccttatcagttgttggttcagcttggggtat 242 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 111 ggctgcacttggtattggcctttcattagccttatcagttgttggttcagcttggggtat 170
Query: 243 ttgggtcactgcatcatcacttatgggtgctgccgttaaagaaccaagaattcgttcaaa 302 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 171 ttgggtcactgcatcatcacttatgggtgctgccgttaaagaaccaagaattcgttcaaa 230
Query: 303 aaa 305 ||| Sbjct: 231 aaa 233
Score = 56.0 bits (28), Expect(3) = 0.0 Identities = 28/28 (100%) Strand = Plus / Plus
Query: 89 atgcctgatattaatccacttactccaa 116 |||||||||||||||||||||||||||| Sbjct: 19 atgcctgatattaatccacttactccaa 46
Score = 85.7 bits (43), Expect = 3e-12 Identities = 81/94 (86%) Strand = Plus / Plus
Query: 869 aaattttcgttgttcccttaggtctttaccctgttattgccgntattcttttgccaacta 928 ||||||||| || | |||||||||||||| ||||||||| || ||||||| || |||||| Sbjct: 494 aaattttcgctggtgccttaggtctttacgctgttattgtcggtattcttatgacaacta 553
Query: 929 ccgctcttgttgtcacacaccaccctccactcaa 962 |||||||| ||||||||| || ||| ||||||| Sbjct: 554 acgctcttggtgtcacacaacaacctgcactcaa 587
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number of Hits to DB: 567,503,501 Number of extensions: 28615373 Number of successful extensions: 1909128 Number of sequences better than 10.0: 55 Length of query: 1030 Length of database: 98,766,808,389 Length adjustment: 24 Effective length of query: 1006 Effective length of database: 96,409,374,237 Effective search space: 96987830482422 Effective search space used: 96987830482422 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7.20 |
Homology vs Protein |
Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d (1030 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AC116956_4(AC116956|pid:none) Dictyostelium discoideum chromosom... 320 1e-86 (Q2TA24) RecName: Full=V-type proton ATPase 21 kDa proteolipid s... 173 1e-41 AY892285_1(AY892285|pid:none) Synthetic construct Homo sapiens c... 173 1e-41 DQ347602_1(DQ347602|pid:none) Bos taurus clone H37 ATP6V0B mRNA,... 173 1e-41 DQ217212_1(DQ217212|pid:none) Taeniopygia guttata clone 0058P003... 172 1e-41 (Q91V37) RecName: Full=V-type proton ATPase 21 kDa proteolipid s... 171 3e-41 BC030393_1(BC030393|pid:none) Mus musculus ATPase, H+ transporti... 171 3e-41 EF146183_1(EF146183|pid:none) Populus trichocarpa clone WS0116_A... 170 7e-41 BC091622_1(BC091622|pid:none) Xenopus tropicalis ATPase, H+ tran... 170 9e-41 BT075706_1(BT075706|pid:none) Osmerus mordax clone omor-rgc-508-... 168 2e-40 EF214934_1(EF214934|pid:none) Callithrix jacchus clone I13-50.1_... 168 2e-40 BT046064_1(BT046064|pid:none) Salmo salar clone ssal-rgf-540-240... 168 3e-40 BT082548_1(BT082548|pid:none) Anoplopoma fimbria clone afim-evh-... 167 6e-40 BT082862_1(BT082862|pid:none) Anoplopoma fimbria clone afim-evh-... 165 2e-39 AM461480_5(AM461480|pid:none) Vitis vinifera contig VV78X276202.... 164 6e-39 AY226999_1(AY226999|pid:none) Citrus limon vacuolar membrane ATP... 164 6e-39 AY462241_1(AY462241|pid:none) Xerophyta viscosa V-ATPase subunit... 162 2e-38 AK059810_1(AK059810|pid:none) Oryza sativa Japonica Group cDNA c... 162 2e-38 AC006053_6(AC006053|pid:none) Arabidopsis thaliana chromosome 2 ... 161 4e-38 EF084521_1(EF084521|pid:none) Picea sitchensis clone WS0287_D02 ... 160 7e-38 CP000581_299(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 160 9e-38 CR954201_272(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 159 2e-37 CP001326_505(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 158 3e-37 AB000919_1(AB000919|pid:none) Caenorhabditis elegans mRNA for VH... 157 4e-37 AC008146_11(AC008146|pid:none) Trypanosoma brucei chromosome 6 c... 156 1e-36 DQ311242_1(DQ311242|pid:none) Bombyx mori vacuolar ATP synthase ... 