| Contig-U16081-1 |
| Contig ID |
Contig-U16081-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1724 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
1322976 |
| End point |
1324545 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
33 |
| Number of EST |
55 |
| Link to clone list |
U16081 |
| List of clone(s) |
est1=SFF395F,1,617
est2=VFK535F,1,578
est3=SFK879F,11,589
est4=VFH584F,11,498
est5=SFC563F,12,557
est6=SFD668F,12,617
est7=SFH131F,12,587
est8=SFH362F,12,588
est9=SFI528F,12,588
est10=SFI538F,12,616
est11=SFI546F,12,616
est12=SFK822F,12,586
est13=VFA677F,14,409
est14=VFD283F,14,594
est15=VFK255F,14,574
est16=VFN236F,14,626
est17=VFO728F,14,551
est18=VSJ807F,20,197
est19=SLA602F,31,531
est20=CFC585H,515,1514
est21=CFC585F,518,1041
est22=CFJ587F,518,1028
est23=CFD555F,521,1094
est24=CFG232F,528,1122
est25=CFF550F,573,776
est26=VFN236Z,702,1377
est27=SFC563Z,767,1467
est28=SFI546Z,770,1468
est29=SFD668Z,776,1555
est30=SFI528Z,815,1508
est31=SFF395Z,816,1467
est32=VFD283Z,818,1545
est33=SFI538Z,829,1468
est34=SFH362Z,836,1467
est35=SFI125Z,852,1504
est36=SFH131Z,862,1504
est37=VFK535Z,862,1468
est38=SFI285Z,866,1329
est39=VFO728Z,882,1524
est40=VFH584Z,884,1552
est41=CFG232Z,895,1467
est42=CFF550Z,938,1544
est43=VHJ888Z,939,1575
est44=VFK255Z,945,1504
est45=VFA677Z,947,1572
est46=CFJ587Z,988,1585
est47=CFC585Z,1027,1575
est48=VSE607Z,1030,1561
est49=SLC737Z,1041,1561
est50=SLA370F,1057,1328
est51=VFA511Z,1102,1519
est52=SLK501Z,1111,1561
est53=VSJ807Z,1140,1552
est54=SLJ115Z,1258,1561
est55=SLA370Z,1586,1724
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.11 |
| Homology vs DNA |
Query= Contig-U16081-1 (Contig-U16081-1Q) /CSM_Contig/Contig-U16081-1Q.Seq.d
(1734 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(U27536) Dictyostelium discoideum cystathionine beta synthas... 1570 0.0 6
(BJ435500) Dictyostelium discoideum cDNA clone:ddv27g10, 3' ... 1132 0.0 3
(BJ402827) Dictyostelium discoideum cDNA clone:dds18k11, 3' ... 997 0.0 2
(BJ399600) Dictyostelium discoideum cDNA clone:dds6m15, 3' e... 997 0.0 2
(BJ400041) Dictyostelium discoideum cDNA clone:dds8g18, 3' e... 979 0.0 3
(BJ402801) Dictyostelium discoideum cDNA clone:dds18g07, 3' ... 908 0.0 2
(BJ398310) Dictyostelium discoideum cDNA clone:dds11n23, 3' ... 906 0.0 2
(BJ430583) Dictyostelium discoideum cDNA clone:ddv7e22, 3' e... 902 0.0 4
(BJ402826) Dictyostelium discoideum cDNA clone:dds18k09, 3' ... 880 0.0 2
(BJ400973) Dictyostelium discoideum cDNA clone:dds15l15, 3' ... 866 0.0 2
(BJ402525) Dictyostelium discoideum cDNA clone:dds17a07, 3' ... 835 0.0 2
(BJ433569) Dictyostelium discoideum cDNA clone:ddv22e09, 3' ... 815 0.0 2
(BJ400920) Dictyostelium discoideum cDNA clone:dds15m07, 3' ... 815 0.0 2
(BJ436195) Dictyostelium discoideum cDNA clone:ddv30h07, 3' ... 775 0.0 3
(BJ434425) Dictyostelium discoideum cDNA clone:ddv16g21, 3' ... 771 0.0 2
(BJ372406) Dictyostelium discoideum cDNA clone:ddc12c13, 3' ... 664 0.0 3
(BJ416796) Dictyostelium discoideum cDNA clone:ddv27g10, 5' ... 484 0.0 5
(BJ389339) Dictyostelium discoideum cDNA clone:dds18k11, 5' ... 484 0.0 5
(BJ389337) Dictyostelium discoideum cDNA clone:dds18k09, 5' ... 484 0.0 5
(BJ388236) Dictyostelium discoideum cDNA clone:dds8g18, 5' e... 484 0.0 5
(BJ387020) Dictyostelium discoideum cDNA clone:dds11n23, 5' ... 484 0.0 5
(BJ372626) Dictyostelium discoideum cDNA clone:ddc13o08, 3' ... 739 0.0 2
(BJ442788) Dictyostelium discoideum cDNA clone:ddv50p22, 3' ... 626 0.0 2
(BJ391214) Dictyostelium discoideum cDNA clone:dds15l15, 5' ... 484 0.0 5
(BJ389317) Dictyostelium discoideum cDNA clone:dds18g07, 5' ... 484 0.0 5
(BJ359224) Dictyostelium discoideum cDNA clone:ddc13o08, 5' ... 484 0.0 6
(BJ391167) Dictyostelium discoideum cDNA clone:dds15m07, 5' ... 484 0.0 5
(BJ412307) Dictyostelium discoideum cDNA clone:ddv7e22, 5' e... 476 0.0 5
(BJ360942) Dictyostelium discoideum cDNA clone:ddc8m13, 5' e... 484 0.0 5
(BJ390575) Dictyostelium discoideum cDNA clone:dds22n20, 5' ... 484 0.0 6
(BJ429254) Dictyostelium discoideum cDNA clone:ddv2i20, 3' e... 531 0.0 3
(BJ390366) Dictyostelium discoideum cDNA clone:dds22l06, 5' ... 484 0.0 6
(BJ376023) Dictyostelium discoideum cDNA clone:ddc20m21, 3' ... 559 0.0 2
(BJ415351) Dictyostelium discoideum cDNA clone:ddv22e09, 5' ... 484 0.0 5
(BJ433382) Dictyostelium discoideum cDNA clone:ddv21m14, 3' ... 650 0.0 2
(BJ415168) Dictyostelium discoideum cDNA clone:ddv21m14, 5' ... 484 0.0 4
(BJ417357) Dictyostelium discoideum cDNA clone:ddv30h07, 5' ... 484 0.0 5
(BJ388662) Dictyostelium discoideum cDNA clone:dds6m15, 5' e... 484 0.0 7
(AU263232) Dictyostelium discoideum vegetative cDNA clone:VS... 507 0.0 2
(BJ360586) Dictyostelium discoideum cDNA clone:ddc6i21, 5' e... 484 0.0 6
(AU034355) Dictyostelium discoideum slug cDNA, clone SLC737. 507 0.0 2
(BJ362235) Dictyostelium discoideum cDNA clone:ddc20m21, 5' ... 484 0.0 5
(AU060221) Dictyostelium discoideum slug cDNA, clone SLA602. 484 0.0 4
(BJ374175) Dictyostelium discoideum cDNA clone:ddc6i21, 3' e... 466 0.0 2
(BJ413746) Dictyostelium discoideum cDNA clone:ddv16g21, 5' ... 601 0.0 5
(BJ402738) Dictyostelium discoideum cDNA clone:dds17i22, 3' ... 753 0.0 2
(AU054048) Dictyostelium discoideum slug cDNA, clone SLK501. 507 0.0 2
(BJ429005) Dictyostelium discoideum cDNA clone:ddv2e03, 3' e... 468 0.0 2
(AU270502) Dictyostelium discoideum vegetative cDNA clone:VS... 444 0.0 3
(BJ411061) Dictyostelium discoideum cDNA clone:ddv2i20, 5' e... 363 0.0 4
(AU053561) Dictyostelium discoideum slug cDNA, clone SLJ115. 507 e-141 2
(AU060124) Dictyostelium discoideum slug cDNA, clone SLA370. 428 e-137 2
(BJ359032) Dictyostelium discoideum cDNA clone:ddc12c13, 5' ... 268 3e-82 2
(AU270501) Dictyostelium discoideum vegetative cDNA clone:VS... 157 6e-71 2
(AU040075) Dictyostelium discoideum slug cDNA, clone SLA370. 113 4e-40 2
(CU357622) Aphanomyces euteiches cDNA. 56 7e-20 4
(EL572206) Physarum15390 Physarum polycephalum starvation st... 90 1e-17 2
(EL574005) Physarum15391 Physarum polycephalum starvation st... 90 1e-17 2
(EC759516) PPE00008124 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC759476) PPE00004059 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC757941) PPE00002853 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC757348) PPE00001691 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC756955) PPE00003726 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EL576769) Physarum15393 Physarum polycephalum starvation st... 90 1e-17 2
(EC755249) PPE00007927 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC755123) PPE00003010 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC754840) PPE00006796 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC754400) PPE00009951 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC754269) PPE00009579 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EC753308) PPE00001355 Agencourt Biosciences Agen-0020 Non-n... 90 1e-17 2
(EL566082) Physarum05500 Physarum polycephalum starvation st... 90 6e-16 2
(AM793024) Nicotiana tabacum EST, clone nt005261036. 60 2e-15 4
(EL575777) Physarum15392 Physarum polycephalum starvation st... 82 2e-15 2
(EC758823) PPE00005172 Agencourt Biosciences Agen-0020 Non-n... 64 4e-15 3
(FC645664) CAXU7895.fwd CAXU Lottia gigantea from female gon... 50 5e-12 4
(EX810486) CBNA1475.fwd CBNA Phycomyces blakesleeanus NRRL15... 50 2e-11 5
(DJ130398) Method for identification of useful proteins deri... 48 3e-11 4
(FC701606) CAXX9447.fwd CAXX Lottia gigantea from male gonad... 50 6e-11 4
(FE240269) CAPG577.fwd CAPG Naegleria gruberi amoeba stage N... 50 8e-11 3
(DT621283) ACAH-aaa54b02.g1 Hydra_EST_UCI-10 Hydra magnipapi... 58 1e-10 4
(BP506707) Hydra magnipapillata cDNA, clone:hmp_00432. 58 1e-10 4
(DT620913) ACAG-aaa86h08.g1 Hydra_EST_UCI-9 Hydra magnipapil... 58 1e-10 4
(DT621015) ACAG-aaa46g07.g1 Hydra_EST_UCI-9 Hydra magnipapil... 58 1e-10 4
(CV863848) ACAB-aaa04b08.g1 Hydra UCI6- barcoded EST's Hydra... 58 1e-10 4
(DT621104) ACAH-aaa84a10.g1 Hydra_EST_UCI-10 Hydra magnipapi... 58 2e-10 4
(DT621318) ACAH-aaa21g11.g1 Hydra_EST_UCI-10 Hydra magnipapi... 58 2e-10 4
(DN816643) ACAC-aab90e20.g1 Hydra EST UCI 7 Hydra magnipapil... 58 2e-10 4
(FF910410) CBWU39910.b1 Yutaka Satou unpublished cDNA librar... 64 1e-09 3
(EE009219) ROE00007292 Rhizopus oryzae Company Rhizopus oryz... 46 1e-09 3
(FC576644) CAXP12409.fwd CAXP Lottia gigantea from head, foo... 50 1e-09 3
(EX815617) CBNA4626.fwd CBNA Phycomyces blakesleeanus NRRL15... 50 7e-09 4
(EX809975) CBNA1184.fwd CBNA Phycomyces blakesleeanus NRRL15... 50 8e-09 4
(EX815407) CBNA4515.fwd CBNA Phycomyces blakesleeanus NRRL15... 50 8e-09 4
(EX811614) CBNA2479.fwd CBNA Phycomyces blakesleeanus NRRL15... 50 9e-09 4
(EE008428) ROE00005403 Rhizopus oryzae Company Rhizopus oryz... 46 2e-08 2
(CX831269) ACAC-aaa86h06.g1 Hydra EST UCI 7 Hydra magnipapil... 58 2e-08 2
(BW368955) Ciona intestinalis cDNA, clone:cima845p18, 5'end,... 64 4e-08 3
(FK076923) XABT134093.b1 Gateway compatible cien cDNA librar... 56 4e-08 4
(FF860473) CBWU8110.b1 Yutaka Satou unpublished cDNA library... 64 4e-08 3
(BW487770) Ciona intestinalis cDNA, clone:cima028o15, 5'end,... 64 5e-08 3
(FF998546) CBWU114779.b1 Yutaka Satou unpublished cDNA libra... 64 6e-08 3
(BW448761) Ciona intestinalis cDNA, clone:cijv012f21, 5'end,... 64 6e-08 3
(FF726944) XABT42414.fwd Gateway compatible cien cDNA librar... 64 6e-08 3
(FF997776) CBWU114182.b1 Yutaka Satou unpublished cDNA libra... 64 6e-08 3
(FF731234) XABT45726.fwd Gateway compatible cien cDNA librar... 64 6e-08 3
(FF887697) CBWU25081.b1 Yutaka Satou unpublished cDNA librar... 64 6e-08 3
(FF744789) XABT55255.fwd Gateway compatible cien cDNA librar... 64 6e-08 3
(FF748933) XABT58222.fwd Gateway compatible cien cDNA librar... 64 7e-08 3
(FF925124) CBWU64347.b1 Yutaka Satou unpublished cDNA librar... 64 7e-08 3
(FF925953) CBWU64860.b1 Yutaka Satou unpublished cDNA librar... 64 7e-08 3
(FF950444) CBWU80795.b1 Yutaka Satou unpublished cDNA librar... 64 7e-08 3