156 1e-36 CU638744_455(CU638744|pid:none) Podospora anserina genomic DNA c... 155 2e-36 AK340112_1(AK340112|pid:none) Acyrthosiphon pisum ACYPI006833 mR... 154 4e-36 BT080643_1(BT080643|pid:none) Caligus clemensi clone ccle-evs-50... 152 2e-35 BT081013_1(BT081013|pid:none) Caligus clemensi clone ccle-evs-50... 151 3e-35 AP007161_230(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 149 1e-34 CT005267_390(CT005267|pid:none) Leishmania major strain Friedlin... 149 2e-34 BT080892_1(BT080892|pid:none) Caligus clemensi clone ccle-evs-52... 148 3e-34 AM494967_369(AM494967|pid:none) Leishmania braziliensis chromoso... 147 6e-34 FM992688_1216(FM992688|pid:none) Candida dubliniensis CD36 chrom... 144 7e-33 AE014297_1990(AE014297|pid:none) Drosophila melanogaster chromos... 142 1e-32 CU928179_660(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 142 2e-32 CR382137_692(CR382137|pid:none) Debaryomyces hansenii strain CBS... 141 3e-32 (P23968) RecName: Full=V-type proton ATPase subunit c''; ... 138 4e-31 AE016816_275(AE016816|pid:none) Ashbya gossypii (= Eremothecium ... 136 1e-30 CR380956_21(CR380956|pid:none) Candida glabrata strain CBS138 ch... 136 1e-30 CR940353_762(CR940353|pid:none) Theileria annulata strain Ankara... 130 6e-29 AM910993_168(AM910993|pid:none) Plasmodium knowlesi strain H chr... 129 1e-28 AM920436_293(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 125 2e-27 DQ347563_1(DQ347563|pid:none) Bos taurus H+-transporting lysosom... 119 2e-25 AY185518_1(AY185518|pid:none) Gossypium barbadense clone 1__2 pu... 105 3e-21 AK220736_1(AK220736|pid:none) Arabidopsis thaliana mRNA for H+-t... 93 2e-17 AY826922_1(AY826922|pid:none) Heterocapsa triquetra clone HTVATP... 92 3e-17 (Q26250) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 88 6e-16 EU930293_1(EU930293|pid:none) Simulium vittatum clone SV-524 vac... 88 6e-16 CR382132_1019(CR382132|pid:none) Yarrowia lipolytica strain CLIB... 87 7e-16 (P31403) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 87 1e-15 (P55277) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 86 2e-15 (Q612A5) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 86 2e-15 S40714(S40714;T37236;T37270)probable H+-exporting ATPase (EC 3.6... 86 2e-15 (P34546) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 86 2e-15 (P54642) RecName: Full=V-type proton ATPase proteolipid subunit;... 86 2e-15 EF639070_1(EF639070|pid:none) Triatoma infestans clone TI-99 vac... 85 4e-15 DQ215922_1(DQ215922|pid:none) Taeniopygia guttata clone 0063P002... 85 4e-15 BT075745_1(BT075745|pid:none) Osmerus mordax clone omor-eva-507-... 85 5e-15 BT077411_1(BT077411|pid:none) Lepeophtheirus salmonis Pacific fo... 85 5e-15 BC152275_1(BC152275|pid:none) Danio rerio ATPase, H+ transportin... 85 5e-15 AE017351_329(AE017351|pid:none) Cryptococcus neoformans var. neo... 85 5e-15 AB003939_1(AB003939|pid:none) Acetabularia acetabulum mRNA for v... 85 5e-15 BC067156_1(BC067156|pid:none) Danio rerio ATPase, H+ transportin... 85 5e-15 FJ438503_1(FJ438503|pid:none) Epinephelus coioides atp6v0c-like ... 84 6e-15 BT022884_1(BT022884|pid:none) Drosophila melanogaster IP07464 fu... 84 6e-15 AB069689_1(AB069689|pid:none) Aspergillus oryzae vmaC gene for v... 84 6e-15 (Q03105) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 84 8e-15 EF082355_1(EF082355|pid:none) Picea sitchensis clone WS0278_L17 ... 84 8e-15 CU640366_298(CU640366|pid:none) Podospora anserina genomic DNA c... 84 8e-15 (P23956) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 84 8e-15 (O18882) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 84 8e-15 BC059745_1(BC059745|pid:none) Xenopus tropicalis ATPase, H+ tran... 84 8e-15 BC065849_1(BC065849|pid:none) Danio rerio zgc:77708, mRNA (cDNA ... 