(FF902708) CBWU35274.b1 Yutaka Satou unpublished cDNA librar... 64 7e-08 3
(FF739168) XABT51484.fwd Gateway compatible cien cDNA librar... 56 1e-07 4
(FF774642) XABT75648.fwd Gateway compatible cien cDNA librar... 62 2e-07 3
(FF871774) CBWU15593.b1 Yutaka Satou unpublished cDNA librar... 64 2e-07 3
(CO538488) tah72d05.y1 Hydra EST UCI 5 Hydra magnipapillata ... 56 4e-07 3
(CU358217) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU356408) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU352427) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU351144) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU349425) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU355325) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU361399) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU358803) Aphanomyces euteiches cDNA. 40 5e-07 3
(CU364481) Aphanomyces euteiches cDNA. 40 5e-07 3
(FE881084) XYM19375.rev XYM Monosiga brevicollis rapidly gro... 56 6e-07 3
(DY886942) CeleSEQ2779 Cunninghamella elegans pBluescript (E... 38 7e-07 5
(BW353539) Ciona intestinalis cDNA, clone:ciem854o04, 5'end,... 64 2e-06 2
(FF856120) CBWU5707.b1 Yutaka Satou unpublished cDNA library... 64 2e-06 2
(BW441445) Ciona intestinalis cDNA, clone:cijv045k17, 5'end,... 64 3e-06 2
(FF988576) CBWU105810.b1 Yutaka Satou unpublished cDNA libra... 64 3e-06 2
(FK113216) XABT157689.b1 Gateway compatible cien cDNA librar... 64 3e-06 2
(FF920880) CBWU61727.b1 Yutaka Satou unpublished cDNA librar... 64 3e-06 2
(FE867929) XYM11031.rev XYM Monosiga brevicollis rapidly gro... 56 3e-06 2
(FF867044) CBWU12437.b1 Yutaka Satou unpublished cDNA librar... 64 3e-06 2
(AC198962) Monosiga brevicollis clone JGIACYI-121K1, complet... 56 3e-06 4
(FF767342) XABT70922.fwd Gateway compatible cien cDNA librar... 64 3e-06 2
(FF900011) CBWU32830.b1 Yutaka Satou unpublished cDNA librar... 64 3e-06 2
(FF701808) XABT110712.fwd Gateway compatible cien cDNA libra... 64 3e-06 2
(FF856893) CBWU6139.b1 Yutaka Satou unpublished cDNA library... 64 3e-06 2
(FF876489) CBWU18543.b1 Yutaka Satou unpublished cDNA librar... 64 3e-06 2
(FF725973) XABT41360.fwd Gateway compatible cien cDNA librar... 64 3e-06 2
(FF925525) CBWU64594.b1 Yutaka Satou unpublished cDNA librar... 64 3e-06 2
(FF714157) XABT33604.fwd Gateway compatible cien cDNA librar... 64 3e-06 2
(FF860282) CBWU8005.b1 Yutaka Satou unpublished cDNA library... 64 3e-06 2
(EY299007) CAWX14223.fwd CAWX Helobdella robusta Primary Ear... 44 4e-06 3
(EY354451) CAWZ3095.fwd CAWZ Helobdella robusta Primary Late... 44 4e-06 3
(EY379475) CAXA17817.fwd CAXA Helobdella robusta Subtracted ... 44 4e-06 3
(EB744601) SPE00000590 Company (LARGE) Spizellomyces punctat... 48 8e-06 2
(FF732729) XABT46734.fwd Gateway compatible cien cDNA librar... 56 1e-05 3
(BW486180) Ciona intestinalis cDNA, clone:cima055k02, 5'end,... 64 2e-05 1
(BW372049) Ciona intestinalis cDNA, clone:cima854n06, 5'end,... 64 2e-05 1
(BW370053) Ciona intestinalis cDNA, clone:cima849c07, 5'end,... 64 2e-05 1
(BW366395) Ciona intestinalis cDNA, clone:cima838g15, 5'end,... 64 2e-05 1
(BW364541) Ciona intestinalis cDNA, clone:cima833b24, 5'end,... 64 2e-05 1
(BW356173) Ciona intestinalis cDNA, clone:cima809c12, 5'end,... 64 2e-05 1
(BW344743) Ciona intestinalis cDNA, clone:ciem828h07, 5'end,... 64 2e-05 1
(BW341285) Ciona intestinalis cDNA, clone:ciem818a12, 5'end,... 64 2e-05 1
(BW338294) Ciona intestinalis cDNA, clone:ciem808k11, 5'end,... 64 2e-05 1
(BW336219) Ciona intestinalis cDNA, clone:ciem802f08, 5'end,... 64 2e-05 1
(BW325828) Ciona intestinalis cDNA, clone:cidg823a07, 5'end,... 64 2e-05 1
(BW325398) Ciona intestinalis cDNA, clone:cidg821m04, 5'end,... 64 2e-05 1
(BW321380) Ciona intestinalis cDNA, clone:cidg807c03, 5'end,... 64 2e-05 1
(BW320099) Ciona intestinalis cDNA, clone:cidg803h10, 5'end,... 64 2e-05 1
(BW294957) Ciona intestinalis cDNA, clone:cigd009e11, 5' end... 64 2e-05 1
(BW294398) Ciona intestinalis cDNA, clone:cigd007i21, 5' end... 64 2e-05 1
(BW291914) Ciona intestinalis cDNA, clone:cigd045o18, 5' end... 64 2e-05 1
(BW283016) Ciona intestinalis cDNA, clone:cigd020l10, 5' end... 64 2e-05 1
(BW279765) Ciona intestinalis cDNA, clone:cigd011o19, 5' end... 64 2e-05 1
(BW279686) Ciona intestinalis cDNA, clone:cigd011k16, 5' end... 64 2e-05 1
(BW260840) Ciona intestinalis cDNA, clone:cign026d05, 5' end... 64 2e-05 1
(BW217105) Ciona intestinalis cDNA, clone:cieg084o12, 5' end... 64 2e-05 1
(BW208882) Ciona intestinalis cDNA, clone:cieg059g05, 5' end... 64 2e-05 1
(FK224773) XABT226875.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK222925) XABT225331.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK217965) XABT222194.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK212809) XABT218866.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK208191) XABT215999.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK204680) XABT213815.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK201919) XABT212106.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK199618) XABT210692.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK189530) XABT204396.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK187743) XABT203267.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK173497) XABT194555.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK171783) XABT193478.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK158358) XABT185262.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK150548) XABT180239.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK147012) XABT178144.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK144200) XABT176435.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK143508) XABT176028.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK139511) XABT173561.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK136055) XABT171485.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK122274) XABT163185.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK115296) XABT158979.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK106059) XABT152827.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK105043) XABT152190.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK101902) XABT149555.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK098440) XABT147463.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK093052) XABT144194.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK092518) XABT143868.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK053658) XABT120031.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK052890) XABT119590.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK047339) XABT115842.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FK045841) XABT114928.b1 Gateway compatible cien cDNA librar... 64 2e-05 1
(FF997957) CBWU114333.b1 Yutaka Satou unpublished cDNA libra... 64 2e-05 1
(FF995385) CBWU111902.b1 Yutaka Satou unpublished cDNA libra... 64 2e-05 1
(FF991718) CBWU109040.b1 Yutaka Satou unpublished cDNA libra... 64 2e-05 1
(FF989511) CBWU106986.b1 Yutaka Satou unpublished cDNA libra... 64 2e-05 1
(FF979252) CBWU102793.b1 Yutaka Satou unpublished cDNA libra... 64 2e-05 1
(FF963558) CBWU89240.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF953867) CBWU82906.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF950496) CBWU80826.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF923321) CBWU63214.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF910867) CBWU40189.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF906604) CBWU37662.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF905734) CBWU37135.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF897218) CBWU31118.b1 Yutaka Satou unpublished cDNA librar... 64 2e-05 1
(FF854834) CBWU4973.b1 Yutaka Satou unpublished cDNA library... 64 2e-05 1
(FF772653) XABT74366.fwd Gateway compatible cien cDNA librar... 64 2e-05 1
(FF715975) XABT34797.fwd Gateway compatible cien cDNA librar... 64 2e-05 1
(FF699079) XABT108905.fwd Gateway compatible cien cDNA libra... 64 2e-05 1
(FF697499) XABT107852.fwd Gateway compatible cien cDNA libra... 64 2e-05 1
(FF697138) XABT107614.fwd Gateway compatible cien cDNA libra... 64 2e-05 1
(FF693862) XABT105454.fwd Gateway compatible cien cDNA libra... 64 2e-05 1
(FF691382) XABT103853.fwd Gateway compatible cien cDNA libra... 64 2e-05 1
(FF686724) XABT100805.fwd Gateway compatible cien cDNA libra... 64 2e-05 1
(AV977415) Ciona intestinalis cDNA, clone:cieg45d02, 5' end,... 64 2e-05 1
(EB488373) 1099341215210 12-DrosW-norm-1P5Kb Drosophila will... 40 6e-05 3
(FJ161950) Glomus intraradices putative cystathionine beta-s... 62 7e-05 1
(CU349162) Aphanomyces euteiches cDNA. 36 8e-05 3
(FF772910) XABT74527.fwd Gateway compatible cien cDNA librar... 56 1e-04 2
(CU357756) Aphanomyces euteiches cDNA. 54 2e-04 2
(CT774610) Paramecium tetraurelia 5-PRIME EST from clone LK0... 40 2e-04 3
(CT790591) Paramecium tetraurelia 5-PRIME EST from clone LK0... 40 2e-04 3
(BY924676) Bombyx mori cDNA, clone:E_EL_vg4M_04K09_F_0, 5' e... 36 3e-04 3
(BW998902) Bombyx mori mRNA, clone:SES1579, expressed in fer... 36 4e-04 3
(DL131060) Bax-responsive genes for drug target identificati... 38 5e-04 3
(AX536830) Sequence 431 from Patent WO02064766. 38 5e-04 3
(AR941620) Sequence 431 from patent US 7101990. 38 5e-04 3
(AR549004) Sequence 4135 from patent US 6747137. 38 6e-04 3
(EK362009) 1095469140559 Global-Ocean-Sampling_GS-31-01-01-1... 56 6e-04 2
(EK027008) 1092955375507 Global-Ocean-Sampling_GS-31-01-01-1... 58 0.001 1
(AV961016) Ciona intestinalis cDNA, clone:cicl14k20, 5' end,... 58 0.001 1
(EC130305) HVE00007577 Hartmannella vermiformis Regular Smal... 42 0.001 2
(FG058448) CBOU6990.fwd CBOU Phytophthora capsici LT1534 Myc... 38 0.002 3
(FG020988) CBOT1763.fwd CBOT Phytophthora capsici LT1534 Myc... 38 0.002 3
(AM806486) Nicotiana tabacum EST, clone nt002080014. 36 0.003 4
(FK224828) XABT226915.b1 Gateway compatible cien cDNA librar... 56 0.005 1
(FK207395) XABT215505.b1 Gateway compatible cien cDNA librar... 56 0.005 1