84 1e-14 AB003937_1(AB003937|pid:none) Acetabularia acetabulum mRNA for v... 84 1e-14 AF008924_1(AF008924|pid:none) Aedes aegypti V-ATPase C-subunit m... 84 1e-14 (Q17046) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 84 1e-14 (Q00607) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 84 1e-14 AM270019_29(AM270019|pid:none) Aspergillus niger contig An02c024... 83 1e-14 AY099523_1(AY099523|pid:none) Danio rerio vacuolar ATP synthase ... 83 1e-14 AE016818_273(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 83 1e-14 (P63081) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 83 1e-14 AM920433_163(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 83 1e-14 CR382138_506(CR382138|pid:none) Debaryomyces hansenii strain CBS... 83 2e-14 (O16110) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 83 2e-14 (Q24808) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 83 2e-14 FN392321_1069(FN392321|pid:none) Pichia pastoris GS115 chromosom... 82 2e-14 DQ443153_1(DQ443153|pid:none) Bombyx mori vacuolar H+ ATP syntha... 82 2e-14 AY892471_1(AY892471|pid:none) Synthetic construct Homo sapiens c... 82 2e-14 AE014296_2077(AE014296|pid:none) Drosophila melanogaster chromos... 82 2e-14 (Q24810) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 82 2e-14 (P27449) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 82 2e-14 BT032787_1(BT032787|pid:none) Drosophila melanogaster IP21224 fu... 82 2e-14 CR380955_60(CR380955|pid:none) Candida glabrata strain CBS138 ch... 82 2e-14 AP003263_18(AP003263|pid:none) Oryza sativa Japonica Group genom... 82 3e-14 BT051501_1(BT051501|pid:none) Medicago truncatula clone MTYF1_F2... 82 4e-14 AY343324_1(AY343324|pid:none) Apis mellifera vacuolar H+ ATP syn... 82 4e-14 EZ048856_1(EZ048856|pid:none) TSA: Stomoxys calcitrans SC-4-3-3 ... 82 4e-14 EF145656_1(EF145656|pid:none) Populus trichocarpa clone WS0112_F... 82 4e-14 CU928181_113(CU928181|pid:none) Zygosaccharomyces rouxii strain ... 81 5e-14 CR382125_975(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 81 7e-14 BC050939_1(BC050939|pid:none) Mus musculus ATPase, H+ transporti... 81 7e-14 AB003940_1(AB003940|pid:none) Acetabularia acetabulum mRNA for v... 80 9e-14 AB003942_1(AB003942|pid:none) Acetabularia acetabulum mRNA for v... 80 9e-14 AB003941_1(AB003941|pid:none) Acetabularia acetabulum mRNA for v... 80 9e-14 CU928180_600(CU928180|pid:none) Kluyveromyces thermotolerans str... 80 9e-14 AY261522_1(AY261522|pid:none) Suaeda maritima subsp. salsa vacuo... 80 1e-13 AC148293_4(AC148293|pid:none) Medicago truncatula clone mth2-16c... 80 1e-13 (P23957) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 BT040707_1(BT040707|pid:none) Zea mays full-length cDNA clone ZM... 80 1e-13 AF193814_1(AF193814|pid:none) Dendrobium crumenatum vacuolar H+-... 80 1e-13 AP004775_8(AP004775|pid:none) Oryza sativa Japonica Group genomi... 80 1e-13 AE013599_2514(AE013599|pid:none) Drosophila melanogaster chromos... 80 1e-13 (O22552) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 (P59228) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 (P68161) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 (Q43434) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 U13670_1(U13670|pid:none) Gossypium hirsutum vacuolar H+-ATPase ... 80 1e-13 AM430959_1(AM430959|pid:none) Vitis vinifera contig VV78X111633.... 80 1e-13 (Q40585) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 AF022925_1(AF022925|pid:none) Vigna radiata adenosine triphospha... 80 1e-13 AK028239_1(AK028239|pid:none) Mus musculus adult male hippocampu... 80 1e-13 (P59227) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 (Q96473) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 80 1e-13 BT071491_1(BT071491|pid:none) Picea sitchensis clone WS02917_E06... 80 2e-13 BT060909_1(BT060909|pid:none) Zea mays full-length cDNA clone ZM... 80 2e-13 X95752_1(X95752|pid:none) N.tabacum mRNA for c subunit of V-type... 80 2e-13 AF416606_1(AF416606|pid:none) Pennisetum glaucum vacuolar H+-ATP... 80 2e-13 CP001323_364(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 80 2e-13 AF286464_1(AF286464|pid:none) Porteresia coarctata V-ATPase subu... 80 2e-13 (Q21898) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 79 3e-13 AB028204_1(AB028204|pid:none) Porphyra yezoensis mRNA for vacuol... 78 6e-13 BT053364_1(BT053364|pid:none) Medicago truncatula clone MTYFP_FQ... 77 7e-13 CT005260_215(CT005260|pid:none) Leishmania major strain Friedlin... 77 7e-13 AM502239_155(AM502239|pid:none) Leishmania infantum chromosome 2... 77 7e-13 (Q43362) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 77 1e-12 CR940353_288(CR940353|pid:none) Theileria annulata strain Ankara... 77 1e-12 EF070596_1(EF070596|pid:none) Maconellicoccus hirsutus clone WHM... 77 1e-12 AM910992_133(AM910992|pid:none) Plasmodium knowlesi strain H chr... 75 3e-12 EZ000081_1(EZ000081|pid:none) TSA: Schistosoma japonicum SJCHGC0... 75 4e-12 AL844504_189(AL844504|pid:none) Plasmodium falciparum 3D7 chromo... 75 5e-12 AM494965_125(AM494965|pid:none) Leishmania braziliensis chromoso... 74 8e-12 FN357297_19(FN357297|pid:none) Schistosoma mansoni genome sequen... 74 1e-11 AJ566619_1(AJ566619|pid:none) Paramecium tetraurelia macronuclea... 73 1e-11 AJ566618_1(AJ566618|pid:none) Paramecium tetraurelia macronuclea... 73 1e-11 AJ566617_1(AJ566617|pid:none) Paramecium tetraurelia macronuclea... 72 4e-11 CR764090_1(CR764090|pid:none) Paramecium tetraurelia, complete g... 72 4e-11 AP007151_634(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 71 5e-11 PXBOV6(A31320;S05209)H+-exporting ATPase (EC 3.6.3.6), vacuolar,... 71 7e-11 U53182_1(U53182|pid:none) Pleurochrysis carterae V-type ATPase 1... 71 7e-11 (Q41773) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 70 9e-11 FN322091_1(FN322091|pid:none) Schistosoma japonicum isolate Anhu... 70 9e-11 CP001160_211(CP001160|pid:none) Thalassiosira pseudonana CCMP133... 70 1e-10 FN315972_1(FN315972|pid:none) Schistosoma japonicum isolate Anhu... 70 2e-10 CR382131_1292(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 69 2e-10 AM502241_15(AM502241|pid:none) Leishmania infantum chromosome 23. 69 2e-10 AM494960_15(AM494960|pid:none) Leishmania braziliensis chromosom... 69 2e-10 CT005262_15(CT005262|pid:none) Leishmania major strain Friedlin,... 69 3e-10 (Q755G4) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 69 3e-10 (Q6CT28) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 69 3e-10 FN392320_734(FN392320|pid:none) Pichia pastoris GS115 chromosome... 67 8e-10 (P32842) RecName: Full=V-type proton ATPase subunit c'; ... 67 8e-10 (Q6FUY5) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 67 1e-09 (Q6BSB9) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 66 2e-09 CP000496_561(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 65 4e-09 CP001577_498(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 65 5e-09 DQ215926_1(DQ215926|pid:none) Taeniopygia guttata clone 0058P000... 65 5e-09 EF215006_1(EF215006|pid:none) Callithrix jacchus clone F16-53.4_... 63 1e-08 CU633899_306(CU633899|pid:none) Podospora anserina genomic DNA c... 63 1e-08 AM270216_16(AM270216|pid:none) Aspergillus niger contig An10c005... 62 2e-08 (Q9Y874) RecName: Full=V-type proton ATPase 16 kDa proteolipid s... 62 4e-08 DQ215924_1(DQ215924|pid:none) Taeniopygia guttata clone 0058P003... 