(FK118593) XABT160988.b1 Gateway compatible cien cDNA librar... 56 0.005 1
(FK067790) XABT128522.b1 Gateway compatible cien cDNA librar... 56 0.005 1
(DV619946) EST1222942 Glossina morsitans morsitans Fat body ... 36 0.016 4
(EJ724755) 1092959489986 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.018 1
(EJ717301) 1092959428728 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.018 1
(EJ643672) 1093012162386 Global-Ocean-Sampling_GS-29-01-01-1... 54 0.018 1
(EJ643065) 1093012024662 Global-Ocean-Sampling_GS-29-01-01-1... 54 0.018 1
(BC153303) Danio rerio zgc:152691, mRNA (cDNA clone MGC:1713... 44 0.019 2
(AB051616) Pichia pastoris cbs mRNA for cystathionine beta-s... 34 0.023 4
(CT760753) Paramecium tetraurelia 5-PRIME EST from clone LK0... 34 0.041 3
(CJ388564) Molgula tectiformis cDNA, gonad clone:mtgd004o14,... 52 0.072 1
(DB651907) Saccharomyces cerevisiae mRNA, clone: S03052-86_D... 42 0.11 2
(DB648408) Saccharomyces cerevisiae mRNA, clone: S03052-54_E... 42 0.11 2
(DV185734) CT052_G10_CT052_3700_91.ab1 C. tentans tissue cul... 40 0.12 3
(DV611026) EST1214022 Glossina morsitans morsitans Fat body ... 44 0.13 2
(DV607659) EST1210655 Glossina morsitans morsitans Fat body ... 44 0.13 2
(DV609346) EST1212342 Glossina morsitans morsitans Fat body ... 44 0.13 2
(DV618407) EST1221403 Glossina morsitans morsitans Fat body ... 44 0.13 2
(DV618843) EST1221839 Glossina morsitans morsitans Fat body ... 44 0.13 2
(DV619380) EST1222376 Glossina morsitans morsitans Fat body ... 44 0.15 2
(EX524573) ALF-R-16_2007-07-25_1/ALF(R)-16_I05_012_1 Alfalfa... 40 0.21 2
(EX522080) ALF(R)-20_2007-08-08_1/ALF(R)-20_D23_047_1 Alfalf... 40 0.21 2
(EC720511) MJE00004616 Malawimonas jakobiformis Home made (1... 48 0.29 2
(EC720203) MJE00005394 Malawimonas jakobiformis Home made (1... 48 0.30 2
(CV903798) PD038D9 mycelium, nitrogen starvation Phytophthor... 40 0.30 2
(EC723389) MJE00000562 Malawimonas jakobiformis Home made (1... 48 0.36 2
(DB667152) Saccharomyces cerevisiae mRNA, clone: Y109_C05_F.... 42 0.37 2
(EC723645) MJE00000567 Malawimonas jakobiformis Home made (1... 48 0.37 2
(AM908689) Solanum tuberosum EST, clone 5P15. 40 0.41 2
(DQ332384) Synthetic construct Saccharomyces cerevisiae clon... 42 0.81 2
(DJ208451) Method for identification of useful proteins deri... 42 0.81 2
(AX830274) Sequence 994 from Patent WO03072602. 42 0.81 2
(AX819244) Sequence 994 from Patent EP1338608. 42 0.81 2
(AX596732) Sequence 2386 from Patent EP1258494. 42 0.81 2
(AR643357) Sequence 14 from patent US 6867014. 42 0.81 2
(AR438536) Sequence 14 from patent US 6664073. 42 0.81 2
(AR410101) Sequence 14 from patent US 6635438. 42 0.81 2
(AZ929721) 479.dif88b12.s1 Saccharomyces kluyveri Lachancea ... 36 0.81 2
(AF424661) Phytophthora infestans clone MY-10-D-12 cystathio... 40 0.83 2
(L14578) Saccharomyces cerevisiae cystathionine beta-synthas... 42 0.89 2
(DL130935) Bax-responsive genes for drug target identificati... 42 1.0 2
(AX536580) Sequence 181 from Patent WO02064766. 42 1.0 2
(AR941495) Sequence 181 from patent US 7101990. 42 1.0 2
(DB645164) Saccharomyces cerevisiae mRNA, clone: S03052-37_H... 38 1.0 2
(X72922) S.cerevisiae gene for cystathionine beta-synthase. 42 1.1 2
(ET704140) CHO_OF432xm09f1.ab1 CHO_OF Nicotiana tabacum geno... 48 1.1 1
(CE386559) tigr-gss-dog-17000334388679 Dog Library Canis lup... 48 1.1 1
(CE315501) tigr-gss-dog-17000361041703 Dog Library Canis lup... 48 1.1 1
(EC134455) HVE00011858 Hartmannella vermiformis Normalized l... 48 1.1 1
(EC129560) HVE00009793 Hartmannella vermiformis Normalized l... 48 1.1 1
(EB761684) 581872 MN12 Leptinotarsa decemlineata cDNA clone ... 48 1.1 1
(EB754900) 666710 MN12 Leptinotarsa decemlineata cDNA clone ... 48 1.1 1
(FM229571) Mycosphaerella graminicola EST, clone 14524. 48 1.1 1
(D16496) Saccharomyces cerevisiae NHS5 gene for cystathionin... 42 1.2 2
(E05462) DNA sequence encoding cystathionine beta-synthase. 42 1.2 2
(GE956530) G1176P157RP18.T0 Neurospora crassa cDNA - 1 hour ... 34 1.2 3
(DQ393809) Saccharomyces cerevisiae isolate UCD957 cystathio... 42 1.3 2
(DQ393808) Saccharomyces cerevisiae isolate UCD940 cystathio... 42 1.3 2
(DQ393807) Saccharomyces cerevisiae isolate UCD939 cystathio... 42 1.3 2
(DQ393806) Saccharomyces cerevisiae isolate UCD932 cystathio... 42 1.3 2
(AF367364) Pichia pastoris cystathionine beta-synthase (CBS)... 34 1.3 3
(E05278) DNA sequence of gene which enhances cystathionine b... 42 1.3 2
(E05175) DNA sequence of hydrogen sulfide suppression gene, ... 42 1.3 2
(Z72940) S.cerevisiae chromosome VII reading frame ORF YGR155w. 42 1.4 2
(FK930891) EST_lsal_evj_934334 lsalevj mixed_tissue_mixed_st... 44 1.9 2
(D16502) Saccharomyces cerevisiae genes for cystathionine be... 42 2.0 2
(AM812962) Nicotiana tabacum EST, clone nt002111077. 34 2.4 4
(FL637317) TG_306_A11 Termite gut library Reticulitermes fla... 36 2.9 2
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 36 3.3 18
(EC718876) MJE00004436 Malawimonas jakobiformis Home made (1... 44 3.4 2
(FE141210) LV_HP_RA39M13r Litopenaeus vannamei hepatopancrea... 40 3.5 2
(FE131282) LV_HP_RA16B21r Litopenaeus vannamei hepatopancrea... 40 3.5 2
(AU001293) Bombyx mori cDNA, clone fbm0256r. 36 3.9 2
(CD451895) USDA-FP_104223 Adult Alate Brown Citrus Aphid Tox... 40 4.2 2
(FE131213) LV_HP_RA16B09r Litopenaeus vannamei hepatopancrea... 40 4.4 2
(AC120877) Mus musculus chromosome 6, clone RP24-548D19, com... 46 4.4 1
(AC102663) Mus musculus chromosome 6, clone RP23-244M15, com... 46 4.4 1
(AC189703) Pan troglodytes BAC clone CH251-98C24 from chromo... 46 4.4 1
(AC148188) Saimiri boliviensis boliviensis clone CH254-64N20... 46 4.4 1
(AC146229) Pan troglodytes BAC clone RP43-33B3 from chromoso... 46 4.4 1
(CR382137) Debaryomyces hansenii strain CBS767 chromosome E ... 46 4.4 1
(AM456163) Vitis vinifera contig VV78X066659.16, whole genom... 46 4.4 1
(AC153071) Equus caballus clone CH241-77F8, complete sequence. 46 4.4 1
(AC215340) Homo sapiens FOSMID clone ABC12-49214500A17 from ... 46 4.4 1
(AC084866) Homo sapiens BAC clone RP11-6E9 from 4, complete ... 46 4.4 1
(AC073141) Homo sapiens BAC clone RP11-733D19 from 7, comple... 46 4.4 1
(AC005996) Homo sapiens PAC clone RP4-555L14 from 7, complet... 46 4.4 1
(AC139898) Rattus norvegicus clone CH230-275J5, WORKING DRAF... 46 4.4 1
(AC109894) Rattus norvegicus clone CH230-321P21, *** SEQUENC... 46 4.4 1
(CU656010) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 4.4 1
(AC183129) Bos taurus clone CH240-101L1, WORKING DRAFT SEQUE... 46 4.4 1
(AC179658) Strongylocentrotus purpuratus clone R3-1024G10, W... 46 4.4 1
(ER304373) 1092343734371 Global-Ocean-Sampling_GS-34-01-01-1... 46 4.4 1
(AM678720) Entamoeba terrapinae GSS, clone terra165f07.q1k. 46 4.4 1
(AL436879) T7 end of clone BC0AA005H05 of library BC0AA from... 46 4.4 1
(AL436146) T3 end of clone BC0AA001F09 of library BC0AA from... 46 4.4 1
(DH436440) Macropus eugenii DNA with T3 primer, fosmid clone... 46 4.4 1
(ES564827) TPAF-aab58g05.g1 T.spiralis_EST Trichinella spira... 46 4.4 1
(DT160137) JGI_ANNO36085.rev ANNO Pimephales promelas Whole ... 46 4.4 1
(DN886754) naf39a11.x1 Rabbit eye cornea. Unnormalized (naf)... 46 4.4 1
(DB909424) Populus nigra mRNA, clone: PnFL2-096_G13, 3'end. 46 4.4 1
(FM008204) Dicentrarchus labrax EST, clone cDN25P0005J01, 5'... 46 4.4 1
(FL640815) TG_37_G9 Termite gut library Reticulitermes flavi... 46 4.4 1
(FL639178) TG_20_D4 Termite gut library Reticulitermes flavi... 46 4.4 1
(FL638720) TG_15_F3 Termite gut library Reticulitermes flavi... 46 4.4 1
(FL638519) TG_13_C11 Termite gut library Reticulitermes flav... 46 4.4 1
(FL636787) TG_304_E10 Termite gut library Reticulitermes fla... 46 4.4 1
(FL636778) TG_304_C10 Termite gut library Reticulitermes fla... 46 4.4 1
(FL636752) TG_304_N7 Termite gut library Reticulitermes flav... 46 4.4 1
(EX500561) TPAF-aac23d08.g1 T.spiralis_EST Trichinella spira... 46 4.4 1
(EW948905) G894P5203RH3.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW938927) G894P5189RD13.T0 Ixodes scapularis Pooled Non-inf... 46 4.4 1
(EW885460) G894P553RG12.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW875838) G894P534RJ19.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW868079) G894P524RH20.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW866126) G894P518RL3.T0 Ixodes scapularis Pooled Non-infec... 46 4.4 1
(EW837251) G894P590RP9.T0 Ixodes scapularis Pooled Non-infec... 46 4.4 1
(EW830412) G894P579RP17.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW827819) G894P576RD20.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW826970) G894P577RA15.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW809771) G893P558RJ15.T0 Ixodes scapularis Pooled Non-infe... 46 4.4 1
(EW786381) G893P58RD11.T0 Ixodes scapularis Pooled Non-infec... 46 4.4 1
(CP000097) Synechococcus sp. CC9902, complete genome. 46 4.4 1
(FL635387) TG_309_B20 Termite gut library Reticulitermes fla... 36 4.8 2
(FE140698) LV_HP_RA37H02f Litopenaeus vannamei hepatopancrea... 40 5.3 2
(FE092641) LV_GL_RA45C19r Litopenaeus vannamei gills cDNA li... 40 5.3 2
(BX511193) Zebrafish DNA sequence from clone DKEY-149J18 in ... 40 5.5 4
(FE185036) LV_NC_RA36L11r Litopenaeus vannamei nerve cord cD... 40 5.6 2
(FE136684) LV_HP_RA28N12r Litopenaeus vannamei hepatopancrea... 40 5.7 2
(FE134433) LV_HP_RA23M03r Litopenaeus vannamei hepatopancrea... 40 5.7 2
(FE099999) LV_HC_RA032B02r Litopenaeus vannamei hemocyte cDN... 40 6.3 2
(FP016077) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 40 6.5 5
(CR301881) mte1-20G13FM1 BAC end, cultivar Jemalong A17 of M... 44 6.5 2
(CR318023) mte1-42N4FM1 BAC end, cultivar Jemalong A17 of Me... 44 6.6 2
(AL402775) T3 end of clone AT0AA004E12 of library AT0AA from... 38 6.8 2
(EG550056) MM05P07_XP Sugar Beet germination cDNA library Be... 42 9.6 2
(X96871) Equine Rhinovirus type 2 genomic sequence. 32 9.6 2
(AC145293) Mus musculus BAC clone RP24-109O8 from chromosome... 44 9.9 2
>(U27536) Dictyostelium discoideum cystathionine beta synthase mRNA,
complete cds.