60 9e-08 AE009439_1013(AE009439|pid:none) Methanopyrus kandleri AV19, com... 59 4e-07 CP000582_265(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 57 8e-07 AJ238275_1(AJ238275|pid:none) Beta vulgaris partial BVA-16/2 gen... 56 2e-06 EF145359_1(EF145359|pid:none) Populus trichocarpa clone WS01123_... 54 9e-06 M95063_1(M95063|pid:none) Zea mays putative proteolipid subunit ... 51 6e-05 CP000743_60(CP000743|pid:none) Methanococcus aeolicus Nankai-3, ... 50 2e-04 BT056872_1(BT056872|pid:none) Salmo salar clone ssal-eve-523-078... 49 3e-04 (Q57674) RecName: Full=Probable ATPase proteolipid chain; &F643... 49 4e-04 CP000742_357(CP000742|pid:none) Methanococcus vannielii SB, comp... 48 5e-04 CP000102_1100(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 48 6e-04 X92375_1(X92375|pid:none) Z.mays mRNA for V-type H+-ATPase, clon... 46 0.002 EF373537_1(EF373537|pid:none) Cucumis sativus vacuolar ATPase su... 46 0.002 BA000016_1642(BA000016|pid:none) Clostridium perfringens str. 13... 44 0.007 CP001056_2787(CP001056|pid:none) Clostridium botulinum B str. Ek... 44 0.009 CP000504_1041(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 44 0.009 S65527(S65527;S65526;S72454) H+-exporting ATPase (EC 3.6.3.6) ch... 44 0.012 EU152211_1(EU152211|pid:none) Dendrobium hybrid cultivar Khao Sa... 43 0.020 AE009441_514(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 43 0.020 CP000896_943(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 43 0.020 CP001145_636(CP001145|pid:none) Coprothermobacter proteolyticus ... 43 0.020 CP001014_14(CP001014|pid:none) Thermoproteus neutrophilus V24Sta... 42 0.035 (A5FRR4) RecName: Full=ATP synthase subunit c; AltName: Full=ATP... 41 0.060 AP006878_1599(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 41 0.060 CP001098_1927(CP001098|pid:none) Halothermothrix orenii H 168, c... 41 0.060 AE005672_1243(AE005672|pid:none) Streptococcus pneumoniae TIGR4,... 41 0.078 CP000300_1137(CP000300|pid:none) Methanococcoides burtonii DSM 6... 40 0.10 AP008971_1169(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 40 0.10 CP001146_1327(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 40 0.10 CP000885_3042(CP000885|pid:none) Clostridium phytofermentans ISD... 40 0.13 AE009951_235(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 40 0.17 (Q2LRB9) RecName: Full=ATP synthase subunit c; AltName: Full=ATP... 39 0.23 CP001251_1438(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 39 0.30 CP001322_4280(CP001322|pid:none) Desulfatibacillum alkenivorans ... 39 0.39 (A7I137) RecName: Full=ATP synthase subunit c; AltName: Full=ATP... 39 0.39 (Q2RFX4) RecName: Full=ATP synthase subunit c; AltName: Full=ATP... 38 0.66 CP000660_18(CP000660|pid:none) Pyrobaculum arsenaticum DSM 13514... 37 0.86 CP001399_1520(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 37 0.86 CP001279_29(CP001279|pid:none) Nautilia profundicola AmH, comple... 37 0.86 CP001400_1419(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 37 0.86 AY620960_1(AY620960|pid:none) Pennisetum glaucum truncated vacuo... 37 1.1 CP000524_1108(CP000524|pid:none) Bartonella bacilliformis KC583,... 37 1.1 EU742836_1(EU742836|pid:none) Amphidinium carterae strain CCMP13... 37 1.1 (Q4J8L5) RecName: Full=Membrane-associated ATPase C chain; &CP0... 37 1.1 AE017199_215(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 37 1.5 EF134011_1(EF134011|pid:none) Alexandrium affine strain CCMP112 ... 36 1.9 CP001230_35(CP001230|pid:none) Persephonella marina EX-H1, compl... 36 2.5 AE009949_118(AE009949|pid:none) Streptococcus pyogenes MGAS8232,... 35 3.3 (B4U8V5) RecName: Full=ATP synthase subunit c; AltName: Full=ATP... 35 3.3 AX970615_1(AX970615|pid:none) Sequence 1418 from Patent EP1104808. 35 3.3 (Q30TH1) RecName: Full=ATP synthase subunit c; AltName: Full=ATP... 35 3.3 AE000666_946(AE000666|pid:none) Methanothermobacter thermautotro... 35 4.3 CP000524_1112(CP000524|pid:none) Bartonella bacilliformis KC583,... 35 4.3 CP000127_1992(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 35 4.3 AL009126_3515(AL009126|pid:none) Bacillus subtilis subsp. subtil... 35 4.3 AL954747_463(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 35 5.5 CP000682_1883(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 35 5.6 EF134006_1(EF134006|pid:none) Alexandrium tamarense strain CB307... 35 5.6 AE004092_109(AE004092|pid:none) Streptococcus pyogenes M1 GAS, c... 35 5.6 CP000259_129(CP000259|pid:none) Streptococcus pyogenes MGAS9429,... 35 5.6 CP000939_2618(CP000939|pid:none) Clostridium botulinum B1 str. O... 34 7.3 EF134007_1(EF134007|pid:none) Alexandrium tamarense strain CB307... 34 7.3 EU742826_1(EU742826|pid:none) Amphidinium carterae strain CCMP13... 34 7.3 AE014296_726(AE014296|pid:none) Drosophila melanogaster chromoso... 34 7.3 (P62021) RecName: Full=Membrane-associated ATPase C chain; AltNa... 34 7.3 CP000852_1865(CP000852|pid:none) Caldivirga maquilingensis IC-16... 34 7.3 EF134008_1(EF134008|pid:none) Alexandrium tamarense strain CB307... 34 7.3 CR382135_227(CR382135|pid:none) Debaryomyces hansenii strain CBS... 34 7.3 AY826871_1(AY826871|pid:none) Heterocapsa triquetra clone HTAPPH... 34 9.5 GN107021_1(GN107021|pid:none) Sequence 11802 from Patent WO20090... 34 9.5 CP001101_2406(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 34 9.5 CP001358_2230(CP001358|pid:none) Desulfovibrio desulfuricans sub... 34 9.5 AE017283_75(AE017283|pid:none) Propionibacterium acnes KPA171202... 34 9.5 EF134009_1(EF134009|pid:none) Alexandrium affine strain CCMP112 ... 34 9.5 AY884253_1(AY884253|pid:none) Heterocapsa triquetra chloroplast ... 34 9.5 EU742840_1(EU742840|pid:none) Amphidinium carterae strain CCMP13... 34 9.5 AY884251_1(AY884251|pid:none) Heterocapsa triquetra chloroplast ... 34 9.5
>AC116956_4(AC116956|pid:none) Dictyostelium discoideum chromosome 2 map 1418423-1684967 strain AX4, complete sequence. Length = 191
Score = 320 bits (820), Expect(2) = 1e-86 Identities = 162/180 (90%), Positives = 162/180 (90%) Frame = +1
Query: 124 DNNYYDQGTYFLVTISPSTWXXXXXXXXXXXXXXXXXWGIWVTASSLMGAAVKEPRIRSK 303 DNNYYDQ TYFLVTISPSTW WGIWVTASSLMGAAVKEPRIRSK Sbjct: 12 DNNYYDQCTYFLVTISPSTWAALGIGLSLALSVVGSAWGIWVTASSLMGAAVKEPRIRSK 71
Query: 304 NIISIIFCEAVAIYGIILAIILNGKIDKFLNIWDPASDYMAGYMMFGAGITVGLCNVFSG 483 NIISIIFCEAVAIYGIILAIILNGKIDKFLNIWDPASDYMAGYMMFGAGITVGLCNVFSG Sbjct: 72 NIISIIFCEAVAIYGIILAIILNGKIDKFLNIWDPASDYMAGYMMFGAGITVGLCNVFSG 131
Query: 484 VCVGIAGSGCALGDAQNPSLFVKMLIIEIFAGALGLYAVIVGILMTTNALGVTQQPALKP 663 VCVGIAGSGCALGDAQNPSLFVKMLIIEIFAGALGLYAVIVGILMTTNALGVTQQPALKP Sbjct: 132 VCVGIAGSGCALGDAQNPSLFVKMLIIEIFAGALGLYAVIVGILMTTNALGVTQQPALKP 191
Score = 24.3 bits (51), Expect(2) = 1e-86 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2
Query: 89 MPDINPLTP 115 MPDINPLTP Sbjct: 1 MPDINPLTP 9
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,289,563,565 Number of extensions: 22438355 Number of successful extensions: 66556 Number of sequences better than 10.0: 249 Number of HSP's gapped: 66171 Number of HSP's successfully gapped: 290 Length of query: 343 Length of database: 1,051,180,864 Length adjustment: 129 Effective length of query: 214 Effective length of database: 633,664,753 Effective search space: 135604257142 Effective search space used: 135604257142 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
7 |
VH (FL, L) |
0 |
VF (FL, S) |
0 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
2 |
SS (DIR, S) |
18 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
2 |
FC-IC (SUB) |
0 |