Length = 1511
Score = 1570 bits (792), Expect(6) = 0.0
Identities = 795/796 (99%)
Strand = Plus / Plus
Query: 477 ttcgtacaccaactgaagcagcatttgatgcaccagagtcacatattggtgttgcaaaga 536
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 428 ttcgtacaccaactgaagcagcatttgatgcaccagagtcacatattggtgttgcaaaga 487
Query: 537 aattaaattcagagattccaaattcccacattttagatcaatacggtaacccatccaatc 596
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 488 aattaaattcagagattccaaattcccacattttagatcaatacggtaacccatccaatc 547
Query: 597 cattggcccattacgatggtaccgccgaagaactcctcgaacaatgtgagggtaagattg 656
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 548 cattggcccattacgatggtaccgccgaagaactcctcgaacaatgtgagggtaagattg 607
Query: 657 atatgatcgtttgcacagccggtaccggtggtacaatcactggtattgccagaaagatca 716
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 608 atatgatcgtttgcacagccggtaccggtggtacaatcactggtattgccagaaagatca 667
Query: 717 aagaaagacttccaaactgtatcgtcgttggtgtcgatccacatggttcaattctcgctc 776
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 668 aagaaagacttccaaactgtatcgtcgttggtgtcgatccacatggttcaattctcgctc 727
Query: 777 aaccagaatcactcaacaataccaacaagagttacaaaatcgaaggtatcggttacgatt 836
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 728 aaccagaatcactcaacaataccaacaagagttacaaaatcgaaggtatcggttacgatt 787
Query: 837 tcattccaaacgttctcgaacgtaaattagtcgatcaatggatcaaaaccgacgataagg 896
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 788 tcattccaaacgttctcgaacgtaaattagtcgatcaatggatcaaaaccgacgataagg 847
Query: 897 aatctttcatcatggctcgtcgtctcattaaagaagaaggtctcctttgcggtggtagtt 956
||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||
Sbjct: 848 aatctttcatcatggctcgtcgtctcattaaagaagaaggtctcctttgcgctggtagtt 907
Query: 957 caggttccgctatggttggtgcactcctagccgccaaacaattgaaaaaaggtcaacgtt 1016
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 908 caggttccgctatggttggtgcactcctagccgccaaacaattgaaaaaaggtcaacgtt 967
Query: 1017 gtgttgtcttattagccgattccattagaaactatatgaccaaacatttaaatgatgatt 1076
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 968 gtgttgtcttattagccgattccattagaaactatatgaccaaacatttaaatgatgatt 1027
Query: 1077 ggttagtcgacaatggtttcgttgatccagaatacaaaactaaagatcaacaagaagaag 1136
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1028 ggttagtcgacaatggtttcgttgatccagaatacaaaactaaagatcaacaagaagaag 1087
Query: 1137 agaaatatcatggtgccaccgtcaaagatttaacactcccaaaaccaatcaccatctctg 1196
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1088 agaaatatcatggtgccaccgtcaaagatttaacactcccaaaaccaatcaccatctctg 1147
Query: 1197 ccaccaccacttgtgctgccgcagttcaactcctccaacaatatggtttcgatcaattac 1256
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1148 ccaccaccacttgtgctgccgcagttcaactcctccaacaatatggtttcgatcaattac 1207
Query: 1257 cagtcgttagtgaatc 1272
||||||||||||||||
Sbjct: 1208 cagtcgttagtgaatc 1223
Score = 484 bits (244), Expect(6) = 0.0
Identities = 244/244 (100%)
Strand = Plus / Plus
Query: 119 cagaagaactccaaagaaattaattatggataatattcttgataatattggtggaacacc 178
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 72 cagaagaactccaaagaaattaattatggataatattcttgataatattggtggaacacc 131
Query: 179 attagttagagttaataaagtttcatcagatttagaatgtgaattagttgcaaaatgtga 238
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 132 attagttagagttaataaagtttcatcagatttagaatgtgaattagttgcaaaatgtga 191
Query: 239 atttttcaatgcaggtggttcagttaaggatcgtattggtcatcgtatgattgttgatgc 298
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 192 atttttcaatgcaggtggttcagttaaggatcgtattggtcatcgtatgattgttgatgc 251
Query: 299 agaagagagtggtagaattaagaaaggagatacattaattgaaccaacctctggtaacac 358
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 252 agaagagagtggtagaattaagaaaggagatacattaattgaaccaacctctggtaacac 311
Query: 359 tggt 362
||||
Sbjct: 312 tggt 315
Score = 426 bits (215), Expect(6) = 0.0
Identities = 215/215 (100%)
Strand = Plus / Plus
Query: 1321 tgcctctaaaaaagctgtcccaactgatgctgtcagtaaagttatgttccgtttcactaa 1380
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1269 tgcctctaaaaaagctgtcccaactgatgctgtcagtaaagttatgttccgtttcactaa 1328
Query: 1381 aaatgaaaaatatattccaatcactcaatcaacttctttagctactcttagcaaattttt 1440
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1329 aaatgaaaaatatattccaatcactcaatcaacttctttagctactcttagcaaattttt 1388
Query: 1441 cgaaaatcatagcagtgctatcgtaactgaaaatgatgaaatcatttcaattgtaactaa 1500
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1389 cgaaaatcatagcagtgctatcgtaactgaaaatgatgaaatcatttcaattgtaactaa 1448
Query: 1501 aattgatttattaacttatttaatgaaatctcaac 1535
|||||||||||||||||||||||||||||||||||
Sbjct: 1449 aattgatttattaacttatttaatgaaatctcaac 1483
Score = 218 bits (110), Expect(6) = 0.0
Identities = 113/114 (99%)
Strand = Plus / Plus
Query: 364 attggtttagcattgacagcagccatcaaaggttacaaaatgatcattacactcccagag 423
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 316 attggtttagcattgacagcagccatcaaaggttacaaaatgatcattacactcccagag 375
Query: 424 aaaatgtcacaagagaaagttgatgtcttgaaagcattgggagcagagatcatt 477
||||||||||||||||||||||||||||||||||||||||||| ||||||||||
Sbjct: 376 aaaatgtcacaagagaaagttgatgtcttgaaagcattgggaggagagatcatt 429
Score = 141 bits (71), Expect(6) = 0.0
Identities = 71/71 (100%)
Strand = Plus / Plus
Query: 47 atgtcagcaccagaaggaccatcaaaatgcacttggactccaaataccactgaaaacact 106
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atgtcagcaccagaaggaccatcaaaatgcacttggactccaaataccactgaaaacact 60
Query: 107 ccacataccac 117
|||||||||||
Sbjct: 61 ccacataccac 71
Score = 46.1 bits (23), Expect(6) = 0.0
Identities = 23/23 (100%)
Strand = Plus / Plus
Query: 1286 ggtcaactcactcttggtaactt 1308
|||||||||||||||||||||||
Sbjct: 1236 ggtcaactcactcttggtaactt 1258
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,782,434,666
Number of extensions: 105132051
Number of successful extensions: 8240996
Number of sequences better than 10.0: 387
Length of query: 1734
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1710
Effective length of database: 96,409,374,237
Effective search space: 164860029945270
Effective search space used: 164860029945270
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.20 |
| Homology vs Protein |
Query= Contig-U16081-1 (Contig-U16081-1Q) /CSM_Contig/Contig-U16081-1Q.Seq.d
(1734 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U27536_1(U27536|pid:none) Dictyostelium discoideum cystathionine... 605 0.0
AF424661_1(AF424661|pid:none) Phytophthora infestans clone MY-10... 352 e-132
BC044091_1(BC044091|pid:none) Xenopus laevis cystathionine-beta-... 330 e-125
BC077504_1(BC077504|pid:none) Xenopus laevis cystathionine-beta-... 332 e-125
AK077669_1(AK077669|pid:none) Mus musculus 8 days embryo whole b... 321 e-124
EU315112_1(EU315112|pid:none) Oncorhynchus mykiss cystathionine-... 324 e-123
M88346_1(M88346|pid:none) Rat cystathionine beta-synthase mRNA, ... 320 e-123
BC171477_1(BC171477|pid:none) Danio rerio cystathionine-beta-syn... 318 e-122
BC155149_1(BC155149|pid:none) Danio rerio cystathionine-beta-syn... 318 e-122
D01098_1(D01098|pid:none) Rattus norvegicus mRNA for hemoprotein... 317 e-122
(P32232) RecName: Full=Cystathionine beta-synthase; EC=... 315 e-121
(Q58H57) RecName: Full=Cystathionine beta-synthase; EC=... 311 e-120
BC151539_1(BC151539|pid:none) Bos taurus cystathionine-beta-synt... 309 e-120
EU716632_1(EU716632|pid:none) Synthetic construct N-EGFP/cystath... 311 e-119
AY891587_1(AY891587|pid:none) Synthetic construct Homo sapiens c... 311 e-119
(P35520) RecName: Full=Cystathionine beta-synthase; EC=... 311 e-119
AK294608_1(AK294608|pid:none) Homo sapiens cDNA FLJ53863 complet... 311 e-119
CP000497_215(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 296 e-112
AM270101_16(AM270101|pid:none) Aspergillus niger contig An05c001... 282 e-109
EU595730_1(EU595730|pid:none) Emericella nidulans cystathionine ... 282 e-107
AF090120_4(AF090120|pid:none) Fugu rubripes beta-amyloid precurs... 273 e-107
AF422799_1(AF422799|pid:none) Magnaporthe grisea cystathionine b... 286 e-106
FN392320_1188(FN392320|pid:none) Pichia pastoris GS115 chromosom... 281 e-105
AF367364_1(AF367364|pid:none) Pichia pastoris cystathionine beta... 276 e-103
AE014298_3195(AE014298|pid:none) Drosophila melanogaster chromos... 254 3e-99
EF103414_1(EF103414|pid:none) Haliotis discus discus cystathioni... 240 2e-93
CR380951_127(CR380951|pid:none) Candida glabrata strain CBS138 c... 261 4e-93
CU928179_288(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 263 3e-92
CU928168_169(CU928168|pid:none) Kluyveromyces thermotolerans str... 251 2e-91
AE017354_2889(AE017354|pid:none) Legionella pneumophila subsp. p... 216 9e-91
CP000675_3151(CP000675|pid:none) Legionella pneumophila str. Cor... 215 1e-90
CR628337_2894(CR628337|pid:none) Legionella pneumophila str. Len... 215 1e-90
CR382126_405(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 248 9e-90
(P32582) RecName: Full=Cystathionine beta-synthase; EC=... 244 1e-89
D16502_1(D16502|pid:none) Saccharomyces cerevisiae genes for cys... 242 4e-89
D16496_1(D16496|pid:none) Saccharomyces cerevisiae NHS5 gene for... 237 1e-87
BC091981_1(BC091981|pid:none) Danio rerio cystathionine-beta-syn... 320 3e-87
L14578_1(L14578|pid:none) Saccharomyces cerevisiae cystathionine... 239 1e-86
CP001020_1844(CP001020|pid:none) Coxiella burnetii CbuK_Q154, co... 208 1e-85
AE016828_1765(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 208 1e-85
FN357298_67(FN357298|pid:none) Schistosoma mansoni genome sequen... 206 1e-83
AP007171_792(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 201 2e-82
AC024136_1(AC024136|pid:none) Caenorhabditis elegans cosmid F54A... 205 5e-77
AM502235_28(AM502235|pid:none) Leishmania infantum chromosome 17. 201 5e-73
AF296847_1(AF296847|pid:none) Trypanosoma cruzi cystathionine be... 206 7e-73
AF256080_1(AF256080|pid:none) Leishmania tarentolae cystathionin... 167 7e-71
CP000117_4129(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 182 8e-71
CP000875_3702(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 167 1e-70
CP000113_1984(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 174 8e-68
CP000159_1092(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 150 1e-64
AL939115_24(AL939115|pid:none) Streptomyces coelicolor A3(2) com... 161 1e-64
CP000088_436(CP000088|pid:none) Thermobifida fusca YX, complete ... 164 2e-64
AP009493_4452(AP009493|pid:none) Streptomyces griseus subsp. gri... 158 8e-64
AF319543_2(AF319543|pid:none) Streptomyces venezuelae putative a... 151 7e-62
AE017341_607(AE017341|pid:none) Cryptococcus neoformans var. neo... 145 1e-61
AM746676_439(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ... 185 7e-61
AP009153_3907(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 146 8e-61
CP000750_1078(CP000750|pid:none) Kineococcus radiotolerans SRS30... 146 7e-60
BX842656_200(BX842656|pid:none) Bdellovibrio bacteriovorus compl... 142 1e-58
CP000454_3040(CP000454|pid:none) Arthrobacter sp. FB24, complete... 146 1e-57
CP000316_2778(CP000316|pid:none) Polaromonas sp. JS666, complete... 139 1e-57
CP000431_5784(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 146 4e-57
CP000509_912(CP000509|pid:none) Nocardioides sp. JS614, complete... 148 5e-57
AP011115_5904(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 146 5e-57
AB075037_2(AB075037|pid:none) Rhodococcus erythropolis pDR51-orf... 147 8e-57
AM398681_1160(AM398681|pid:none) Flavobacterium psychrophilum JI... 135 1e-56
CP001338_1104(CP001338|pid:none) Candidatus Methanosphaerula pal... 144 7e-56
CP000474_2908(CP000474|pid:none) Arthrobacter aurescens TC1, com... 139 9e-56
AP006618_4852(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 139 1e-55
AE016958_1024(AE016958|pid:none) Mycobacterium avium subsp. para... 141 1e-55
CP000780_1980(CP000780|pid:none) Candidatus Methanoregula boonei... 132 3e-55
CP000384_4132(CP000384|pid:none) Mycobacterium sp. MCS, complete... 142 2e-54
CP000580_4338(CP000580|pid:none) Mycobacterium sp. JLS, complete... 142 3e-54
AP009256_490(AP009256|pid:none) Bifidobacterium adolescentis ATC... 137 6e-54
CP000820_6292(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 132 8e-54
CP000251_3694(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 165 5e-53
CP001359_3809(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 164 6e-53
AE000516_1145(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 131 1e-52
CP000769_3805(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 160 1e-52
CP001131_3731(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 162 2e-52
CP000511_4598(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 137 3e-52
AM420293_878(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 132 5e-52
CT573213_759(CT573213|pid:none) Frankia alni str. ACN14A chromos... 127 9e-52
CP000605_914(CP000605|pid:none) Bifidobacterium longum DJO10A, c... 127 7e-51
AE016825_3395(AE016825|pid:none) Chromobacterium violaceum ATCC ... 129 6e-50
CP001213_1078(CP001213|pid:none) Bifidobacterium animalis subsp.... 128 8e-50
CP000822_1657(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 131 2e-49
AL583925_130(AL583925|pid:none) Mycobacterium leprae strain TN c... 138 2e-49
CP001620_783(CP001620|pid:none) Corynebacterium kroppenstedtii D... 139 2e-49
AE003849_600(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 136 5e-49
H89621(H89621) protein ZC373.1 [imported] - Caenorhabditis elega... 197 1e-48
Z49131_1(Z49131|pid:none) Caenorhabditis elegans Cosmid ZC373, c... 197 1e-48
CP000850_2846(CP000850|pid:none) Salinispora arenicola CNS-205, ... 112 1e-48
CP000783_2689(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 123 1e-48
CP001393_1543(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 98 2e-48
CP000438_418(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA1... 122 4e-48
AE008922_594(AE008922|pid:none) Xanthomonas campestris pv. campe... 146 4e-48
BA000012_3464(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 123 1e-47
AP009389_247(AP009389|pid:none) Pelotomaculum thermopropionicum ... 101 1e-47
CP000854_4326(CP000854|pid:none) Mycobacterium marinum M, comple... 139 1e-47
AP008229_707(AP008229|pid:none) Xanthomonas oryzae pv. oryzae MA... 146 3e-47
AM743169_582(AM743169|pid:none) Stenotrophomonas maltophilia K27... 144 3e-47
CP000325_174(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 136 6e-47
CP000382_2065(CP000382|pid:none) Clostridium novyi NT, complete ... 97 7e-47
CP000927_4889(CP000927|pid:none) Caulobacter sp. K31, complete g... 125 9e-47
CP000744_498(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp... 117 9e-47
CP001111_488(CP001111|pid:none) Stenotrophomonas maltophilia R55... 143 1e-46
AM746676_7388(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 102 2e-46
CP000724_2148(CP000724|pid:none) Alkaliphilus metalliredigens QY... 107 2e-46
CP000679_1658(CP000679|pid:none) Caldicellulosiruptor saccharoly... 95 4e-46
CP000647_3344(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 121 5e-46
CP000930_1679(CP000930|pid:none) Heliobacterium modesticaldum Ic... 96 5e-46
AP006725_4251(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 121 6e-46
DQ643993_3(DQ643993|pid:none) Klebsiella pneumoniae strain W70 m... 120 1e-45
AM746676_8798(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 121 2e-45
CP000964_698(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 118 5e-45
BX572600_189(BX572600|pid:none) Rhodopseudomonas palustris CGA00... 137 7e-45
CP000568_1819(CP000568|pid:none) Clostridium thermocellum ATCC 2... 101 1e-44
CP000110_2315(CP000110|pid:none) Synechococcus sp. CC9605, compl... 109 3e-44
CP000142_1846(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 100 3e-44
AP009049_907(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 105 3e-44
CP000826_1621(CP000826|pid:none) Serratia proteamaculans 568, co... 112 4e-44
CP000095_175(CP000095|pid:none) Prochlorococcus marinus str. NAT... 106 5e-44
CP000232_1667(CP000232|pid:none) Moorella thermoacetica ATCC 390... 100 7e-44
CP000553_196(CP000553|pid:none) Prochlorococcus marinus str. NAT... 107 1e-43
CP001390_2503(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 93 1e-43
AP008934_2243(AP008934|pid:none) Staphylococcus saprophyticus su... 88 1e-43
CP001337_1956(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 97 2e-43
CP001056_3239(CP001056|pid:none) Clostridium botulinum B str. Ek... 101 3e-43
AE008691_1052(AE008691|pid:none) Thermoanaerobacter tengcongensi... 93 3e-43
CP000471_3373(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 100 4e-43
AE008691_2291(AE008691|pid:none) Thermoanaerobacter tengcongensi... 91 7e-43
AP008955_4786(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 101 1e-42
CP000930_1626(CP000930|pid:none) Heliobacterium modesticaldum Ic... 99 2e-42
CP001472_960(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 110 2e-42
CP000939_740(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 103 2e-42
AE001437_2205(AE001437|pid:none) Clostridium acetobutylicum ATCC... 97 3e-42
CP001098_2288(CP001098|pid:none) Halothermothrix orenii H 168, c... 92 3e-42
CP000975_228(CP000975|pid:none) Methylacidiphilum infernorum V4,... 91 6e-42
CP001338_1161(CP001338|pid:none) Candidatus Methanosphaerula pal... 96 8e-42
CP000686_1457(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 95 1e-41
(P63870) RecName: Full=Cysteine synthase; Short=CSase; ... 85 1e-41
AE016879_1678(AE016879|pid:none) Bacillus anthracis str. Ames, c... 92 1e-41
CP000923_1413(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 90 1e-41
CU459003_1353(CU459003|pid:none) Magnetospirillum gryphiswaldens... 88 1e-41
CP000804_2590(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 94 1e-41
CP000728_716(CP000728|pid:none) Clostridium botulinum F str. Lan... 101 1e-41
CP000230_786(CP000230|pid:none) Rhodospirillum rubrum ATCC 11170... 114 2e-41
CP000360_2092(CP000360|pid:none) Acidobacteria bacterium Ellin34... 97 2e-41
AP008230_4189(AP008230|pid:none) Desulfitobacterium hafniense Y5... 94 2e-41
AF276772_3(AF276772|pid:none) Methanosarcina thermophila cystein... 91 2e-41
CP001581_783(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 100 2e-41
CP000703_525(CP000703|pid:none) Staphylococcus aureus subsp. aur... 83 3e-41
CP001638_2228(CP001638|pid:none) Geobacillus sp. WCH70, complete... 101 3e-41
CP001176_1700(CP001176|pid:none) Bacillus cereus B4264, complete... 91 3e-41
CP000726_701(CP000726|pid:none) Clostridium botulinum A str. ATC... 101 3e-41
(Q9XEA8) RecName: Full=Cysteine synthase; Short=CSase; ... 94 4e-41
CP001186_1664(CP001186|pid:none) Bacillus cereus G9842, complete... 91 4e-41
AB029511_1(AB029511|pid:none) Solanum tuberosum PCS-1 mRNA for c... 98 5e-41
CP000923_751(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 89 5e-41
CP000853_325(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 92 5e-41
AP008955_170(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 88 5e-41
CP001638_1715(CP001638|pid:none) Geobacillus sp. WCH70, complete... 97 5e-41
FJ483542_1(FJ483542|pid:none) Corynebacterium ammoniagenes cyste... 86 6e-41
CP000096_1516(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 96 6e-41
CP001083_719(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 100 8e-41
BA000004_88(BA000004|pid:none) Bacillus halodurans C-125 DNA, co... 86 1e-40
FJ625861_11(FJ625861|pid:none) Clostridium sp. enrichment cultur... 95 1e-40
(O23735) RecName: Full=Cysteine synthase; Short=CSase; ... 98 2e-40
CP000607_293(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 95 2e-40
CP001100_1494(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 95 2e-40
CP000828_4969(CP000828|pid:none) Acaryochloris marina MBIC11017,... 91 3e-40
AP006716_2497(AP006716|pid:none) Staphylococcus haemolyticus JCS... 87 3e-40
CP000283_4171(CP000283|pid:none) Rhodopseudomonas palustris BisB... 106 4e-40
BX548175_2548(BX548175|pid:none) Prochlorococcus marinus MIT9313... 104 4e-40
AE015927_1192(AE015927|pid:none) Clostridium tetani E88, complet... 87 4e-40
DQ285606_1(DQ285606|pid:none) Azospirillum brasilense O-acetyl s... 83 5e-40
AM295250_162(AM295250|pid:none) Staphylococcus carnosus subsp. c... 84 5e-40
CP000075_1582(CP000075|pid:none) Pseudomonas syringae pv. syring... 93 7e-40
AJ965256_888(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 99 7e-40
CP000769_2468(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 91 7e-40
CP000885_1215(CP000885|pid:none) Clostridium phytofermentans ISD... 89 7e-40
CP001628_1669(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 109 8e-40
CP000951_961(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 84 9e-40
CP000922_755(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 98 9e-40
CP000058_1504(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 93 1e-39
CP000764_2933(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 96 1e-39
BA000022_872(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA, ... 96 1e-39
(P73410) RecName: Full=Cysteine synthase; Short=CSase; ... 96 1e-39
CP000353_202(CP000353|pid:none) Ralstonia metallidurans CH34 meg... 87 2e-39
CP000240_1927(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 93 2e-39
CP001104_39(CP001104|pid:none) Eubacterium eligens ATCC 27750, c... 94 2e-39
(Q5HRP1) RecName: Full=Cysteine synthase; Short=CSase; ... 83 2e-39
CP000962_756(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 95 2e-39
CP000300_377(CP000300|pid:none) Methanococcoides burtonii DSM 62... 86 2e-39
AB031003_1(AB031003|pid:none) Cyanidioschyzon merolae cmOASTL1 g... 100 3e-39
AL646053_276(AL646053|pid:none) Ralstonia solanacearum GMI1000 m... 87 3e-39
CP001037_5975(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 86 3e-39
AP006841_3424(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 89 3e-39
AB040503_1(AB040503|pid:none) Allium tuberosum Bsas1 mRNA for cy... 94 4e-39
(Q00834) RecName: Full=Cysteine synthase; EC=2.5.1.47; ... 91 4e-39
CP000435_2527(CP000435|pid:none) Synechococcus sp. CC9311, compl... 100 4e-39
CP000117_452(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 97 4e-39
CP001197_2635(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 96 4e-39
CP000962_198(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 87 4e-39
CP001359_2829(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 86 5e-39
CP001101_2149(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 93 5e-39
AM412317_203(AM412317|pid:none) Clostridium botulinum A str. ATC... 87 5e-39
DQ086195_1(DQ086195|pid:none) Ictalurus punctatus cystathionine ... 89 6e-39
CP001344_4274(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 82 7e-39
AM849034_505(AM849034|pid:none) Clavibacter michiganensis subsp.... 88 7e-39
CP001131_2741(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 86 9e-39
CP001108_1947(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 93 9e-39
CP000448_1386(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 91 9e-39
Z78415_11(Z78415|pid:none) Caenorhabditis elegans Cosmid C17G1, ... 95 1e-38
AM421808_680(AM421808|pid:none) Neisseria meningitidis serogroup... 80 1e-38
(O81154) RecName: Full=Cysteine synthase; EC=2.5.1.47; ... 94 1e-38
CP000117_1345(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 83 1e-38
CP000875_3318(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 86 1e-38
CP000544_1663(CP000544|pid:none) Halorhodospira halophila SL1, c... 85 2e-38
AB2121(AB2121) cysteine synthase (EC 4.2.99.8) [similarity] - No... 97 2e-38
CR626927_4247(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 79 2e-38
AP006841_4564(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 79 2e-38
CP000251_1276(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 86 2e-38
BA000028_1703(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 87 2e-38
CP000571_1524(CP000571|pid:none) Burkholderia pseudomallei 668 c... 92 2e-38
AM087458_1(AM087458|pid:none) Nicotiana tabacum mRNA for putativ... 87 2e-38
AY450295_1(AY450295|pid:none) Nicotiana plumbaginifolia cysteine... 87 2e-38
AH2374(AH2374) cysteine synthase (EC 4.2.99.8) [similarity] - No... 96 2e-38
CP000117_2497(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 96 2e-38
AP009044_2515(AP009044|pid:none) Corynebacterium glutamicum R DN... 85 2e-38
CP000112_3073(CP000112|pid:none) Desulfovibrio desulfuricans G20... 94 2e-38
CP001071_1977(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 91 2e-38
CP000562_450(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 86 2e-38
CP000153_433(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 86 2e-38
CP000728_199(CP000728|pid:none) Clostridium botulinum F str. Lan... 85 2e-38
CP000712_1301(CP000712|pid:none) Pseudomonas putida F1, complete... 88 3e-38
AP009179_388(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic D... 91 3e-38
CP001349_4980(CP001349|pid:none) Methylobacterium nodulans ORS 2... 87 3e-38
CP000251_2660(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 84 3e-38
AP006627_109(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 82 3e-38
CP001581_204(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 85 3e-38
CP000838_294(CP000838|pid:none) Acaryochloris marina MBIC11017 p... 95 4e-38
CP000780_415(CP000780|pid:none) Candidatus Methanoregula boonei ... 90 4e-38
CP001628_890(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 81 4e-38
BA000028_84(BA000028|pid:none) Oceanobacillus iheyensis HTE831 D... 85 4e-38
CP001099_663(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 84 4e-38
(P47999) RecName: Full=Cysteine synthase, chloroplastic/chromopl... 95 6e-38
X81698_1(X81698|pid:none) A.thaliana cpACS1 mRNA for cysteine sy... 95 6e-38
FJ232911_1(FJ232911|pid:none) Porphyra yezoensis putative cystei... 92 6e-38
(Q43317) RecName: Full=Cysteine synthase; Short=CSase; ... 91 6e-38
CT573326_3715(CT573326|pid:none) Pseudomonas entomophila str. L4... 86 6e-38
AF198621_4(AF198621|pid:none) Bacillus stearothermophilus putati... 82 6e-38
AE017333_75(AE017333|pid:none) Bacillus licheniformis DSM 13, co... 83 6e-38
CP000777_2903(CP000777|pid:none) Leptospira biflexa serovar Pato... 80 7e-38
AM942444_1592(AM942444|pid:none) Corynebacterium urealyticum DSM... 82 7e-38
AX063963_1(AX063963|pid:none) Sequence 245 from Patent WO0100843. 81 7e-38
CP001176_4327(CP001176|pid:none) Bacillus cereus B4264, complete... 91 8e-38
CP000252_283(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 92 1e-37
(O81155) RecName: Full=Cysteine synthase, chloroplastic/chromopl... 88 1e-37
CP000356_1879(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 91 1e-37
(O32978) RecName: Full=Cysteine synthase A; Short=CSase... 90 1e-37
CP001186_4400(CP001186|pid:none) Bacillus cereus G9842, complete... 91 1e-37
AE017126_403(AE017126|pid:none) Prochlorococcus marinus subsp. m... 91 1e-37
EF145037_1(EF145037|pid:none) Populus trichocarpa clone WS0111_L... 86 1e-37
AE015451_4510(AE015451|pid:none) Pseudomonas putida KT2440 compl... 86 1e-37
AE004091_2710(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 82 1e-37
CP000806_209(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 81 1e-37
BA000022_86(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA, c... 79 1e-37
AM711867_668(AM711867|pid:none) Clavibacter michiganensis subsp.... 85 1e-37
AF287914_1(AF287914|pid:none) Selenomonas ruminantium O-acetylse... 85 1e-37
AE016879_4248(AE016879|pid:none) Bacillus anthracis str. Ames, c... 91 1e-37
CP000813_57(CP000813|pid:none) Bacillus pumilus SAFR-032, comple... 81 1e-37
BA000040_4453(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 83 2e-37
CP000111_428(CP000111|pid:none) Prochlorococcus marinus str. MIT... 89 2e-37
AF452451_1(AF452451|pid:none) Glycine max cysteine synthase mRNA... 89 2e-37
CP000485_3757(CP000485|pid:none) Bacillus thuringiensis str. Al ... 91 2e-37
AE015928_3079(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 84 2e-37
CP001087_682(CP001087|pid:none) Desulfobacterium autotrophicum H... 92 2e-37
(P37887) RecName: Full=Cysteine synthase; Short=CSase; ... 80 2e-37
AE017194_4420(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 91 2e-37
CP001407_4298(CP001407|pid:none) Bacillus cereus 03BB102, comple... 91 2e-37
AE017340_217(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 104 2e-37
CP000859_1162(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 88 2e-37
CP000551_458(CP000551|pid:none) Prochlorococcus marinus str. AS9... 88 2e-37
EU031817_1(EU031817|pid:none) Sesamum indicum O-acetylserine(thi... 92 2e-37
AC135320_25(AC135320|pid:none) Medicago truncatula clone mth2-28... 88 2e-37
(P38076) RecName: Full=Cysteine synthase; EC=2.5.1.47; ... 87 2e-37
CP000926_4066(CP000926|pid:none) Pseudomonas putida GB-1, comple... 85 2e-37
CP000951_240(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 93 2e-37
AE017283_951(AE017283|pid:none) Propionibacterium acnes KPA17120... 80 2e-37
CP000557_2432(CP000557|pid:none) Geobacillus thermodenitrificans... 89 2e-37
CP000227_4055(CP000227|pid:none) Bacillus cereus Q1, complete ge... 91 2e-37
BA000045_798(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 93 3e-37
CP000825_142(CP000825|pid:none) Prochlorococcus marinus str. MIT... 90 3e-37
CP000140_943(CP000140|pid:none) Parabacteroides distasonis ATCC ... 83 3e-37
CP000090_1787(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 89 4e-37
CP000576_427(CP000576|pid:none) Prochlorococcus marinus str. MIT... 87 4e-37
CP001291_4526(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 81 4e-37
AJ535197_1(AJ535197|pid:none) Propionibacterium freudenreichii s... 95 4e-37
CP000551_142(CP000551|pid:none) Prochlorococcus marinus str. AS9... 90 4e-37
CP001344_4738(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 90 4e-37
AM286690_1023(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 83 4e-37
CP000102_429(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 83 4e-37
AP007255_199(AP007255|pid:none) Magnetospirillum magneticum AMB-... 82 4e-37
BA000043_2541(BA000043|pid:none) Geobacillus kaustophilus HTA426... 90 4e-37
(P80608) RecName: Full=Cysteine synthase; Short=CSase; ... 88 5e-37
AP009552_5168(AP009552|pid:none) Microcystis aeruginosa NIES-843... 94 5e-37
CP000922_1521(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 86 5e-37
AL138647_3(AL138647|pid:none) Arabidopsis thaliana DNA chromosom... 88 6e-37
CP000248_1117(CP000248|pid:none) Novosphingobium aromaticivorans... 81 6e-37
CP001032_4386(CP001032|pid:none) Opitutus terrae PB90-1, complet... 86 6e-37
AM778906_9(AM778906|pid:none) Microcystis aeruginosa PCC 7806 ge... 93 6e-37
CP000509_4254(CP000509|pid:none) Nocardioides sp. JS614, complet... 82 6e-37
CP000854_3590(CP000854|pid:none) Mycobacterium marinum M, comple... 80 6e-37
CP000227_66(CP000227|pid:none) Bacillus cereus Q1, complete geno... 78 6e-37
AK316875_1(AK316875|pid:none) Arabidopsis thaliana AT3G59760 mRN... 87 8e-37
GN098594_1(GN098594|pid:none) Sequence 3375 from Patent WO200903... 89 8e-37
(Q43725) RecName: Full=Cysteine synthase, mitochondrial; ... 87 8e-37
CP000552_469(CP000552|pid:none) Prochlorococcus marinus str. MIT... 86 8e-37
CP000325_1210(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 80 8e-37
AB100142_1(AB100142|pid:none) Geobacillus stearothermophilus gen... 78 8e-37
BA000043_65(BA000043|pid:none) Geobacillus kaustophilus HTA426 D... 78 8e-37
CR382138_711(CR382138|pid:none) Debaryomyces hansenii strain CBS... 92 1e-36
AM087457_1(AM087457|pid:none) Nicotiana tabacum partial mRNA for... 89 1e-36
C89009(C89009) cysteine synthase (EC 4.2.99.8) [similarity] - Ca... 99 1e-36
EF584897_1(EF584897|pid:none) Glycine max OAS-TL2 cysteine synth... 91 1e-36
CP000485_61(CP000485|pid:none) Bacillus thuringiensis str. Al Ha... 78 1e-36
AE006470_690(AE006470|pid:none) Chlorobium tepidum TLS, complete... 81 1e-36
AJ130879_2(AJ130879|pid:none) Clostridium sticklandii ORFX' (par... 81 1e-36
AK230249_1(AK230249|pid:none) Arabidopsis thaliana mRNA for cyto... 85 1e-36
AM425401_1(AM425401|pid:none) Vitis vinifera contig VV78X191797.... 83 1e-36
CP000552_138(CP000552|pid:none) Prochlorococcus marinus str. MIT... 90 1e-36
BX294145_52(BX294145|pid:none) Rhodopirellula baltica SH 1 compl... 87 1e-36
CP000474_2312(CP000474|pid:none) Arthrobacter aurescens TC1, com... 78 1e-36
CP000487_881(CP000487|pid:none) Campylobacter fetus subsp. fetus... 85 1e-36
EF084091_1(EF084091|pid:none) Picea sitchensis clone WS0272_O08 ... 90 2e-36
CP000554_2099(CP000554|pid:none) Prochlorococcus marinus str. MI... 86 2e-36
CP000544_547(CP000544|pid:none) Halorhodospira halophila SL1, co... 92 2e-36
CP000949_3846(CP000949|pid:none) Pseudomonas putida W619, comple... 83 2e-36
CP001087_2645(CP001087|pid:none) Desulfobacterium autotrophicum ... 88 2e-36
BA000039_2310(BA000039|pid:none) Thermosynechococcus elongatus B... 82 2e-36
AF078693_1(AF078693|pid:none) Chlamydomonas reinhardtii putative... 85 2e-36
BX569690_319(BX569690|pid:none) Synechococcus sp. WH8102 complet... 85 2e-36
AE016877_61(AE016877|pid:none) Bacillus cereus ATCC 14579, compl... 78 2e-36
EF148573_1(EF148573|pid:none) Populus trichocarpa x Populus delt... 87 3e-36
CP001344_1318(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 86 3e-36
CP000151_1821(CP000151|pid:none) Burkholderia sp. 383 chromosome... 82 3e-36
CP001104_714(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 77 3e-36
AP010904_1712(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 87 3e-36
CP001283_64(CP001283|pid:none) Bacillus cereus AH820, complete g... 78 3e-36
CP001186_63(CP001186|pid:none) Bacillus cereus G9842, complete g... 78 3e-36
CP001078_2741(CP001078|pid:none) Clostridium botulinum E3 str. A... 74 3e-36
AK065007_1(AK065007|pid:none) Oryza sativa Japonica Group cDNA c... 86 4e-36
CP000769_3569(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 80 4e-36
BA000039_503(BA000039|pid:none) Thermosynechococcus elongatus BP... 87 4e-36
CP000155_2492(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 84 4e-36
CP000272_237(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 85 4e-36
CP001055_24(CP001055|pid:none) Elusimicrobium minutum Pei191, co... 87 4e-36
(P32260) RecName: Full=Cysteine synthase, chloroplastic/chromopl... 87 5e-36
AE017194_66(AE017194|pid:none) Bacillus cereus ATCC 10987, compl... 78 5e-36
CP001322_3796(CP001322|pid:none) Desulfatibacillum alkenivorans ... 80 6e-36
CP001016_210(CP001016|pid:none) Beijerinckia indica subsp. indic... 78 6e-36
CP000094_1412(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 80 6e-36
CP001001_3314(CP001001|pid:none) Methylobacterium radiotolerans ... 79 6e-36
AP008231_1337(AP008231|pid:none) Synechococcus elongatus PCC 630... 78 8e-36
CP000076_1494(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 78 8e-36
BX571874_109(BX571874|pid:none) Photorhabdus luminescens subsp. ... 101 8e-36
CP000097_658(CP000097|pid:none) Synechococcus sp. CC9902, comple... 82 8e-36
CP000111_134(CP000111|pid:none) Prochlorococcus marinus str. MIT... 87 8e-36
AF073695_1(AF073695|pid:none) Oryza sativa cysteine synthase (rc... 82 8e-36
(Q9XEA6) RecName: Full=Cysteine synthase; Short=CSase; ... 82 8e-36
CP000769_2628(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 83 8e-36
CP000319_1962(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 79 1e-35
EF535995_1(EF535995|pid:none) Glycine soja O-acetylserine (thiol... 83 1e-35
AP008957_1091(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 77 1e-35
AP000731_2(AP000731|pid:none) Arabidopsis thaliana genomic DNA, ... 75 1e-35
AF213822_3(AF213822|pid:none) Zymomonas mobilis strain ZM4 fosmi... 75 1e-35
CP000312_152(CP000312|pid:none) Clostridium perfringens SM101, c... 106 2e-35
AY045825_1(AY045825|pid:none) Arabidopsis thaliana putative cyto... 85 2e-35
CR931997_394(CR931997|pid:none) Corynebacterium jeikeium K411 co... 74 2e-35
CP001175_2388(CP001175|pid:none) Listeria monocytogenes HCC23, c... 82 2e-35
AM263198_186(AM263198|pid:none) Listeria welshimeri serovar 6b s... 82 2e-35
AE017262_231(AE017262|pid:none) Listeria monocytogenes str. 4b F... 82 2e-35
AH1102(AH1102) cysteine synthase (EC 4.2.99.8) [similarity] - Li... 82 2e-35
U97004_6(U97004|pid:none) Caenorhabditis elegans cosmid R08E5, c... 94 2e-35
CP001056_3001(CP001056|pid:none) Clostridium botulinum B str. Ek... 74 2e-35
CP001101_2094(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 101 2e-35
AY766093_1(AY766093|pid:none) Allium sativum chloroplast cystein... 87 2e-35
CP001341_2160(CP001341|pid:none) Arthrobacter chlorophenolicus A... 75 2e-35
AE017285_660(AE017285|pid:none) Desulfovibrio vulgaris subsp. vu... 84 2e-35
AB028629_2(AB028629|pid:none) Clostridium perfringens metB, cysK... 105 3e-35
BT056009_1(BT056009|pid:none) Zea mays full-length cDNA clone ZM... 89 3e-35
CP000494_3692(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 79 3e-35
CP000095_442(CP000095|pid:none) Prochlorococcus marinus str. NAT... 85 3e-35
CP001157_3174(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 79 3e-35
AM181176_1501(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 79 3e-35
A75477(A75477) cysteine synthase (EC 4.2.99.8) DR0789 [similarit... 86 3e-35
CP000697_2522(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 79 3e-35
CP000153_154(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 84 3e-35
CP000148_2953(CP000148|pid:none) Geobacter metallireducens GS-15... 75 3e-35
AM455579_1(AM455579|pid:none) Vitis vinifera contig VV78X180489.... 88 4e-35
CP000764_62(CP000764|pid:none) Bacillus cereus subsp. cytotoxis ... 75 4e-35
CP000312_1291(CP000312|pid:none) Clostridium perfringens SM101, ... 81 5e-35
CP000246_159(CP000246|pid:none) Clostridium perfringens ATCC 131... 104 7e-35
T23591(T23591) cysteine synthase (EC 4.2.99.8) K10H10.2 [similar... 86 7e-35
CP000908_949(CP000908|pid:none) Methylobacterium extorquens PA1,... 79 7e-35
CP000027_1095(CP000027|pid:none) Dehalococcoides ethenogenes 195... 84 7e-35
CP000478_2655(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 84 7e-35
BX571660_88(BX571660|pid:none) Wolinella succinogenes, complete ... 82 9e-35
CP000758_1004(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 75 9e-35
CP000738_3505(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 76 9e-35
AE007869_301(AE007869|pid:none) Agrobacterium tumefaciens str. C... 75 9e-35
EF088803_1(EF088803|pid:none) Halobacillus halophilus strain DSM... 80 9e-35
FM992694_386(FM992694|pid:none) Candida dubliniensis CD36 chromo... 83 1e-34
CP000910_3276(CP000910|pid:none) Renibacterium salmoninarum ATCC... 79 1e-34
AP006627_2783(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 78 1e-34
(P31300) RecName: Full=Cysteine synthase, chloroplastic/chromopl... 80 2e-34
AB029513_1(AB029513|pid:none) Solanum tuberosum PCS-2-2 mRNA for... 77 2e-34
CP000319_1685(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 78 2e-34
CP000254_2106(CP000254|pid:none) Methanospirillum hungatei JF-1,... 81 2e-34
CT573213_3271(CT573213|pid:none) Frankia alni str. ACN14A chromo... 84 2e-34
AP007281_1677(AP007281|pid:none) Lactobacillus reuteri JCM 1112 ... 80 2e-34
AP010904_3072(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 80 3e-34
BT039546_1(BT039546|pid:none) Zea mays full-length cDNA clone ZM... 86 3e-34
AC124964_18(AC124964|pid:none) Medicago truncatula clone mth2-27... 78 3e-34
CP000453_1705(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 75 3e-34
CP000499_662(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 82 4e-34
CP001154_967(CP001154|pid:none) Laribacter hongkongensis HLHK9, ... 76 4e-34
AB028632_1(AB028632|pid:none) Entamoeba dispar gene for cysteine... 84 6e-34
CP001029_895(CP001029|pid:none) Methylobacterium populi BJ001, c... 79 6e-34
AL591688_341(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 74 6e-34
AB077204_1(AB077204|pid:none) Fusobacterium nucleatum cdl gene f... 83 6e-34
S48695(S48695;S49587)cysteine synthase (EC 4.2.99.8) isoform 7-4... 84 7e-34
CP000377_1439(CP000377|pid:none) Silicibacter sp. TM1040, comple... 75 7e-34
CP000084_782(CP000084|pid:none) Candidatus Pelagibacter ubique H... 80 7e-34
CR378665_221(CR378665|pid:none) Photobacterium profundum SS9; se... 76 7e-34
AE017180_532(AE017180|pid:none) Geobacter sulfurreducens PCA, co... 76 7e-34
AY353092_1(AY353092|pid:none) Populus x canescens O-acetylserine... 88 7e-34
AC091811_1(AC091811|pid:none) Oryza sativa chromosome 3 BAC OSJN... 92 7e-34
AE008917_101(AE008917|pid:none) Brucella melitensis 16M chromoso... 72 1e-33
CP000708_1736(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 72 1e-33
S49586(S49586) cysteine synthase (EC 4.2.99.8) ACS1 - Arabidopsi... 85 1e-33
BA000037_979(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr... 76 1e-33
AF186381_1(AF186381|pid:none) Bacillus thermoleovorans cysteine ... 76 1e-33
CP000781_75(CP000781|pid:none) Xanthobacter autotrophicus Py2, c... 79 2e-33
AM040264_1968(AM040264|pid:none) Brucella melitensis biovar Abor... 72 2e-33
CP000829_1175(CP000829|pid:none) Streptococcus pyogenes NZ131, c... 76 2e-33
CP000423_465(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 81 2e-33
CP001131_3349(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 109 2e-33
CP001359_3411(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 109 2e-33
CU459003_1417(CU459003|pid:none) Magnetospirillum gryphiswaldens... 72 2e-33
CP001191_4295(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 76 2e-33
CP000494_4098(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 76 2e-33
(Q5XAQ3) RecName: Full=Cysteine synthase; Short=CSase; ... 76 2e-33
AE009949_1343(AE009949|pid:none) Streptococcus pyogenes MGAS8232... 76 2e-33
AM295007_460(AM295007|pid:none) Streptococcus pyogenes Manfredo ... 76 2e-33
AJ580401_1(AJ580401|pid:none) Arabidopsis halleri subsp. halleri... 85 2e-33
CP001281_2862(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 77 2e-33
CU234118_3767(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 76 3e-33
AE004092_1246(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 76 3e-33
CP001389_3602(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 72 3e-33
AK070508_1(AK070508|pid:none) Oryza sativa Japonica Group cDNA c... 93 3e-33
CP000250_476(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 75 3e-33
CP000283_341(CP000283|pid:none) Rhodopseudomonas palustris BisB5... 75 5e-33
AE016830_267(AE016830|pid:none) Enterococcus faecalis V583, comp... 95 5e-33
CP001001_1082(CP001001|pid:none) Methylobacterium radiotolerans ... 82 6e-33
AP009384_709(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 82 6e-33
CP001196_2186(CP001196|pid:none) Oligotropha carboxidovorans OM5... 79 6e-33
CP001124_1963(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 75 6e-33
CU694397_7(CU694397|pid:none) Ralstonia solanacearum strain MolK... 76 6e-33
X81973_1(X81973|pid:none) A.thaliana mRNA for cysteine synthase. 79 8e-33
AP007162_235(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 74 8e-33
CP000056_1365(CP000056|pid:none) Streptococcus pyogenes MGAS6180... 76 8e-33
CP000233_1697(CP000233|pid:none) Lactobacillus salivarius UCC118... 83 8e-33
AB006900_1(AB006900|pid:none) Entamoeba histolytica DNA for cyst... 79 1e-32
CP001114_866(CP001114|pid:none) Deinococcus deserti VCD115, comp... 80 1e-32
CP001074_355(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 74 1e-32
AM041150_5(AM041150|pid:none) Prosthecobacter debontii partial c... 87 1e-32
CP001107_2397(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 86 1e-32
AE016823_2016(AE016823|pid:none) Leptospira interrogans serovar ... 73 1e-32
L05184_1(L05184|pid:none) Spinacia oleracea chlorplast O-acetyls... 80 1e-32
CP000472_605(CP000472|pid:none) Shewanella piezotolerans WP3, co... 80 1e-32
CP000931_2561(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 80 1e-32
AP008232_1700(AP008232|pid:none) Sodalis glossinidius str. 'mors... 76 1e-32
CP000774_3628(CP000774|pid:none) Parvibaculum lavamentivorans DS... 77 2e-32
CP000033_1161(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 76 2e-32
CP000348_1136(CP000348|pid:none) Leptospira borgpetersenii serov... 71 2e-32
CP000655_1468(CP000655|pid:none) Polynucleobacter necessarius su... 82 2e-32
CP000407_428(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 79 2e-32
BA000031_797(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221... 74 2e-32
AE003852_952(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 72 2e-32
CP001341_286(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 88 2e-32
CP000348_1016(CP000348|pid:none) Leptospira borgpetersenii serov... 75 3e-32
CP000259_1323(CP000259|pid:none) Streptococcus pyogenes MGAS9429... 74 3e-32
CP000394_1397(CP000394|pid:none) Granulibacter bethesdensis CGDN... 71 4e-32
CP001349_2656(CP001349|pid:none) Methylobacterium nodulans ORS 2... 71 4e-32
CP000815_276(CP000815|pid:none) Paulinella chromatophora chromat... 92 4e-32
CP000964_1352(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 75 4e-32
AJ535196_1(AJ535196|pid:none) Propionibacterium freudenreichii s... 72 4e-32
>U27536_1(U27536|pid:none) Dictyostelium discoideum cystathionine beta
synthase mRNA, complete cds.
Length = 497
Score = 605 bits (1560), Expect(4) = 0.0
Identities = 313/353 (88%), Positives = 315/353 (89%)
Frame = +2
Query: 479 RTPTEAAFDAPESHIGVAKKLNSEIPNSHILDQYGNPSNPLAHYDGTAEELLEQCEGKID 658
RTPTEAAFDAPESHIGVAKKLNSEIPNSHILDQYGNPSNPLAHYDGTAEELLEQCEGKID
Sbjct: 144 RTPTEAAFDAPESHIGVAKKLNSEIPNSHILDQYGNPSNPLAHYDGTAEELLEQCEGKID 203
Query: 659 MIVCXXXXXXXXXXXXRKIKERLPNCIVVGVDPHGSILAQPESLNNTNKSYKIEGIGYDF 838
MIVC RKIKERLPNCIVVGVDPHGSILAQPESLNNTNKSYKIEGIGYDF
Sbjct: 204 MIVCTAGTGGTITGIARKIKERLPNCIVVGVDPHGSILAQPESLNNTNKSYKIEGIGYDF 263
Query: 839 IPNVLERKLVDQWIKTDDKESFIMARRLIKEEGLLCXXXXXXAMVGALLAAKQLKKGQRC 1018
IPNVLERKLVDQWIKTDDKESFIMARRLIKEEGLLC AMVGALLAAKQLKKGQRC
Sbjct: 264 IPNVLERKLVDQWIKTDDKESFIMARRLIKEEGLLCAGSSGSAMVGALLAAKQLKKGQRC 323
Query: 1019 VVLLADSIRNYMTKHLNDDWLVDNGFVDPEYKTKDQQEEEKYHGATVKDLTLPKPXXXXX 1198
VVLLADSIRNYMTKHLNDDWLVDNGFVDPEYKTKDQQEEEKYHGATVKDLTLPKP
Sbjct: 324 VVLLADSIRNYMTKHLNDDWLVDNGFVDPEYKTKDQQEEEKYHGATVKDLTLPKPITISA 383
Query: 1199 XXXXXXXVQLLQQYGFDQLPVVSESKKVLGQLTLGNLLSHIASKKAVPTDAVSKVMFRFT 1378
VQLLQQYGFDQLPVVSESKKVL L L++ ASKKAVPTDAVSKVMFRFT
Sbjct: 384 TTTCAAAVQLLQQYGFDQLPVVSESKKVLVNSLLVTSLTY-ASKKAVPTDAVSKVMFRFT 442
Query: 1379 KNEKYIPITQSTSLATLSKFFENHSSAIVTENDEIISIVTKIDLLTYLMKSQQ 1537
KNEKYIPITQSTSLATLSKFFENHSSAIVTENDEIISIVTKIDLLTYLMKSQQ
Sbjct: 443 KNEKYIPITQSTSLATLSKFFENHSSAIVTENDEIISIVTKIDLLTYLMKSQQ 495
Score = 165 bits (417), Expect(4) = 0.0
Identities = 81/81 (100%), Positives = 81/81 (100%)
Frame = +3
Query: 120 RRTPKKLIMDNILDNIGGTPLVRVNKVSSDLECELVAKCEFFNAGGSVKDRIGHRMIVDA 299
RRTPKKLIMDNILDNIGGTPLVRVNKVSSDLECELVAKCEFFNAGGSVKDRIGHRMIVDA
Sbjct: 25 RRTPKKLIMDNILDNIGGTPLVRVNKVSSDLECELVAKCEFFNAGGSVKDRIGHRMIVDA 84
Query: 300 EESGRIKKGDTLIEPTSGNTG 362
EESGRIKKGDTLIEPTSGNTG
Sbjct: 85 EESGRIKKGDTLIEPTSGNTG 105
Score = 72.0 bits (175), Expect(4) = 0.0
Identities = 37/38 (97%), Positives = 37/38 (97%)
Frame = +1
Query: 364 IGLALTAAIKGYKMIITLPEKMSQEKVDVLKALGAEII 477
IGLALTAAIKGYKMIITLPEKMSQEKVDVLKALG EII
Sbjct: 106 IGLALTAAIKGYKMIITLPEKMSQEKVDVLKALGGEII 143
Score = 26.2 bits (56), Expect(4) = 0.0
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = +2
Query: 47 MSAPEGPSKC 76
MSAPEGPSKC
Sbjct: 1 MSAPEGPSKC 10
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,735,056,830
Number of extensions: 56342144
Number of successful extensions: 169509
Number of sequences better than 10.0: 1149
Number of HSP's gapped: 167984
Number of HSP's successfully gapped: 3019
Length of query: 578
Length of database: 1,051,180,864
Length adjustment: 134
Effective length of query: 444
Effective length of database: 617,481,958
Effective search space: 274161989352
Effective search space used: 274161989352
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
2 |
| VH (FL, L) |
1 |
| VF (FL, S) |
8 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
5 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
12 |
| CH (FL, L) |
0 |
| CF (FL, S) |
5 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |