| Contig-U16069-1 |
| Contig ID |
Contig-U16069-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
2156 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
4008933 |
| End point |
4010052 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
10 |
| Number of EST |
12 |
| Link to clone list |
U16069 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 3.10 |
| Homology vs DNA |
Query= Contig-U16069-1 (Contig-U16069-1Q) /CSM_Contig/Contig-U16069-1Q.Seq.d
(2166 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AU060293) Dictyostelium discoideum slug cDNA, clone SLA886. 1322 0.0 1
(AU267889) Dictyostelium discoideum vegetative cDNA clone:VS... 1156 0.0 1
(BJ384565) Dictyostelium discoideum cDNA clone:ddc49m23, 3' ... 817 0.0 2
(BJ401292) Dictyostelium discoideum cDNA clone:dds22d22, 3' ... 674 0.0 2
(AU267888) Dictyostelium discoideum vegetative cDNA clone:VS... 1017 0.0 1
(BJ414551) Dictyostelium discoideum cDNA clone:ddv19g14, 5' ... 999 0.0 1
(AU262199) Dictyostelium discoideum vegetative cDNA clone:VS... 846 0.0 1
(BJ432726) Dictyostelium discoideum cDNA clone:ddv19g14, 3' ... 733 0.0 2
(AU033488) Dictyostelium discoideum slug cDNA, clone SLA886. 694 0.0 1
(AU052351) Dictyostelium discoideum slug cDNA, clone SLD181. 529 e-145 1
(BJ390537) Dictyostelium discoideum cDNA clone:dds22d22, 5' ... 337 e-144 3
(CV158504) HISTERID25PCR_D02_1_015 Hister sp. cDNA Hister sp... 101 3e-36 3
(DY887291) CeleSEQ3234 Cunninghamella elegans pBluescript (E... 98 7e-34 4
(AY722643) Apis mellifera clone NBB-f-08 mRNA sequence. 94 2e-33 3
(DY895279) CeleSEQ15066 Cunninghamella elegans pBluescript (... 98 2e-32 4
(DY887906) CeleSEQ4725 Cunninghamella elegans pBluescript (E... 90 1e-31 4
(DY680211) TTDA614TG Tetrahymena thermophila EST library str... 90 5e-29 2
(EV837525) FTSA423TF Tetrahymena thermophila SB210 cDNA libr... 90 5e-29 2
(CN596449) TTE00006817 Normalized large Tetrahymena thermoph... 90 6e-29 2
(EV828331) FTSA871TF Tetrahymena thermophila SB210 cDNA libr... 80 1e-28 3
(DY894937) CeleSEQ14630 Cunninghamella elegans pBluescript (... 98 2e-28 3
(DY885908) CeleSEQ1353 Cunninghamella elegans pBluescript (E... 98 3e-28 3
(CV181570) tai77f02.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 62 3e-26 5
(DY886129) CeleSEQ1659 Cunninghamella elegans pBluescript (E... 98 9e-26 4
(DV868032) CRP7764 Creeping bentgrass EST Agrostis stolonife... 68 1e-23 4
(EL915815) INIT2_95_F12.g2_A006 G5 trophont cDNA (INIT2) Ich... 86 3e-22 3
(EL915888) INIT2_96_F11.g2_A006 G5 trophont cDNA (INIT2) Ich... 86 4e-22 3
(BI508464) BB170027B10C05.5 Bee Brain Normalized/Subtracted ... 94 5e-22 2
(BI503829) BB170025B20F12.5 Bee Brain Normalized/Subtracted ... 94 5e-22 2
(DN200614) USDA-FP_138678 Citrus root weevil whole body adul... 70 3e-21 3
(CZ538976) SRAA-aad23a05.b1 Strongyloides ratti whole genome... 78 1e-20 2
(EJ215200) 1092351073254 Global-Ocean-Sampling_GS-27-01-01-1... 78 1e-20 2
(CZ534270) SRAA-aac90c07.b1 Strongyloides ratti whole genome... 78 1e-20 2
(DR444119) AR1005C05 A. gomesiana hemocytes normalized libra... 78 5e-20 4
(DR448466) AR1056A03 A. gomesiana hemocytes normalized libra... 78 7e-20 4
(CT784072) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 8e-20 3
(CT755829) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 1e-19 3
(CT763561) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 1e-19 3
(BW637556) Dugesia ryukyuensis mRNA, clone: Dr_sW_008_N16, 5... 82 2e-19 5
(DN301710) PL04023A2H04 cDNA from sexually mature hermaphodi... 80 4e-19 4
(DN312597) PL06013A2E01 cDNA from juvenile hermaphodites Sch... 80 7e-19 4
(DV609730) EST1212726 Glossina morsitans morsitans Fat body ... 76 1e-18 4
(DV606183) EST1209179 Glossina morsitans morsitans Fat body ... 76 1e-18 4
(DV606026) EST1209022 Glossina morsitans morsitans Fat body ... 76 1e-18 4
(DV609819) EST1212815 Glossina morsitans morsitans Fat body ... 76 2e-18 4
(EE003108) ROE00011654 Rhizopus oryzae Company Rhizopus oryz... 62 3e-18 3
(EE006506) ROE00000725 Rhizopus oryzae Company Rhizopus oryz... 62 3e-18 3
(BP510432) Hydra magnipapillata cDNA, clone:hmp_05393. 62 3e-18 4
(EE007611) ROE00002402 Rhizopus oryzae Company Rhizopus oryz... 62 4e-18 3
(EE009073) ROE00005004 Rhizopus oryzae Company Rhizopus oryz... 62 5e-18 3
(CV174249) EUCLIDIA35PCR_C09_1_066 Euclidia glyphica cDNA Eu... 72 7e-18 2
(CT739731) Paramecium tetraurelia 3-PRIME EST from clone LK0... 66 2e-17 3
(EE009502) ROE00005292 Rhizopus oryzae Company Rhizopus oryz... 62 2e-17 3
(ES220790) MpGV_ag1_J23 Myzus persicae, line G006, PLRV infe... 88 1e-16 2
(DW012310) w16i8_M13F Myzus persicae, tobacco lineage, whole... 88 1e-16 2
(EC388862) F05_F05gm2c10_pDNRf_490761 Myzus persicae, line G... 88 1e-16 2
(ES450639) 25609 Myzus persicae 2001-12 (red), Fenton Myzus ... 88 1e-16 2
(EH756934) CNSL1748.b1_G06.ab1 CNS(LMS) yellow starthistle C... 88 1e-16 2
(EC390972) H10_H10nb3p20__449781 Myzus persicae, tobacco lin... 88 1e-16 2
(EE262433) D04_D04fm1n8_pDNRf_520838 Myzus persicae, line F0... 88 1e-16 2
(EE261521) C12_C12ff5n23_pDNRf_515138 Myzus persicae, line F... 88 1e-16 2
(EE570805) A10_A10fv4a19_pDNRf_531392 Myzus persicae, line F... 88 1e-16 2
(EE264034) E03_E03gf3k5_pDNRf_505416 Myzus persicae, line G0... 88 1e-16 2
(EE571162) D08_D08fv3b16_pDNRf_530995 Myzus persicae, line F... 88 1e-16 2
(EY256324) BF01011A2E04.f1 Normalized subtracted keck librar... 68 2e-16 4
(DV609820) EST1212816 Glossina morsitans morsitans Fat body ... 76 4e-16 4
(CV181750) tai77f02.y1 Hydra EST UCI 5 ALP Hydra magnipapill... 66 1e-15 2
(FC656896) CAXW15063.fwd CAXW Lottia gigantea from female go... 58 3e-15 4
(DR448768) AR1059C11 A. gomesiana hemocytes normalized libra... 70 3e-15 3
(FC710357) CAXY6300.fwd CAXY Lottia gigantea from male gonad... 58 3e-15 4
(FC616586) CAXS8343.fwd CAXS Lottia gigantea from head, foot... 58 4e-15 4
(FC753685) CBBI7502.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 58 4e-15 4
(EE000402) ROE00014020 Rhizopus oryzae Company Rhizopus oryz... 62 2e-14 2
(EE003092) ROE00014160 Rhizopus oryzae Company Rhizopus oryz... 62 2e-14 2
(EE004091) ROE00013961 Rhizopus oryzae Company Rhizopus oryz... 62 2e-14 2
(DV613243) EST1216239 Glossina morsitans morsitans Fat body ... 76 3e-14 4
(EE263993) D11_D11gf2n22_pDNRf_505191 Myzus persicae, line G... 88 3e-14 2
(DV610769) EST1213765 Glossina morsitans morsitans Fat body ... 76 3e-14 4
(CP000655) Polynucleobacter sp. QLW-P1DMWA-1, complete genome. 66 6e-14 4
(EK142545) 1095456001103 Global-Ocean-Sampling_GS-31-01-01-1... 48 6e-14 3
(FG085604) CMRC-FF-IH0-aca-n-02-0-CMRC.r1 Ceratitis capitata... 88 7e-14 3
(FG084441) CMRC-FF-IH0-abx-a-16-0-CMRC.r1 Ceratitis capitata... 88 7e-14 3
(DV609731) EST1212727 Glossina morsitans morsitans Fat body ... 76 7e-14 4
(EJ479678) 1095403461251 Global-Ocean-Sampling_GS-28-01-01-1... 60 1e-13 5
(DC238199) Hodotermopsis sjoestedti cDNA clone: MY0734BHsHg_... 56 1e-13 4
(FF798210) XABT91574.fwd Gateway compatible cien cDNA librar... 62 1e-13 4
(FD458069) LARV056TF Haematobia irritans 1st Instar Larvae H... 86 2e-13 2
(FC753684) CBBI7502.rev CBBI Lottia gigantea 26h,37h,61h Lar... 58 2e-13 3
(EJ635530) 1092986901119 Global-Ocean-Sampling_GS-29-01-01-1... 60 2e-13 5
(FC616585) CAXS8343.rev CAXS Lottia gigantea from head, foot... 58 2e-13 3
(EJ635450) 1092986900924 Global-Ocean-Sampling_GS-29-01-01-1... 60 2e-13 5
(EC999167) ROE00011341 Rhizopus oryzae Company Rhizopus oryz... 58 2e-13 2
(FG077638) UI-FF-IF0-abs-g-10-0-UI.r1 Ceratitis capitata emb... 88 4e-13 2
(FG083537) UI-FF-IH0-abe-b-07-0-UI.r1 Ceratitis capitata adu... 88 4e-13 2
(FG075603) UI-FF-IF0-abm-c-09-0-UI.r1 Ceratitis capitata emb... 88 4e-13 2
(BW348173) Ciona intestinalis cDNA, clone:ciem838k18, 5'end,... 62 5e-13 3
(AV998975) Ciona intestinalis cDNA, clone:cicl47h12, 5' end,... 62 5e-13 3
(AV889339) Ciona intestinalis cDNA, clone:rcicl47h12, 3' end... 62 6e-13 3
(FC657788) CAXW15598.fwd CAXW Lottia gigantea from female go... 48 6e-13 5
(FF775020) XABT75901.fwd Gateway compatible cien cDNA librar... 62 6e-13 3
(BW336688) Ciona intestinalis cDNA, clone:ciem803l21, 5'end,... 62 6e-13 3
(BW341717) Ciona intestinalis cDNA, clone:ciem819f16, 5'end,... 62 6e-13 3
(BW340421) Ciona intestinalis cDNA, clone:ciem815g01, 5'end,... 62 6e-13 3
(FK165156) XABT189440.b1 Gateway compatible cien cDNA librar... 62 6e-13 3
(BW260399) Ciona intestinalis cDNA, clone:cign024h12, 5' end... 62 7e-13 3
(FF772746) XABT74421.fwd Gateway compatible cien cDNA librar... 62 7e-13 3
(FK204928) XABT213976.b1 Gateway compatible cien cDNA librar... 62 7e-13 3
(FF749115) XABT58340.fwd Gateway compatible cien cDNA librar... 62 8e-13 3
(FF727751) XABT42973.fwd Gateway compatible cien cDNA librar... 62 8e-13 3
(DV606184) EST1209180 Glossina morsitans morsitans Fat body ... 76 1e-12 3
(DV606027) EST1209023 Glossina morsitans morsitans Fat body ... 76 1e-12 3
(DV619786) EST1222782 Glossina morsitans morsitans Fat body ... 76 1e-12 3
(DV618151) EST1221147 Glossina morsitans morsitans Fat body ... 76 1e-12 3
(DV739163) ID0AFF12DA09CM1 ID0AFF Acyrthosiphon pisum cDNA c... 66 1e-12 2
(FF320748) 280409988 Pea aphid whole body normalized full le... 66 1e-12 2
(CN586218) USDA-FP_129290 Acyrthosiphon pisum, Pea Aphid Acy... 66 1e-12 2
(EX646005) 256707464 Pea aphid whole body normalized full le... 66 2e-12 2
(EX635055) 256599727 Pea aphid whole body normalized full le... 66 2e-12 2
(FF322146) 280413607 Pea aphid whole body normalized full le... 66 2e-12 2
(FF325874) 280427324 Pea aphid whole body normalized full le... 66 2e-12 2
(FF331898) 280448534 Pea aphid whole body normalized full le... 66 2e-12 2
(FF305959) 279364974 Pea aphid whole body normalized full le... 66 2e-12 2
(FF296278) 279310951 Pea aphid whole body normalized full le... 66 2e-12 2
(FF336010) 280461245 Pea aphid whole body normalized full le... 66 2e-12 2
(FF323541) 280418279 Pea aphid whole body normalized full le... 66 2e-12 2
(EX615733) 255390371 Pea aphid whole body normalized full le... 66 2e-12 2
(EX605498) 255349499 Pea aphid whole body normalized full le... 66 2e-12 2
(EX651658) 256760594 Pea aphid whole body normalized full le... 66 2e-12 2
(FF325704) 280427929 Pea aphid whole body normalized full le... 66 2e-12 2
(FF330009) 280441580 Pea aphid whole body normalized full le... 66 2e-12 2
(FF326621) 280429465 Pea aphid whole body normalized full le... 66 2e-12 2
(FF305635) 279363213 Pea aphid whole body normalized full le... 66 2e-12 2
(FF328343) 280435949 Pea aphid whole body normalized full le... 66 2e-12 2
(FF308234) 279372174 Pea aphid whole body normalized full le... 66 2e-12 2
(EE570260) C11_C11fm3b21_pDNRf_532554 Myzus persicae, line F... 88 2e-12 1
(DW010470) w10m18_M13F Myzus persicae, tobacco lineage, whol... 88 2e-12 1
(EX640660) 256634310 Pea aphid whole body normalized full le... 66 2e-12 2
(FF311777) 279383531 Pea aphid whole body normalized full le... 66 2e-12 2
(CN585314) USDA-FP_128385 Acyrthosiphon pisum, Pea Aphid Acy... 66 2e-12 2
(CN762010) ID0AAA3BH07RM1 ApMS Acyrthosiphon pisum cDNA clon... 66 2e-12 2
(CN762009) ID0AAA3BH07FM1 ApMS Acyrthosiphon pisum cDNA clon... 66 2e-12 2
(FF690000) XABT102955.fwd Gateway compatible cien cDNA libra... 62 2e-12 3
(CB409062) IPG015A02_251026 JH III-treated male I. pini midg... 78 3e-12 2
(AK114153) Ciona intestinalis cDNA, clone:cicl041i19, full i... 62 3e-12 3
(BW353526) Ciona intestinalis cDNA, clone:ciem854n14, 5'end,... 52 4e-12 3
(EY256384) BF01011A2G09.f1 Normalized subtracted keck librar... 52 9e-12 4
(FF720714) XABT37929.fwd Gateway compatible cien cDNA librar... 70 1e-11 2
(FF953121) CBWU82423.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF917540) CBWU59659.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(BW424755) Ciona intestinalis cDNA, clone:cima849m14, 3'end,... 70 1e-11 2
(FF952589) CBWU82093.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF974330) CBWU95818.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF701958) XABT110812.fwd Gateway compatible cien cDNA libra... 70 1e-11 2
(FF974163) CBWU95722.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF917541) CBWU59659.g1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF873096) CBWU16391.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF879901) CBWU20282.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FK095604) XABT145737.b1 Gateway compatible cien cDNA librar... 70 1e-11 2
(FF923383) CBWU63257.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF858650) CBWU7085.b1 Yutaka Satou unpublished cDNA library... 70 1e-11 2
(FF958953) CBWU86018.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FF862768) CBWU9387.b1 Yutaka Satou unpublished cDNA library... 70 1e-11 2
(FK206458) XABT214912.b1 Gateway compatible cien cDNA librar... 70 1e-11 2
(FF936986) CBWU72446.b1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FG001355) CBWU116689.b1 Yutaka Satou unpublished cDNA libra... 70 1e-11 2
(FF989004) CBWU106241.b1 Yutaka Satou unpublished cDNA libra... 70 1e-11 2
(BW359650) Ciona intestinalis cDNA, clone:cima819d14, 5'end,... 70 1e-11 2
(FK101450) XABT149286.b1 Gateway compatible cien cDNA librar... 70 1e-11 2
(FF790056) XABT86120.fwd Gateway compatible cien cDNA librar... 70 1e-11 2
(BW370278) Ciona intestinalis cDNA, clone:cima849m14, 5'end,... 70 1e-11 2
(FF879902) CBWU20282.g1 Yutaka Satou unpublished cDNA librar... 70 1e-11 2
(FK168477) XABT191484.b1 Gateway compatible cien cDNA librar... 70 1e-11 2
(BW369394) Ciona intestinalis cDNA, clone:cima847d17, 5'end,... 70 1e-11 2
(FK217907) XABT222158.g1 Gateway compatible cien cDNA librar... 62 1e-11 2
(FK101451) XABT149286.g1 Gateway compatible cien cDNA librar... 70 1e-11 2
(FK165157) XABT189440.g1 Gateway compatible cien cDNA librar... 62 1e-11 2
(EY259498) BF01025A1H04.f1 Normalized subtracted keck librar... 52 1e-11 4
(FF801538) XABT93731.fwd Gateway compatible cien cDNA librar... 62 1e-11 3
(CU427098) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 64 1e-11 3
(CU437380) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 64 1e-11 3
(CU429990) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 64 1e-11 3
(CU431379) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 64 2e-11 3
(CU433516) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 64 2e-11 3
(EH632279) EST3386 LK04 Laupala kohalensis cDNA clone 106102... 58 2e-11 2
(FG131652) b1339 Periplaneta americana Whole Organism cDNA L... 64 2e-11 2
(EJ302622) 1095390046585 Global-Ocean-Sampling_GS-27-01-01-1... 62 3e-11 2
(FD453345) EGGAN08TF Haematobia irritans eggs Haematobia irr... 78 3e-11 2
(FD458070) LARV056TR Haematobia irritans 1st Instar Larvae H... 78 4e-11 2
(FD453346) EGGAN08TR Haematobia irritans eggs Haematobia irr... 78 4e-11 2
(FF922739) CBWU62864.b1 Yutaka Satou unpublished cDNA librar... 70 4e-11 2
(BW497848) Ciona intestinalis cDNA, clone:cima008b10, 3'end,... 68 4e-11 2
(EJ362078) 1092963690862 Global-Ocean-Sampling_GS-28-01-01-1... 60 4e-11 3
(EK256037) 1095462011170 Global-Ocean-Sampling_GS-31-01-01-1... 54 5e-11 4
(EJ639256) 1093010386624 Global-Ocean-Sampling_GS-29-01-01-1... 48 5e-11 3
(FF307925) 279370816 Pea aphid whole body normalized full le... 60 9e-11 2
(FF323744) 280419672 Pea aphid whole body normalized full le... 48 1e-10 3
(EE262866) A12_A12fvplus1e23_pDNRf_521859 Myzus persicae, li... 82 1e-10 1
(FF865242) CBWU11267.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(FF853180) CBWU3966.b1 Yutaka Satou unpublished cDNA library... 62 1e-10 3
(BW367813) Ciona intestinalis cDNA, clone:cima842j01, 5'end,... 62 1e-10 3
(EW966327) SFHL_01_B14_T7 Headlice composite library with al... 60 1e-10 2
(BW330637) Ciona intestinalis cDNA, clone:cidg837a14, 5'end,... 62 1e-10 3
(BW333244) Ciona intestinalis cDNA, clone:cidg844k12, 5'end,... 62 1e-10 3
(BW321391) Ciona intestinalis cDNA, clone:cidg807c14, 5'end,... 62 1e-10 3
(FF905721) CBWU37127.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(FF953698) CBWU82796.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(FF964704) CBWU89945.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(FF984104) CBWU97415.b1 Yutaka Satou unpublished cDNA librar... 70 1e-10 2
(FF948087) CBWU79359.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(BW384722) Ciona intestinalis cDNA, clone:cidg837a14, 3'end,... 62 1e-10 3
(FF985580) CBWU98288.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(FF954150) CBWU83089.b1 Yutaka Satou unpublished cDNA librar... 62 1e-10 3
(BW375320) Ciona intestinalis cDNA, clone:cidg807c14, 3'end,... 62 2e-10 3
(BW390038) Ciona intestinalis cDNA, clone:ciem801g02, 3'end,... 62 2e-10 3
(FF960506) CBWU87000.b1 Yutaka Satou unpublished cDNA librar... 62 2e-10 3
(EJ380863) 1092963761471 Global-Ocean-Sampling_GS-28-01-01-1... 58 2e-10 3
(FE828770) CCAG41788.b1 CCAG Petrolisthes cinctipes heart, g... 60 2e-10 2
(DV189180) BCT037_F08_BCT037_3700_91.ab1 C. tentans, embryo ... 54 2e-10 3
(FF731515) XABT45913.fwd Gateway compatible cien cDNA librar... 58 2e-10 3
(EJ938132) 1093018849510 Global-Ocean-Sampling_GS-30-02-01-1... 58 2e-10 3
(FE833994) CCAG44969.b1 CCAG Petrolisthes cinctipes heart, g... 60 3e-10 2
(FE768001) CCAG4118.b3 CCAG Petrolisthes cinctipes heart, gi... 60 3e-10 2
(FE817790) CCAG33690.b1 CCAG Petrolisthes cinctipes heart, g... 60 3e-10 2
(EX653009) 256788456 Pea aphid whole body normalized full le... 58 3e-10 2
(FF329785) 280441081 Pea aphid whole body normalized full le... 66 3e-10 2
(FE806372) CCAG26802.b1 CCAG Petrolisthes cinctipes heart, g... 60 4e-10 2
(EX641714) 256639722 Pea aphid whole body normalized full le... 66 4e-10 2
(FF298403) 279318245 Pea aphid whole body normalized full le... 66 4e-10 2
(FE768002) CCAG4118.g1 CCAG Petrolisthes cinctipes heart, gi... 60 4e-10 2
(CN589471) TTE00000294 Non-normalized Tetrahymena thermophil... 80 4e-10 1
(FF798209) XABT91574.rev Gateway compatible cien cDNA librar... 62 4e-10 3
(FD453033) EGGAL24TF Haematobia irritans eggs Haematobia irr... 78 5e-10 2
(FD453034) EGGAL24TR Haematobia irritans eggs Haematobia irr... 78 5e-10 2
(FD452894) EGGAK40TF Haematobia irritans eggs Haematobia irr... 78 5e-10 2
(FD452895) EGGAK40TR Haematobia irritans eggs Haematobia irr... 78 5e-10 2
(FD462325) LARVR55TF Haematobia irritans 1st Instar Larvae H... 78 5e-10 2
(FD462326) LARVR55TR Haematobia irritans 1st Instar Larvae H... 78 5e-10 2
(DX386853) Diversa 1104 Library 3 734791_R Library3 Area3 FB... 64 5e-10 2
(EJ300362) 1095390008651 Global-Ocean-Sampling_GS-27-01-01-1... 56 9e-10 3
(CK805478) AGENCOURT_19145605 NICHD_XGC_Te2 Xenopus laevis c... 74 1e-09 2
(FK217906) XABT222158.b1 Gateway compatible cien cDNA librar... 62 1e-09 3
(FC657787) CAXW15598.rev CAXW Lottia gigantea from female go... 48 1e-09 3
(FF853181) CBWU3966.g1 Yutaka Satou unpublished cDNA library... 62 2e-09 3
(CF549347) AGENCOURT_15597747 NICHD_XGC_Brn1 Xenopus laevis ... 74 2e-09 2
(CA755504) BR030022000_PLATE_E09_69_070.ab1 OA Oryza sativa ... 62 2e-09 3
(BU903053) AGENCOURT_10124885 NICHD_XGC_Kid1 Xenopus laevis ... 74 2e-09 2
(CD327268) AGENCOURT_14144182 NICHD_XGC_Eye1 Xenopus laevis ... 74 2e-09 2
(EB645382) AGENCOURT_75548013 NICHD_XGC_thy Xenopus laevis c... 74 2e-09 2
(FC613310) CAXS6545.rev CAXS Lottia gigantea from head, foot... 48 2e-09 3
(BC108621) Xenopus laevis hypothetical protein LOC733431, mR... 74 2e-09 2
(FC613311) CAXS6545.fwd CAXS Lottia gigantea from head, foot... 48 2e-09 3
(EJ802112) 1093017433914 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-09 4
(FF985581) CBWU98288.g1 Yutaka Satou unpublished cDNA librar... 62 2e-09 2
(FF885178) CBWU23525.b1 Yutaka Satou unpublished cDNA librar... 62 2e-09 2
(FF885179) CBWU23525.g1 Yutaka Satou unpublished cDNA librar... 62 2e-09 2
(FF960507) CBWU87000.g1 Yutaka Satou unpublished cDNA librar... 62 2e-09 2
(CU434028) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 2e-09 3
(EJ910456) 1093018535222 Global-Ocean-Sampling_GS-30-02-01-1... 52 2e-09 4
(CU439010) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 2e-09 3
(CU435753) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 2e-09 3
(CU429924) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 2e-09 3
(CU434455) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 3e-09 3
(CU424960) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 3e-09 3
(CU428803) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 3e-09 3
(BW641927) Dugesia ryukyuensis mRNA, clone: Dr_sW_022_M14, 5... 58 4e-09 4
(EX148731) ZRA63F ZRA Zoophthora radicans cDNA clone ZRA63 5... 66 5e-09 2
(FK169436) XABT192063.b1 Gateway compatible cien cDNA librar... 54 6e-09 3
(FK164483) XABT189030.b1 Gateway compatible cien cDNA librar... 54 6e-09 3
(FK090238) XABT142450.b1 Gateway compatible cien cDNA librar... 54 6e-09 3
(FF790867) XABT86658.rev Gateway compatible cien cDNA librar... 54 7e-09 3
(FF865243) CBWU11267.g1 Yutaka Satou unpublished cDNA librar... 60 7e-09 3
(FF790868) XABT86658.fwd Gateway compatible cien cDNA librar... 54 8e-09 3
(FE351806) CBIC2898.fwd CBIC_Daphnia_pulex_Chosen_One_Librar... 60 9e-09 3
(EC999619) ROE00014411 Rhizopus oryzae Company Rhizopus oryz... 58 1e-08 2
(EJ410025) 1093012132802 Global-Ocean-Sampling_GS-28-01-01-1... 48 1e-08 4
(DY680212) TTDA614TO Tetrahymena thermophila EST library str... 74 2e-08 1
(CN588683) TTE00000028 Non-normalized Tetrahymena thermophil... 74 2e-08 1
(BG162964) df28a11.y1 Wellcome CRC pRN3 head Xenopus laevis ... 74 2e-08 1
(BF613058) dd99b12.y1 Wellcome CRC pRN3 oocyte Xenopus laevi... 74 2e-08 1
(FF321768) 280414892 Pea aphid whole body normalized full le... 74 2e-08 1
(AW765098) da88b01.y1 Xenopus laevis tadpole stage 24 Xenopu... 74 2e-08 1
(FF756161) XABT63086.rev Gateway compatible cien cDNA librar... 50 3e-08 2
(FE351805) CBIC2898.rev CBIC_Daphnia_pulex_Chosen_One_Librar... 60 3e-08 3
(EE133788) SiJWD10ADA Lausanne fire ant library Solenopsis i... 50 5e-08 2
(EE146236) SiJWF01CAU2 Lausanne fire ant library Solenopsis ... 50 6e-08 2
(BM345385) rr54h11.y1 Globodera rostochiensis J2 pcDNAII Sma... 50 6e-08 2
(FE827766) CCAG41148.b1 CCAG Petrolisthes cinctipes heart, g... 52 6e-08 2
(EE130589) SiJWC01ABX Lausanne fire ant library Solenopsis i... 50 6e-08 2
(EE135904) SiJWF07BAS Lausanne fire ant library Solenopsis i... 50 7e-08 2
(CU427865) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 64 7e-08 2
(EE133328) SiJWH07ADJ Lausanne fire ant library Solenopsis i... 50 7e-08 2
(FE757818) CAYF5881.b3 CAYF Petrolisthes cinctipes heart, wh... 52 7e-08 2
(EB738767) AGENCOURT_78596840 NICHD_XGC_thy Xenopus laevis c... 68 8e-08 2
(EH764686) CNSM10707.b1_F14.ab1 CNS(LMS) yellow starthistle ... 72 1e-07 1
(FD464077) LARW347TF Haematobia irritans 1st Instar Larvae H... 70 1e-07 2
(FD464078) LARW347TR Haematobia irritans 1st Instar Larvae H... 70 1e-07 2
(ER615898) 1093017244057 Global-Ocean-Sampling_GS-36-01-01-2... 58 1e-07 2
(AV997270) Ciona intestinalis cDNA, clone:cicl41i19, 5' end,... 62 2e-07 2
(BI747977) rm48c04.y1 Meloidogyne arenaria egg pAMP1 v1 Chia... 50 2e-07 2
(FK059669) XABT123634.b1 Gateway compatible cien cDNA librar... 54 3e-07 3
(FF953122) CBWU82423.g1 Yutaka Satou unpublished cDNA librar... 70 3e-07 2
(BX561679) Glossina morsitans morsitans (Tseatse fly) EST fr... 70 4e-07 1
(CP000728) Clostridium botulinum F str. Langeland, complete ... 70 4e-07 1
(BM174591) Tm_ad_31C09_SKPL Trichuris muris (parasitic nemat... 58 4e-07 2
(FF955293) CBWU83812.b1 Yutaka Satou unpublished cDNA librar... 54 4e-07 2
(FF143567) TMAB-aab66b01.g1 T.muris_TMAB_EST_pSMART Trichuri... 58 4e-07 2
(FF954151) CBWU83089.g1 Yutaka Satou unpublished cDNA librar... 54 4e-07 2
(ER500638) 1093015397898 Global-Ocean-Sampling_GS-35-01-01-1... 52 5e-07 3
(CA996791) rg03c02.y1 Meloidogyne hapla J2 pAMP1 v1 Meloidog... 50 8e-07 2
(FF445997) G178P60067RF3.T0 Acorn worm gastrula/neurula pCMV... 60 9e-07 2
(FF491765) G708P5207RB5.T0 Acorn worm normalized gastrula pE... 60 1e-06 2
(FF476278) G613P6149RH10.T0 Acorn worm blastula/gastrula pCM... 60 1e-06 2
(FF520242) G710P5231RG11.T0 Acorn worm normalized juvenile p... 60 1e-06 2
(DT094954) JGI_ANNN1506.fwd ANNN Pimephales promelas Whole (... 62 1e-06 2
(EJ141933) 1092343659854 Global-Ocean-Sampling_GS-27-01-01-1... 60 1e-06 2
(EJ440444) 1093015302364 Global-Ocean-Sampling_GS-28-01-01-1... 60 1e-06 2
(ER588422) 1093016185349 Global-Ocean-Sampling_GS-36-01-01-2... 44 2e-06 3
(ER323532) 1092344193334 Global-Ocean-Sampling_GS-34-01-01-1... 44 2e-06 3
(FC849058) CBHN5582.fwd CBHN Metridium senile tentacle Metri... 50 4e-06 2
(AM875561) Venerupis (Ruditapes) philippinarum EST, 5' end s... 48 4e-06 3
(CK808473) Rasgsc1105 Salivary Gland 4th instar 3rd period (... 54 4e-06 2
(DT344223) JGI_CAAX8680.fwd CAAX Pimephales promelas testis ... 60 4e-06 2
(EW998027) HA_MX1_30d04_SP6 Lobster Multiple Tissues, Normal... 44 4e-06 3
(DT344222) JGI_CAAX8680.rev CAAX Pimephales promelas testis ... 60 4e-06 2
(CK811453) Rasgsc7164 Salivary Gland 4th instar 3rd period (... 54 4e-06 2
(EH759792) CNSL595.b2_E06.ab1 CNS(LMS) yellow starthistle Ce... 52 4e-06 2
(ER349296) 1092345448783 Global-Ocean-Sampling_GS-34-01-01-1... 40 5e-06 4
(ER576587) 1093015814404 Global-Ocean-Sampling_GS-36-01-01-2... 48 5e-06 2
(BC074535) Xenopus tropicalis enoyl Coenzyme A hydratase, sh... 66 6e-06 1
(EL844054) CBXT4723.b1 NICHD_XGC_trop_25 Xenopus (Silurana) ... 66 6e-06 1
(EL840496) CBXT2458.b1 NICHD_XGC_trop_25 Xenopus (Silurana) ... 66 6e-06 1
(EL827701) CBWN10120.b1 NICHD_XGC_tropTe1 Xenopus (Silurana)... 66 6e-06 1
(EL825848) CBWN8640.b1 NICHD_XGC_tropTe1 Xenopus (Silurana) ... 66 6e-06 1
(EL825162) CBWN8224.b1 NICHD_XGC_tropTe1 Xenopus (Silurana) ... 66 6e-06 1
(EL821208) CBWN5645.b1 NICHD_XGC_tropTe1 Xenopus (Silurana) ... 66 6e-06 1
(EL658838) AGENCOURT_103345838 NICHD_XGC_tropInt_66 Xenopus ... 66 6e-06 1
(EL636165) CBTC2454.fwd NICHD_XGC_tropBone1 Xenopus (Siluran... 66 6e-06 1
(EG652618) AGENCOURT_90945419 NICHD_XGC_tropInt_54 Xenopus (... 66 6e-06 1
(DV738841) ID0AFF11DD01CM1 ID0AFF Acyrthosiphon pisum cDNA c... 66 6e-06 1
(DT490579) WS02545.B21_F16 PT-MB-N-A-15 Populus trichocarpa ... 66 6e-06 1
(DT428265) JGI_CABJ7363.fwd NIH_XGC_tropSki1 Xenopus (Silura... 66 6e-06 1
(DT423780) JGI_CABJ4515.fwd NIH_XGC_tropSki1 Xenopus (Silura... 66 6e-06 1
(DT422108) JGI_CABJ3603.fwd NIH_XGC_tropSki1 Xenopus (Silura... 66 6e-06 1
(DT422107) JGI_CABJ3603.rev NIH_XGC_tropSki1 Xenopus (Silura... 66 6e-06 1
(DT418762) JGI_CABJ1781.fwd NIH_XGC_tropSki1 Xenopus (Silura... 66 6e-06 1
(DT389532) JGI_CABH7752.fwd NIH_XGC_tropSkeMus1 Xenopus (Sil... 66 6e-06 1
(DT389531) JGI_CABH7752.rev NIH_XGC_tropSkeMus1 Xenopus (Sil... 66 6e-06 1
(DT388057) JGI_CABH6951.fwd NIH_XGC_tropSkeMus1 Xenopus (Sil... 66 6e-06 1
(DT387216) JGI_CABH6122.fwd NIH_XGC_tropSkeMus1 Xenopus (Sil... 66 6e-06 1
(DR865152) JGI_CABG8313.rev NIH_XGC_tropSto1 Xenopus (Silura... 66 6e-06 1
(DR850311) JGI_CABE12939.fwd NIH_XGC_tropOva1 Xenopus (Silur... 66 6e-06 1
(DN098507) JGI_CABE7972.fwd NIH_XGC_tropOva1 Xenopus (Silura... 66 6e-06 1
(DN096262) JGI_CABE6789.fwd NIH_XGC_tropOva1 Xenopus (Silura... 66 6e-06 1
(DN096261) JGI_CABE6789.rev NIH_XGC_tropOva1 Xenopus (Silura... 66 6e-06 1
(DN073911) JGI_CABD8007.fwd NIH_XGC_tropLun1 Xenopus (Silura... 66 6e-06 1
(DN069612) JGI_CABD5472.fwd NIH_XGC_tropLun1 Xenopus (Silura... 66 6e-06 1
(DN033183) JGI_CAAR9750.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 66 6e-06 1
(DN033182) JGI_CAAR9750.rev NIH_XGC_tropLiv1 Xenopus (Silura... 66 6e-06 1
(DN027555) JGI_CAAR6328.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 66 6e-06 1
(CX998355) JGI_CAAQ1767.fwd NIH_XGC_tropHrt1 Xenopus (Silura... 66 6e-06 1
(CX998060) JGI_CAAQ1590.fwd NIH_XGC_tropHrt1 Xenopus (Silura... 66 6e-06 1
(CX998059) JGI_CAAQ1590.rev NIH_XGC_tropHrt1 Xenopus (Silura... 66 6e-06 1
(CX959598) JGI_CAAO10404.fwd NIH_XGC_tropTe5 Xenopus (Silura... 66 6e-06 1
(CX957697) JGI_CAAO9377.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 66 6e-06 1
(CX931892) JGI_CAAO2026.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 66 6e-06 1
(CX931891) JGI_CAAO2026.rev NIH_XGC_tropTe5 Xenopus (Siluran... 66 6e-06 1
(CX931054) JGI_CAAO1562.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 66 6e-06 1
(CX854984) JGI_CAAL10290.fwd NIH_XGC_tropBrn4 Xenopus (Silur... 66 6e-06 1
(CX748940) JGI_ANHP1523.fwd NIH_XGC_tropNeu5 Xenopus (Silura... 66 6e-06 1
(CX513861) JGI_XZG58200.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 6e-06 1
(CX453703) JGI_XZG54990.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 6e-06 1
(CX450172) JGI_XZG27235.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 6e-06 1
(CX447128) JGI_XZG22416.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 6e-06 1
(CX439992) JGI_XZG8095.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 66 6e-06 1
(CX437753) JGI_XZG6242.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 66 6e-06 1
(CX411071) JGI_XZT28110.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 6e-06 1
(CX408465) JGI_XZT63601.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 6e-06 1
(CX392758) JGI_XZT39886.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 6e-06 1
(CX369250) JGI_XZT54971.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 6e-06 1
(CR424018) Xenopus tropicalis EST, clone TTbA034e21 5'. 66 6e-06 1
(CR413577) Xenopus tropicalis EST, clone TTbA029n20 5'. 66 6e-06 1
(AL956940) Xenopus tropicalis EST, clone TGas125f08 5'. 66 6e-06 1
(AL871078) Xenopus tropicalis EST, clone TEgg132j15 5'. 66 6e-06 1
(AL869860) Xenopus tropicalis EST, clone TEgg112e14 5'. 66 6e-06 1
(AL846093) Xenopus tropicalis EST, clone TEgg073m01 5'. 66 6e-06 1
(AL796125) Xenopus tropicalis EST, clone TNeu106a04 5'. 66 6e-06 1
(AL779470) Xenopus tropicalis EST, clone TNeu072o22 5'. 66 6e-06 1
(AL774556) Xenopus tropicalis EST, clone TGas084e01 5'. 66 6e-06 1
(AL680519) Xenopus tropicalis EST, clone TGas061l14 5'. 66 6e-06 1
(CN089382) EC2BBA31CC03.g1 Xenopus tropicalis xtbs plasmid l... 66 6e-06 1
(CN082210) EC2BBA20DA06.g1 Xenopus tropicalis xtbs plasmid l... 66 6e-06 1
(CN074943) EC0CBA005DG02.g1 Xenopus tropicalis xtbs plasmid ... 66 6e-06 1
(CK654978) AGENCOURT_18026148 XtSt10-30 Xenopus (Silurana) t... 66 6e-06 1
(CF377164) AGENCOURT_15340110 NICHD_XGC_Swb1N Xenopus (Silur... 66 6e-06 1
(CF152815) AGENCOURT_14908426 NICHD_XGC_Emb8 Xenopus (Silura... 66 6e-06 1
(CA301617) taa05f09.y1 Hydra cDNA library Hydra magnipapilla... 66 6e-06 1
(BX763599) Xenopus tropicalis EST, clone TGas092l01 3'. 66 6e-06 1
(BX757772) Xenopus tropicalis EST, clone TGas125f08 3'. 66 6e-06 1
(BX748699) Xenopus tropicalis EST, clone TGas061l14 3'. 66 6e-06 1
(BX739890) Xenopus tropicalis EST, clone TTpA043f18 5'. 66 6e-06 1
(BX739502) Xenopus tropicalis EST, clone TTpA075h03 5'. 66 6e-06 1
(BX706998) Xenopus tropicalis EST, clone TTpA003k24 5'. 66 6e-06 1
(BX691164) Xenopus tropicalis EST, clone TNeu106a04 3'. 66 6e-06 1
(BX683616) Xenopus tropicalis EST, clone TNeu072o22 3'. 66 6e-06 1
(BQ390663) NISC_mq14d09.y1 NICHD_XGC_Emb5 Xenopus (Silurana)... 66 6e-06 1
(FF327937) 280433802 Pea aphid whole body normalized full le... 66 6e-06 1
(FF327354) 280431981 Pea aphid whole body normalized full le... 66 6e-06 1
(FF325163) 280424147 Pea aphid whole body normalized full le... 66 6e-06 1
(FF323199) 280418439 Pea aphid whole body normalized full le... 66 6e-06 1
(FF314354) 279392281 Pea aphid whole body normalized full le... 66 6e-06 1
(FF309155) 279374295 Pea aphid whole body normalized full le... 66 6e-06 1
(EX616868) 255397412 Pea aphid whole body normalized full le... 66 6e-06 1
(EX606180) 255355078 Pea aphid whole body normalized full le... 66 6e-06 1
(BW387361) Ciona intestinalis cDNA, clone:cidg844k12, 3'end,... 50 6e-06 2
(FK120321) XABT162021.g1 Gateway compatible cien cDNA librar... 54 6e-06 2
(BX562972) Glossina morsitans morsitans (Tseatse fly) EST fr... 50 1e-05 3
(AR318191) Sequence 741 from patent US 6562958. 44 1e-05 4
(FE359135) CBNN17923.rev CBNN_Daphnia_pulex_Chosen_One_Libra... 52 1e-05 4
(CV578853) kf04g07.y3 Globodera pallida Pa2 female Globodera... 48 1e-05 2
(FE383227) CBNT2216.fwd CBNT_Daphnia_pulex_Chosen_One_Librar... 60 1e-05 2
(FE419099) CBTW3649.fwd CBTW_Daphnia_pulex_Chosen_One_Librar... 60 1e-05 2
(DB609824) Halocynthia roretzi cDNA clone:mae19l14, 5' end. 56 2e-05 3
(DB776669) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB771930) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB768211) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB760721) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB757399) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB756723) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB755012) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(EX149150) ZRB475R ZRB Zoophthora radicans cDNA clone ZRB475... 64 2e-05 1
(CP000962) Clostridium botulinum A3 str. Loch Maree, complet... 64 2e-05 1
(EK427070) 1095516038951 Global-Ocean-Sampling_GS-31-01-01-1... 54 2e-05 2
(EK155944) 1095458005132 Global-Ocean-Sampling_GS-31-01-01-1... 40 3e-05 3
(FE419098) CBTW3649.rev CBTW_Daphnia_pulex_Chosen_One_Librar... 60 6e-05 2
(FE383226) CBNT2216.rev CBNT_Daphnia_pulex_Chosen_One_Librar... 60 6e-05 2
(CN584714) USDA-FP_127783 Acyrthosiphon pisum, Pea Aphid Acy... 48 6e-05 2
(FE347989) CBIB7534.rev CBIB_Daphnia_pulex_Chosen_One_Librar... 60 6e-05 2
(EK254461) 1095462003406 Global-Ocean-Sampling_GS-31-01-01-1... 62 9e-05 1
(EJ730930) 1092960128833 Global-Ocean-Sampling_GS-30-02-01-1... 62 9e-05 1
(DT693837) s13dFA53D10HS090_437288 Tall fescue, Festuca arun... 62 9e-05 1
(DT692195) s13dFA07C11HS086_358513 Tall fescue, Festuca arun... 62 9e-05 1
(DT690529) s13dFA03D07HS058_272575 Tall fescue, Festuca arun... 62 9e-05 1
(BX562973) Glossina morsitans morsitans (Tseatse fly) EST fr... 62 9e-05 1
(BX552300) Glossina morsitans morsitans (Tseatse fly) EST fr... 62 9e-05 1
(CP000727) Clostridium botulinum A str. Hall, complete genome. 62 9e-05 1
(CP000726) Clostridium botulinum A str. ATCC 19397, complete... 62 9e-05 1
(AM412317) Clostridium botulinum A str. ATCC 3502 complete g... 62 9e-05 1
(EJ407022) 1093012103942 Global-Ocean-Sampling_GS-28-01-01-1... 44 1e-04 3
(AJ623695) Mytilus galloprovincialis EST, clone GPPD01882. 42 1e-04 3
(FE376652) CBNS2164.fwd CBNS_Daphnia_pulex_Chosen_One_Librar... 52 1e-04 3
(CN950462) Ha_mx0_34g01_SP6 Lobster Multiple Tissues, Normal... 44 2e-04 2
(FE793822) CCAG9996.b3 CCAG Petrolisthes cinctipes heart, gi... 52 2e-04 2
(FE366437) CBNO4411.fwd CBNO_Daphnia_pulex_Chosen_One_Librar... 52 2e-04 3
(FE793823) CCAG9996.g1 CCAG Petrolisthes cinctipes heart, gi... 52 2e-04 2
(DT176623) JGI_ANNO45675.fwd ANNO Pimephales promelas Whole ... 52 2e-04 2
(FE357975) CBNN17087.fwd CBNN_Daphnia_pulex_Chosen_One_Libra... 52 3e-04 3
(CD519713) AGENCOURT_14144196 NICHD_XGC_Eye1 Xenopus laevis ... 56 3e-04 2
(EK071948) 1092961000196 Global-Ocean-Sampling_GS-31-01-01-1... 44 3e-04 3
(CJ362664) Molgula tectiformis cDNA, cleaving embryo clone:m... 38 3e-04 3
(ES414299) HTAB-aaa27f02.b2 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES413221) HTAB-aaa07d04.b4 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES412813) HTAB-aaa69f10.b2 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES412734) HTAB-aaa19h08.b2 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES412470) HTAB-aaa12g11.b2 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES410469) HTAB-aaa34h11.b2 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES410241) HTAB-aaa72e10.b2 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(DR865153) JGI_CABG8313.fwd NIH_XGC_tropSto1 Xenopus (Silura... 60 4e-04 1
(CO843996) LM_GM5_001586 Locusta migratoria gregarious phase... 60 4e-04 1
(CO823141) LM_GB5_003467 Locusta migratoria gregarious phase... 60 4e-04 1
(CO823140) LM_GB5_003466 Locusta migratoria gregarious phase... 60 4e-04 1
(CO823138) LM_GB5_003464 Locusta migratoria gregarious phase... 60 4e-04 1
(FK809702) HTAM-aaa47c06.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FK806821) HTAM-aaa34c05.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FK804940) HTAM-aaa20c04.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FK803893) HTAM-aaa29f05.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FK802315) HTAM-aaa50h09.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FG976474) HTAO-aaa58f06.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FF679669) HTAN-aaa06a10.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FF679166) HTAM-aaa03d04.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FF679136) HTAM-aaa03b08.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FF678998) HTAM-aaa01c08.g1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FF678225) HTAM-aaa03b08.b1 Heterorhabditis_bacteriophora_ES... 60 4e-04 1
(FE833995) CCAG44969.g1 CCAG Petrolisthes cinctipes heart, g... 60 4e-04 1
(EX915913) HTAB-aae50g08.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX915447) HTAB-aae04c07.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX913724) HTAB-aae80b10.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX911692) HTAB-aae75e10.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX911235) HTAB-aae62a11.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX910804) HTAB-aae05a01.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX910140) HTAB-aae14b10.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX910002) HTAB-aae08h03.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX014680) HTAB-aac96g10.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX013126) HTAB-aad68h03.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX009174) HTAB-aad30b03.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(EX007283) HTAB-aac82b09.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES744283) HTAB-aab26g09.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES743498) HTAB-aab01e03.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES742424) HTAB-aaa80a05.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES740113) HTAB-aab07c02.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
(ES739683) HTAB-aab09g01.b1 Heterorhabditis_bacteriophora_HT... 60 4e-04 1
>(AU060293) Dictyostelium discoideum slug cDNA, clone SLA886.
Length = 667
Score = 1322 bits (667), Expect = 0.0
Identities = 667/667 (100%)
Strand = Plus / Plus
Query: 1129 atcgtgatcaaggttaaatttaatataaaatgttaaaacaagttattaaaacagtatcaa 1188
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atcgtgatcaaggttaaatttaatataaaatgttaaaacaagttattaaaacagtatcaa 60
Query: 1189 gctcacaagcaccaaagaaatatttctttaaccagttttgtacatcaacaaattcaagtt 1248
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 gctcacaagcaccaaagaaatatttctttaaccagttttgtacatcaacaaattcaagtt 120
Query: 1249 ttcaatatattttagcagaaaagaaaggtcgtgttggtcttgttactttaaatagaccaa 1308
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ttcaatatattttagcagaaaagaaaggtcgtgttggtcttgttactttaaatagaccaa 180
Query: 1309 aatcattaaatgcactttctgatggtttaatttcagaaattaacagtgctgttaaactct 1368
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aatcattaaatgcactttctgatggtttaatttcagaaattaacagtgctgttaaactct 240
Query: 1369 tccaagaagataaagatgttggttcaatcattatcactggtagtgaaaaagcatttgctg 1428
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 tccaagaagataaagatgttggttcaatcattatcactggtagtgaaaaagcatttgctg 300
Query: 1429 ctggtgcagatattaaagaaatggaaaaagttacattaccagatgcttacaataatgatc 1488
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ctggtgcagatattaaagaaatggaaaaagttacattaccagatgcttacaataatgatc 360
Query: 1489 ttttagcacaatggcatgaccttaccaagattcgtaaaccaattattgcagctgtaaatg 1548
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 ttttagcacaatggcatgaccttaccaagattcgtaaaccaattattgcagctgtaaatg 420
Query: 1549 gttatgcattaggtggtggttgtgaattagcaatgatgtgcgatattattatcgctggtg 1608
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 gttatgcattaggtggtggttgtgaattagcaatgatgtgcgatattattatcgctggtg 480
Query: 1609 aaaaagcagtatttggtcaaccagagattaaattaggtactattccaggttgtggtggta 1668
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 aaaaagcagtatttggtcaaccagagattaaattaggtactattccaggttgtggtggta 540
Query: 1669 cacaacgtttaattagagcaattggtaaatcaaaagctatggaattagttttaacaggta 1728
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 cacaacgtttaattagagcaattggtaaatcaaaagctatggaattagttttaacaggta 600
Query: 1729 ataatttaactgcagttgaagctgaaaaagctggtttagttagtaaagttgttccagttg 1788
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 ataatttaactgcagttgaagctgaaaaagctggtttagttagtaaagttgttccagttg 660
Query: 1789 aagaact 1795
|||||||
Sbjct: 661 aagaact 667
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 2,380,929,092
Number of extensions: 156234700
Number of successful extensions: 16803133
Number of sequences better than 10.0: 1207
Length of query: 2166
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 2142
Effective length of database: 96,409,374,237
Effective search space: 206508879615654
Effective search space used: 206508879615654
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 7.20 |
| Homology vs Protein |
Query= Contig-U16069-1 (Contig-U16069-1Q) /CSM_Contig/Contig-U16069-1Q.Seq.d
(2166 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q1ZXF1) RecName: Full=Probable enoyl-CoA hydratase, mitochondri... 531 e-149
(P14604) RecName: Full=Enoyl-CoA hydratase, mitochondrial; ... 333 1e-89
AY892211_1(AY892211|pid:none) Synthetic construct Homo sapiens c... 333 2e-89
AY889749_1(AY889749|pid:none) Synthetic construct Homo sapiens c... 333 2e-89
AB170787_1(AB170787|pid:none) Macaca fascicularis brain cDNA clo... 332 3e-89
(Q5R646) RecName: Full=Enoyl-CoA hydratase, mitochondrial; ... 330 1e-88
(Q58DM8) RecName: Full=Enoyl-CoA hydratase, mitochondrial; ... 330 2e-88
AL831745_1(AL831745|pid:none) Zebrafish DNA sequence from clone ... 328 4e-88
BT043625_1(BT043625|pid:none) Salmo salar clone HM4_4021 enoyl C... 327 1e-87
D13900_1(D13900|pid:none) Homo sapiens mRNA for mitochondrial sh... 326 2e-87
GN123370_1(GN123370|pid:none) Sequence 6266 from Patent WO200903... 325 3e-87
BT078805_1(BT078805|pid:none) Esox lucius clone eluc-evq-506-324... 325 4e-87
DQ213433_1(DQ213433|pid:none) Taeniopygia guttata clone 0058P005... 320 1e-85
CP001488_2063(CP001488|pid:none) Brucella melitensis ATCC 23457 ... 320 2e-85
AE013599_1862(AE013599|pid:none) Drosophila melanogaster chromos... 319 2e-85
AC3495(AC3495) probable enoyl-CoA hydratase (EC 4.2.1.17) [impor... 319 3e-85
CP000708_1929(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 318 5e-85
CP000133_347(CP000133|pid:none) Rhizobium etli CFN 42, complete ... 318 7e-85
CP001074_385(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 318 7e-85
AY049961_1(AY049961|pid:none) Bos taurus enoyl-CoA hydratase pre... 315 3e-84
CP001191_4324(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 315 4e-84
CU633749_2697(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 313 2e-83
AM236080_377(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 311 5e-83
AE016958_1017(AE016958|pid:none) Mycobacterium avium subsp. para... 311 6e-83
CP000479_1138(CP000479|pid:none) Mycobacterium avium 104, comple... 311 6e-83
CP000628_451(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 310 2e-82
CP000655_1550(CP000655|pid:none) Polynucleobacter necessarius su... 308 7e-82
AL646052_2870(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 306 3e-81
BT080286_1(BT080286|pid:none) Caligus clemensi clone ccle-evs-50... 306 3e-81
GN119852_1(GN119852|pid:none) Sequence 2748 from Patent WO200903... 305 3e-81
CP001389_3632(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 305 6e-81
CP000390_4063(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 305 6e-81
CP001068_3070(CP001068|pid:none) Ralstonia pickettii 12J chromos... 304 8e-81
CP000614_505(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 304 8e-81
A97398(A97398) probable enoyl-CoA hydratase [imported] - Agrobac... 303 1e-80
CP000781_3278(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 303 2e-80
CP001281_840(CP001281|pid:none) Thauera sp. MZ1T, complete genome. 303 2e-80
CP000958_513(CP000958|pid:none) Burkholderia cenocepacia MC0-3 c... 303 2e-80
AB2616(AB2616) enoyl CoA hydratase [imported] - Agrobacterium tu... 302 4e-80
CP000094_2864(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 301 5e-80
(Q52995) RecName: Full=Probable enoyl-CoA hydratase; EC... 301 5e-80
CP000151_449(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 301 5e-80
BT078384_1(BT078384|pid:none) Lepeophtheirus salmonis Pacific fo... 301 6e-80
CP000529_3339(CP000529|pid:none) Polaromonas naphthalenivorans C... 300 1e-79
CP000378_2544(CP000378|pid:none) Burkholderia cenocepacia AU 105... 300 1e-79
BT076255_1(BT076255|pid:none) Caligus rogercresseyi clone crog-e... 300 2e-79
AM181176_2960(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 299 2e-79
CP000230_3790(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 299 2e-79
AP011115_4496(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 299 2e-79
BX571965_3068(BX571965|pid:none) Burkholderia pseudomallei strai... 298 4e-79
CP000011_524(CP000011|pid:none) Burkholderia mallei ATCC 23344 c... 298 4e-79
CU459003_1464(CU459003|pid:none) Magnetospirillum gryphiswaldens... 298 7e-79
GN119746_1(GN119746|pid:none) Sequence 2642 from Patent WO200903... 298 7e-79
CU458896_1170(CU458896|pid:none) Mycobacterium abscessus chromos... 298 7e-79
DQ311162_1(DQ311162|pid:none) Bombyx mori enoyl-CoA hydratase pr... 297 9e-79
AM270003_13(AM270003|pid:none) Aspergillus niger contig An02c008... 297 1e-78
CP001052_3422(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 296 2e-78
AM167904_3219(AM167904|pid:none) Bordetella avium 197N complete ... 296 2e-78
CP000270_3924(CP000270|pid:none) Burkholderia xenovorans LB400 c... 296 3e-78
CP000076_3018(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 295 4e-78
BT076325_1(BT076325|pid:none) Caligus rogercresseyi clone crog-e... 295 5e-78
CP000454_423(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 294 8e-78
CP000316_1107(CP000316|pid:none) Polaromonas sp. JS666, complete... 294 8e-78
CP000511_4605(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 293 1e-77
BA000040_3036(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 293 2e-77
CP000283_1903(CP000283|pid:none) Rhodopseudomonas palustris BisB... 293 2e-77
CP000656_2018(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 293 2e-77
(O07137) RecName: Full=Probable enoyl-CoA hydratase echA8; ... 291 9e-77
CP001341_628(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 291 9e-77
CU234118_2507(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 291 9e-77
CP001392_2878(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 290 1e-76
CP000539_3479(CP000539|pid:none) Acidovorax sp. JS42, complete g... 290 1e-76
AE016853_3094(AE016853|pid:none) Pseudomonas syringae pv. tomato... 290 1e-76
CP000267_1543(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 290 1e-76
CP000115_2238(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 290 1e-76
CP000555_597(CP000555|pid:none) Methylibium petroleiphilum PM1, ... 290 2e-76
CR555306_716(CR555306|pid:none) Azoarcus sp. EbN1 complete genom... 289 3e-76
CP001016_605(CP001016|pid:none) Beijerinckia indica subsp. indic... 289 3e-76
GN123578_1(GN123578|pid:none) Sequence 6474 from Patent WO200903... 289 3e-76
CP000926_1830(CP000926|pid:none) Pseudomonas putida GB-1, comple... 288 4e-76
AF290950_5(AF290950|pid:none) Pseudomonas putida FadDx (fadDx), ... 288 6e-76
AP011115_7208(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 287 1e-75
CP000494_2822(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 286 2e-75
CP000863_133(CP000863|pid:none) Acinetobacter baumannii ACICU, c... 286 3e-75
CP001157_1034(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 286 3e-75
CP000884_1526(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 285 4e-75
CP000521_106(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 285 5e-75
CP000319_2539(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 285 6e-75
CP000089_176(CP000089|pid:none) Dechloromonas aromatica RCB, com... 284 8e-75
CP000075_3029(CP000075|pid:none) Pseudomonas syringae pv. syring... 282 3e-74
CP000512_862(CP000512|pid:none) Acidovorax citrulli AAC00-1, com... 281 5e-74
CP000301_1718(CP000301|pid:none) Rhodopseudomonas palustris BisB... 281 5e-74
CP000542_453(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 281 5e-74
CU633900_891(CU633900|pid:none) Podospora anserina genomic DNA c... 278 6e-73
CP000943_4358(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 278 6e-73
CP001013_265(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 278 8e-73
CR931997_395(CR931997|pid:none) Corynebacterium jeikeium K411 co... 277 1e-72
CP000830_3354(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 275 5e-72
AP006840_212(AP006840|pid:none) Symbiobacterium thermophilum IAM... 275 6e-72
CP000697_1430(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 274 8e-72
CR382128_396(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 274 8e-72
CP001010_144(CP001010|pid:none) Polynucleobacter necessarius sub... 273 1e-71
CP000449_3061(CP000449|pid:none) Maricaulis maris MCS10, complet... 273 2e-71
CP000480_6562(CP000480|pid:none) Mycobacterium smegmatis str. MC... 272 4e-71
CP000661_2567(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 270 2e-70
AC091483_30(AC091483|pid:none) Trypanosoma brucei chromosome 3 c... 269 3e-70
AE017349_23(AE017349|pid:none) Cryptococcus neoformans var. neof... 268 6e-70
AL132876_5(AL132876|pid:none) Caenorhabditis elegans YAC Y105E8A... 265 7e-69
DQ311163_1(DQ311163|pid:none) Bombyx mori enoyl-CoA hydratase pr... 263 1e-68
CP000699_643(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 263 3e-68
BT074974_1(BT074974|pid:none) Osmerus mordax clone omor-eva-509-... 262 3e-68
GN119862_1(GN119862|pid:none) Sequence 2758 from Patent WO200903... 262 3e-68
AM942444_1591(AM942444|pid:none) Corynebacterium urealyticum DSM... 262 3e-68
CP000699_1791(CP000699|pid:none) Sphingomonas wittichii RW1, com... 262 4e-68
CP000781_900(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 261 6e-68
AM502247_266(AM502247|pid:none) Leishmania infantum chromosome 29. 260 2e-67
CP000490_73(CP000490|pid:none) Paracoccus denitrificans PD1222 c... 259 3e-67
CP000909_97(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl,... 259 4e-67
AM494966_228(AM494966|pid:none) Leishmania braziliensis chromoso... 258 6e-67
CP000157_2007(CP000157|pid:none) Erythrobacter litoralis HTCC259... 257 1e-66
CP001620_400(CP001620|pid:none) Corynebacterium kroppenstedtii D... 257 1e-66
CP000264_4211(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 257 1e-66
CP000667_766(CP000667|pid:none) Salinispora tropica CNB-440, com... 256 3e-66
CP001337_1130(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 256 3e-66
CP000356_3033(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 254 7e-66
CP000699_1762(CP000699|pid:none) Sphingomonas wittichii RW1, com... 248 5e-64
CP000463_612(CP000463|pid:none) Rhodopseudomonas palustris BisA5... 248 6e-64
CP001195_12(CP001195|pid:none) Rhizobium leguminosarum bv. trifo... 248 6e-64
CP000283_1542(CP000283|pid:none) Rhodopseudomonas palustris BisB... 247 1e-63
BX572595_19(BX572595|pid:none) Rhodopseudomonas palustris CGA009... 245 4e-63
AP008955_5002(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 244 1e-62
CP001399_2631(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 236 3e-60
CP001400_2505(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 235 4e-60
AM412317_3209(AM412317|pid:none) Clostridium botulinum A str. AT... 235 6e-60
GN119864_1(GN119864|pid:none) Sequence 2760 from Patent WO200903... 234 7e-60
CP001581_3408(CP001581|pid:none) Clostridium botulinum A2 str. K... 233 2e-59
BA000023_2585(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 233 2e-59
CP000682_384(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 232 4e-59
CP000926_2595(CP000926|pid:none) Pseudomonas putida GB-1, comple... 232 5e-59
AE008691_503(AE008691|pid:none) Thermoanaerobacter tengcongensis... 232 5e-59
CP000728_3184(CP000728|pid:none) Clostridium botulinum F str. La... 231 1e-58
AP009389_515(AP009389|pid:none) Pelotomaculum thermopropionicum ... 230 1e-58
AF029714_4(AF029714|pid:none) Pseudomonas putida transcriptional... 229 2e-58
AP009049_399(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 229 2e-58
CP000712_2433(CP000712|pid:none) Pseudomonas putida F1, complete... 229 3e-58
CP000077_2142(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 228 5e-58
AE015451_3257(AE015451|pid:none) Pseudomonas putida KT2440 compl... 228 7e-58
AJ000330_12(AJ000330|pid:none) Pseudomonas sp. Y2 DNA for styren... 226 3e-57
CP000612_1754(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 226 3e-57
CP000082_1171(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 224 8e-57
(P76082) RecName: Full=Probable enoyl-CoA hydratase paaF; ... 224 1e-56
A83675(A83675) enoyl-CoA hydratase chain I phaA [imported] - Bac... 224 1e-56
AP009240_1478(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 224 1e-56
CP000800_1504(CP000800|pid:none) Escherichia coli E24377A, compl... 223 2e-56
BA000012_798(BA000012|pid:none) Mesorhizobium loti MAFF303099 DN... 223 2e-56
CP000946_2210(CP000946|pid:none) Escherichia coli ATCC 8739, com... 222 4e-56
CP001022_390(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 222 4e-56
AB026669_5(AB026669|pid:none) Acinetobacter sp. NCIMB9871 cycloh... 222 5e-56
AP007171_458(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 221 1e-55
CT573326_2573(CT573326|pid:none) Pseudomonas entomophila str. L4... 221 1e-55
BA000043_2039(BA000043|pid:none) Geobacillus kaustophilus HTA426... 220 1e-55
DQ384293_1(DQ384293|pid:none) Malawimonas jakobiformis enoyl-CoA... 220 2e-55
CP000647_1445(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 218 5e-55
CP000612_397(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 218 9e-55
CP000141_1557(CP000141|pid:none) Carboxydothermus hydrogenoforma... 218 9e-55
CP000804_3078(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 218 9e-55
CP000682_1964(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 217 1e-54
BA000016_2301(BA000016|pid:none) Clostridium perfringens str. 13... 216 3e-54
AM998794_2(AM998794|pid:none) Clostridium saccharobutylicum ORF1... 215 5e-54
CP000964_2936(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 215 6e-54
CR543861_1548(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 214 8e-54
(P52046) RecName: Full=3-hydroxybutyryl-CoA dehydratase; ... 214 1e-53
FM209186_3697(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 214 1e-53
CP000826_3068(CP000826|pid:none) Serratia proteamaculans 568, co... 214 1e-53
AY714845_24(AY714845|pid:none) Uncultured archaeon GZfos27B6 clo... 214 1e-53
CP001322_2623(CP001322|pid:none) Desulfatibacillum alkenivorans ... 214 1e-53
CP001034_1850(CP001034|pid:none) Natranaerobius thermophilus JW/... 212 4e-53
CP000744_3602(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 210 1e-52
CP001078_329(CP001078|pid:none) Clostridium botulinum E3 str. Al... 210 1e-52
CP000930_1047(CP000930|pid:none) Heliobacterium modesticaldum Ic... 209 3e-52
CP000863_1394(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 209 3e-52
CP000448_752(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 209 3e-52
CP000721_2012(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 209 3e-52
CP000438_1418(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 209 4e-52
AM180355_1084(AM180355|pid:none) Clostridium difficile 630 compl... 209 4e-52
CP001276_99(CP001276|pid:none) Thermomicrobium roseum DSM 5159 p... 209 4e-52
CP001172_2093(CP001172|pid:none) Acinetobacter baumannii AB307-0... 208 6e-52
GN119848_1(GN119848|pid:none) Sequence 2744 from Patent WO200903... 208 6e-52
AE000782_428(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 208 6e-52
AP008932_70(AP008932|pid:none) Rhodococcus erythropolis PR4 plas... 208 7e-52
CP001390_239(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 207 1e-51
CP000686_2238(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 207 1e-51
CP000246_79(CP000246|pid:none) Clostridium perfringens ATCC 1312... 207 1e-51
BA000016_95(BA000016|pid:none) Clostridium perfringens str. 13 D... 207 1e-51
DQ384311_1(DQ384311|pid:none) Isochrysis galbana enoyl-CoA hydra... 207 1e-51
CP000615_1234(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 207 2e-51
AE014292_214(AE014292|pid:none) Brucella suis 1330 chromosome II... 207 2e-51
AE015924_935(AE015924|pid:none) Porphyromonas gingivalis W83, co... 206 2e-51
BX842651_35(BX842651|pid:none) Bdellovibrio bacteriovorus comple... 206 3e-51
AP009380_1175(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 205 5e-51
CP000873_1041(CP000873|pid:none) Brucella canis ATCC 23365 chrom... 205 5e-51
CR555306_1026(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 205 6e-51
CP001489_203(CP001489|pid:none) Brucella melitensis ATCC 23457 c... 204 8e-51
CP000148_1697(CP000148|pid:none) Geobacter metallireducens GS-15... 204 1e-50
DQ534433_1(DQ534433|pid:none) Pseudomonas fluorescens strain ST ... 204 1e-50
CP000148_2050(CP000148|pid:none) Geobacter metallireducens GS-15... 203 2e-50
AP009153_816(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 202 3e-50
CP001107_968(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 202 5e-50
AY232242_1(AY232242|pid:none) Drosophila yakuba clone yak-ad_CG6... 201 7e-50
CP000113_3695(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 201 7e-50
CP001096_4251(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 201 9e-50
CP001472_2221(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 201 9e-50
CP000698_2995(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 201 1e-49
CP001322_3326(CP001322|pid:none) Desulfatibacillum alkenivorans ... 200 2e-49
CP000448_1429(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 200 2e-49
CP000851_2127(CP000851|pid:none) Shewanella pealeana ATCC 700345... 200 2e-49
CP000769_2118(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 199 3e-49
CP000875_1198(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 199 3e-49
CP001078_1733(CP001078|pid:none) Clostridium botulinum E3 str. A... 199 5e-49
AP008226_1434(AP008226|pid:none) Thermus thermophilus HB8 genomi... 198 8e-49
GN119742_1(GN119742|pid:none) Sequence 2638 from Patent WO200903... 197 1e-48
DQ987697_3(DQ987697|pid:none) Butyrate-producing bacterium L2-50... 197 2e-48
CP000088_588(CP000088|pid:none) Thermobifida fusca YX, complete ... 196 2e-48
CP000927_1895(CP000927|pid:none) Caulobacter sp. K31, complete g... 196 2e-48
D72628(D72628)probable 3-hydroxybutyryl-CoA dehydratase APE1484 ... 196 2e-48
BA000002_978(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 196 2e-48
CP000148_1554(CP000148|pid:none) Geobacter metallireducens GS-15... 196 4e-48
CP000251_1661(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 196 4e-48
CP001275_39(CP001275|pid:none) Thermomicrobium roseum DSM 5159, ... 195 7e-48
CP000252_1915(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 193 2e-47
CP001359_2257(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 193 2e-47
CP001131_2175(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 192 3e-47
AP008230_1709(AP008230|pid:none) Desulfitobacterium hafniense Y5... 191 7e-47
CU459003_618(CU459003|pid:none) Magnetospirillum gryphiswaldense... 191 9e-47
CP000473_6134(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 191 9e-47
CP001357_111(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 191 9e-47
CP000675_958(CP000675|pid:none) Legionella pneumophila str. Corb... 191 1e-46
AE017354_849(AE017354|pid:none) Legionella pneumophila subsp. pn... 191 1e-46
CP000820_1058(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 190 2e-46
CP001390_3109(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 190 2e-46
CR628337_905(CR628337|pid:none) Legionella pneumophila str. Lens... 189 3e-46
CP000509_4242(CP000509|pid:none) Nocardioides sp. JS614, complet... 189 3e-46
CP000888_194(CP000888|pid:none) Brucella abortus S19 chromosome ... 189 3e-46
GN119740_1(GN119740|pid:none) Sequence 2636 from Patent WO200903... 189 5e-46
CP000077_1031(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 188 6e-46
CP000359_1582(CP000359|pid:none) Deinococcus geothermalis DSM 11... 188 8e-46
CR954246_849(CR954246|pid:none) Pseudoalteromonas haloplanktis s... 187 1e-45
CP000685_932(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 187 1e-45
CP000852_329(CP000852|pid:none) Caldivirga maquilingensis IC-167... 187 1e-45
CP000542_1775(CP000542|pid:none) Verminephrobacter eiseniae EF01... 187 1e-45
CP000485_3001(CP000485|pid:none) Bacillus thuringiensis str. Al ... 187 1e-45
CP000667_1191(CP000667|pid:none) Salinispora tropica CNB-440, co... 187 2e-45
CP000001_3204(CP000001|pid:none) Bacillus cereus E33L, complete ... 186 2e-45
AB190764_2(AB190764|pid:none) Butyrivibrio fibrisolvens thl, crt... 186 2e-45
BA000035_2772(BA000035|pid:none) Corynebacterium efficiens YS-31... 186 3e-45
A75432(A75432) 3-hydroxybutyryl-CoA dehydratase - Deinococcus ra... 185 5e-45
AM420293_6025(AM420293|pid:none) Saccharopolyspora erythraea NRR... 185 7e-45
CP001638_2379(CP001638|pid:none) Geobacillus sp. WCH70, complete... 185 7e-45
CP000148_2189(CP000148|pid:none) Geobacter metallireducens GS-15... 185 7e-45
AP009493_2087(AP009493|pid:none) Streptomyces griseus subsp. gri... 184 9e-45
CP001638_1635(CP001638|pid:none) Geobacillus sp. WCH70, complete... 184 9e-45
CP000866_1304(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 184 9e-45
CP000521_1444(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 184 1e-44
AE006641_2295(AE006641|pid:none) Sulfolobus solfataricus P2, com... 184 1e-44
GN123320_1(GN123320|pid:none) Sequence 6216 from Patent WO200903... 184 1e-44
CP001172_2155(CP001172|pid:none) Acinetobacter baumannii AB307-0... 184 1e-44
CP000386_2315(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 184 1e-44
CP000922_563(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 184 1e-44
BA000023_85(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, c... 184 1e-44
CP001114_777(CP001114|pid:none) Deinococcus deserti VCD115, comp... 183 3e-44
AL939123_237(AL939123|pid:none) Streptomyces coelicolor A3(2) co... 183 3e-44
CU459141_2228(CU459141|pid:none) Acinetobacter baumannii str. AY... 182 3e-44
AE009951_1596(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 182 3e-44
CP000348_805(CP000348|pid:none) Leptospira borgpetersenii serova... 182 4e-44
CP000557_1434(CP000557|pid:none) Geobacillus thermodenitrificans... 182 6e-44
CP001087_988(CP001087|pid:none) Desulfobacterium autotrophicum H... 182 6e-44
AP008955_3856(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 182 6e-44
CP001407_2876(CP001407|pid:none) Bacillus cereus 03BB102, comple... 181 7e-44
AE017355_2672(AE017355|pid:none) Bacillus thuringiensis serovar ... 181 7e-44
BA000043_2688(BA000043|pid:none) Geobacillus kaustophilus HTA426... 181 1e-43
CP001403_304(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,... 181 1e-43
CP000316_641(CP000316|pid:none) Polaromonas sp. JS666, complete ... 180 2e-43
GN123518_1(GN123518|pid:none) Sequence 6414 from Patent WO200903... 180 2e-43
CP001399_329(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 180 2e-43
AE017333_2036(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 180 2e-43
GN123546_1(GN123546|pid:none) Sequence 6442 from Patent WO200903... 180 2e-43
CP001283_2952(CP001283|pid:none) Bacillus cereus AH820, complete... 180 2e-43
EU016653_26(EU016653|pid:none) Uncultured Group I marine crenarc... 180 2e-43
CP000485_2515(CP000485|pid:none) Bacillus thuringiensis str. Al ... 179 3e-43
AM180088_1461(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 179 3e-43
AF218939_8(AF218939|pid:none) Bacillus subtilis FenH (fenH), Fen... 179 4e-43
(O34893) RecName: Full=Putative enoyl-CoA hydratase/isomerase yn... 179 5e-43
AE008922_1510(AE008922|pid:none) Xanthomonas campestris pv. camp... 178 6e-43
AM920689_2759(AM920689|pid:none) Xanthomonas campestris pv. camp... 178 6e-43
AE016823_2423(AE016823|pid:none) Leptospira interrogans serovar ... 178 8e-43
AE010300_1197(AE010300|pid:none) Leptospira interrogans serovar ... 177 1e-42
CU914168_2633(CU914168|pid:none) Ralstonia solanacearum strain I... 177 1e-42
CP000764_1729(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 177 1e-42
AK340212_1(AK340212|pid:none) Acyrthosiphon pisum ACYPI001292 mR... 177 1e-42
CR936257_1310(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 177 1e-42
CU207366_3167(CU207366|pid:none) Gramella forsetii KT0803 comple... 177 2e-42
CP000478_3550(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 176 2e-42
CP001390_166(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 176 2e-42
AE016879_2347(AE016879|pid:none) Bacillus anthracis str. Ames, c... 176 2e-42
AM260479_1691(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 176 4e-42
AM398681_49(AM398681|pid:none) Flavobacterium psychrophilum JIP0... 176 4e-42
CP001124_1402(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 176 4e-42
CP000699_752(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 176 4e-42
CP000777_878(CP000777|pid:none) Leptospira biflexa serovar Patoc... 175 5e-42
AE017194_2532(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 175 7e-42
BA000043_1602(BA000043|pid:none) Geobacillus kaustophilus HTA426... 175 7e-42
CP000001_2260(CP000001|pid:none) Bacillus cereus E33L, complete ... 174 9e-42
AE016877_2337(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 174 9e-42
CP001390_158(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 174 9e-42
AE004437_332(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 174 1e-41
AE008923_1560(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 174 2e-41
AP009152_510(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 174 2e-41
CP000682_399(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 173 2e-41
CP001131_2197(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 173 2e-41
EU686636_5(EU686636|pid:none) Uncultured marine group III euryar... 172 3e-41
CP000251_1640(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 172 3e-41
CP000968_114(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 172 3e-41
CP000390_2918(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 172 3e-41
CP001635_4255(CP001635|pid:none) Variovorax paradoxus S110 chrom... 172 5e-41
A69534(A69534) 3-hydroxyacyl-CoA dehydrogenase (hbd-10) homolog ... 172 5e-41
CP000227_2328(CP000227|pid:none) Bacillus cereus Q1, complete ge... 171 1e-40
AE000782_282(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 170 2e-40
CP000813_1753(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 170 2e-40
CP000386_367(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 170 2e-40
AE013598_2406(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 170 2e-40
CP001176_2371(CP001176|pid:none) Bacillus cereus B4264, complete... 169 3e-40
CP000903_2305(CP000903|pid:none) Bacillus weihenstephanensis KBA... 169 3e-40
CP001404_1245(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 169 4e-40
AP008229_2323(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 169 4e-40
AP006627_1501(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 169 4e-40
AJ576102_36(AJ576102|pid:none) Bacillus amyloliquefaciens partia... 169 4e-40
CP000817_2850(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 169 5e-40
AP008955_5001(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 168 7e-40
AL939121_277(AL939121|pid:none) Streptomyces coelicolor A3(2) co... 168 7e-40
CP001022_394(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 168 9e-40
BA000004_1135(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 168 9e-40
BA000004_207(BA000004|pid:none) Bacillus halodurans C-125 DNA, c... 168 9e-40
CP000542_4179(CP000542|pid:none) Verminephrobacter eiseniae EF01... 167 1e-39
CP000148_2184(CP000148|pid:none) Geobacter metallireducens GS-15... 167 1e-39
BA000012_6405(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 167 1e-39
CP000816_1052(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, c... 167 1e-39
CP000352_2594(CP000352|pid:none) Ralstonia metallidurans CH34, c... 167 1e-39
CP001399_1441(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 167 1e-39
AP008230_2489(AP008230|pid:none) Desulfitobacterium hafniense Y5... 167 1e-39
CP000301_849(CP000301|pid:none) Rhodopseudomonas palustris BisB1... 167 2e-39
AY596298_196(AY596298|pid:none) Haloarcula marismortui ATCC 4304... 167 2e-39
CP001336_3596(CP001336|pid:none) Desulfitobacterium hafniense DC... 167 2e-39
CP001400_1341(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 167 2e-39
CP000157_2143(CP000157|pid:none) Erythrobacter litoralis HTCC259... 166 2e-39
CP001336_4468(CP001336|pid:none) Desulfitobacterium hafniense DC... 166 3e-39
CP000777_3057(CP000777|pid:none) Leptospira biflexa serovar Pato... 166 4e-39
CP000113_3653(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 165 6e-39
CP000272_806(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 165 6e-39
BA000030_3333(BA000030|pid:none) Streptomyces avermitilis MA-468... 165 6e-39
CP000542_3517(CP000542|pid:none) Verminephrobacter eiseniae EF01... 165 6e-39
CP000270_1661(CP000270|pid:none) Burkholderia xenovorans LB400 c... 165 7e-39
AB011837_2(AB011837|pid:none) Bacillus halodurans C-125 genomic ... 165 7e-39
AP008230_3374(AP008230|pid:none) Desulfitobacterium hafniense Y5... 164 9e-39
BA000035_322(BA000035|pid:none) Corynebacterium efficiens YS-314... 164 9e-39
AP011117_136(AP011117|pid:none) Rhodococcus opacus B4 plasmid pR... 164 1e-38
AM260479_860(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 164 1e-38
AE005673_2557(AE005673|pid:none) Caulobacter crescentus CB15, co... 164 1e-38
BA000028_2120(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 164 1e-38
AP009493_2613(AP009493|pid:none) Streptomyces griseus subsp. gri... 164 2e-38
CP000817_870(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 164 2e-38
CP000158_1792(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 164 2e-38
CP000157_196(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 163 2e-38
A69252(A69252) 3-hydroxyacyl-CoA dehydrogenase (hbd-1) homolog -... 163 2e-38
AM746676_8646(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 163 2e-38
CP001401_807(CP001401|pid:none) Sulfolobus islandicus M.16.27, c... 163 3e-38
CP000927_3673(CP000927|pid:none) Caulobacter sp. K31, complete g... 163 3e-38
BA000004_3101(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 163 3e-38
CR936257_1708(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 162 4e-38
CP000091_1089(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 162 4e-38
AP008957_2364(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 162 5e-38
CP001322_1726(CP001322|pid:none) Desulfatibacillum alkenivorans ... 162 5e-38
AP008955_5004(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 162 5e-38
AP006627_2663(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 162 6e-38
CP001176_4464(CP001176|pid:none) Bacillus cereus B4264, complete... 162 6e-38
BX640451_129(BX640451|pid:none) Bordetella bronchiseptica strain... 161 8e-38
AL591688_2290(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 161 8e-38
CP000356_1794(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 161 1e-37
AE017333_2001(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 161 1e-37
AE017194_4616(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 161 1e-37
CP001407_4441(CP001407|pid:none) Bacillus cereus 03BB102, comple... 161 1e-37
CP000485_3898(CP000485|pid:none) Bacillus thuringiensis str. Al ... 161 1e-37
CP000272_262(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 160 2e-37
AB471639_26(AB471639|pid:none) Desulfotignum balticum genomic DN... 160 2e-37
CP000510_634(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 159 3e-37
AP008957_784(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 159 3e-37
BX640431_146(BX640431|pid:none) Bordetella parapertussis strain ... 159 3e-37
CP000480_5021(CP000480|pid:none) Mycobacterium smegmatis str. MC... 159 3e-37
CP000383_17(CP000383|pid:none) Cytophaga hutchinsonii ATCC 33406... 159 4e-37
CP000447_1331(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 159 4e-37
AM992894_4(AM992894|pid:none) Streptomyces violaceoruber kendomy... 159 5e-37
CP000542_223(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 159 5e-37
BA000030_721(BA000030|pid:none) Streptomyces avermitilis MA-4680... 159 5e-37
CU458896_827(CU458896|pid:none) Mycobacterium abscessus chromoso... 158 7e-37
AP007171_490(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 158 7e-37
GN119918_1(GN119918|pid:none) Sequence 2814 from Patent WO200903... 158 9e-37
CP001102_306(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 157 1e-36
CP000903_4242(CP000903|pid:none) Bacillus weihenstephanensis KBA... 157 2e-36
CP000092_203(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 157 2e-36
BX640451_181(BX640451|pid:none) Bordetella bronchiseptica strain... 157 2e-36
CP000431_3911(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 157 2e-36
AY596297_959(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 157 2e-36
CP001390_2398(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 157 2e-36
CP000301_1656(CP000301|pid:none) Rhodopseudomonas palustris BisB... 157 2e-36
CP000249_2427(CP000249|pid:none) Frankia sp. CcI3, complete geno... 157 2e-36
CT573213_3032(CT573213|pid:none) Frankia alni str. ACN14A chromo... 156 3e-36
(Q8Z9L5) RecName: Full=Carnitinyl-CoA dehydratase; EC=4... 156 3e-36
AF173961_9(AF173961|pid:none) Thauera aromatica bbs operon, comp... 156 3e-36
CP000148_2201(CP000148|pid:none) Geobacter metallireducens GS-15... 156 3e-36
CP000077_2074(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 156 3e-36
CP001322_804(CP001322|pid:none) Desulfatibacillum alkenivorans A... 156 3e-36
CP000929_19(CP000929|pid:none) Caulobacter sp. K31 plasmid pCAUL... 155 4e-36
(P94549) RecName: Full=Probable enoyl-CoA hydratase; EC... 155 4e-36
CP001113_71(CP001113|pid:none) Salmonella enterica subsp. enteri... 155 4e-36
BX640424_331(BX640424|pid:none) Bordetella parapertussis strain ... 155 4e-36
(Q57TJ1) RecName: Full=Carnitinyl-CoA dehydratase; EC=4... 155 4e-36
CP000386_2018(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 155 6e-36
(Q8ZRX5) RecName: Full=Carnitinyl-CoA dehydratase; EC=4... 155 6e-36
CP000386_1727(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 155 6e-36
(A9MYJ5) RecName: Full=Carnitinyl-CoA dehydratase; EC=4... 155 6e-36
CP001172_2154(CP001172|pid:none) Acinetobacter baumannii AB307-0... 155 7e-36
CP000656_2099(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 155 7e-36
AL939105_59(AL939105|pid:none) Streptomyces coelicolor A3(2) com... 155 7e-36
CP000148_1508(CP000148|pid:none) Geobacter metallireducens GS-15... 154 1e-35
CP000774_1563(CP000774|pid:none) Parvibaculum lavamentivorans DS... 154 1e-35
AM902716_1243(AM902716|pid:none) Bordetella petrii strain DSM 12... 154 1e-35
GN123520_1(GN123520|pid:none) Sequence 6416 from Patent WO200903... 154 1e-35
BX842653_156(BX842653|pid:none) Bdellovibrio bacteriovorus compl... 154 1e-35
CP000088_1278(CP000088|pid:none) Thermobifida fusca YX, complete... 154 1e-35
CP001600_2848(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 154 1e-35
AE016825_2083(AE016825|pid:none) Chromobacterium violaceum ATCC ... 154 1e-35
CP001096_4745(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 154 1e-35
AE016958_3658(AE016958|pid:none) Mycobacterium avium subsp. para... 154 1e-35
CP000077_1648(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 154 2e-35
BX572607_4(BX572607|pid:none) Rhodopseudomonas palustris CGA009 ... 154 2e-35
BA000011_17(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA, ... 154 2e-35
CP000820_94(CP000820|pid:none) Frankia sp. EAN1pec, complete gen... 153 2e-35
(Q13825) RecName: Full=Methylglutaconyl-CoA hydratase, mitochond... 153 2e-35
CP000931_224(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 153 2e-35
AE005673_1711(AE005673|pid:none) Caulobacter crescentus CB15, co... 153 2e-35
CP000472_4703(CP000472|pid:none) Shewanella piezotolerans WP3, c... 153 3e-35
GN123196_1(GN123196|pid:none) Sequence 6092 from Patent WO200903... 153 3e-35
GN123504_1(GN123504|pid:none) Sequence 6400 from Patent WO200903... 153 3e-35
GN123526_1(GN123526|pid:none) Sequence 6422 from Patent WO200903... 152 4e-35
CP000854_4252(CP000854|pid:none) Mycobacterium marinum M, comple... 152 4e-35
CP000863_1342(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 152 4e-35
CP000463_4092(CP000463|pid:none) Rhodopseudomonas palustris BisA... 152 4e-35
(A9MR28) RecName: Full=Carnitinyl-CoA dehydratase; EC=4... 152 5e-35
GN123604_1(GN123604|pid:none) Sequence 6500 from Patent WO200903... 152 5e-35
BA000038_1040(BA000038|pid:none) Vibrio vulnificus YJ016 DNA, ch... 152 5e-35
AM920437_2081(AM920437|pid:none) Penicillium chrysogenum Wiscons... 152 5e-35
AE016825_1553(AE016825|pid:none) Chromobacterium violaceum ATCC ... 152 6e-35
BA000043_2038(BA000043|pid:none) Geobacillus kaustophilus HTA426... 152 6e-35
GN123322_1(GN123322|pid:none) Sequence 6218 from Patent WO200903... 152 6e-35
AE017261_1021(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 152 6e-35
CP000521_1445(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 152 6e-35
AP006520_16(AP006520|pid:none) Geobacillus kaustophilus HTA426 p... 151 8e-35
AP006618_2955(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 151 8e-35
CP000514_2102(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 151 8e-35
CP000272_310(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 151 8e-35
AM260479_1838(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 151 1e-34
(A8ALR7) RecName: Full=Carnitinyl-CoA dehydratase; EC=4... 151 1e-34
CP000560_2470(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 151 1e-34
AE005673_1802(AE005673|pid:none) Caulobacter crescentus CB15, co... 151 1e-34
DQ093285_1(DQ093285|pid:none) Rhodococcus aetherivorans putative... 151 1e-34
BC026525_1(BC026525|pid:none) Mus musculus AU RNA binding protei... 150 1e-34
AE006641_1188(AE006641|pid:none) Sulfolobus solfataricus P2, com... 150 1e-34
CP000458_177(CP000458|pid:none) Burkholderia cenocepacia HI2424 ... 150 1e-34
BC049597_1(BC049597|pid:none) Mus musculus AU RNA binding protei... 150 1e-34
EU874252_40(EU874252|pid:none) Uncultured soil bacterium clone B... 150 1e-34
CP000511_4512(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 150 1e-34
AF494369_1(AF494369|pid:none) Arabidopsis lyrata subsp. petraea ... 150 1e-34
(Q9JLZ3) RecName: Full=Methylglutaconyl-CoA hydratase, mitochond... 150 1e-34
BA000040_2946(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 150 2e-34
CP000316_3611(CP000316|pid:none) Polaromonas sp. JS666, complete... 150 2e-34
CP000446_2583(CP000446|pid:none) Shewanella sp. MR-4, complete g... 150 2e-34
CP000774_1789(CP000774|pid:none) Parvibaculum lavamentivorans DS... 150 2e-34
X73904_5(X73904|pid:none) E.coli DNA sequence of cai locus. 150 2e-34
CP000480_3883(CP000480|pid:none) Mycobacterium smegmatis str. MC... 150 2e-34
AL161544_39(AL161544|pid:none) Arabidopsis thaliana DNA chromoso... 150 2e-34
BA000043_2779(BA000043|pid:none) Geobacillus kaustophilus HTA426... 150 2e-34
CP000851_2771(CP000851|pid:none) Shewanella pealeana ATCC 700345... 150 2e-34
BA000040_4965(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 150 2e-34
AP007174_143(AP007174|pid:none) Aspergillus oryzae RIB40 genomic... 150 2e-34
CP000302_1926(CP000302|pid:none) Shewanella denitrificans OS217,... 149 3e-34
CP000304_606(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 149 3e-34
CP000148_2172(CP000148|pid:none) Geobacter metallireducens GS-15... 149 3e-34
EU974260_1(EU974260|pid:none) Zea mays clone 444239 methylglutac... 149 3e-34
BC044574_1(BC044574|pid:none) Homo sapiens enoyl Coenzyme A hydr... 149 3e-34
AF063588_1(AF063588|pid:none) Rhodococcus fascians strain NRRL-B... 149 3e-34
CP000511_1958(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 149 3e-34
>(Q1ZXF1) RecName: Full=Probable enoyl-CoA hydratase, mitochondrial;
EC=4.2.1.17; AltName: Full=Short chain enoyl-CoA
hydratase; Short=SCEH; AltName: Full=Enoyl-CoA
hydratase 1; Flags: Precursor;
Length = 277
Score = 531 bits (1369), Expect = e-149
Identities = 275/285 (96%), Positives = 275/285 (96%)
Frame = +3
Query: 1158 MLKQVIKTVSSSQAPKKYFFNQFCTSTNSSFQYILAEKKGRVGLVTLNRPKSLNALSDGL 1337
MLKQVIKTVSSSQAPKKYFF QFCTST EKKGRVGLVTLNRPKSLNALSDGL
Sbjct: 1 MLKQVIKTVSSSQAPKKYFFKQFCTSTT--------EKKGRVGLVTLNRPKSLNALSDGL 52
Query: 1338 ISEINSAVKLFQEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHDLTK 1517
ISEINSAVKLFQEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHDLTK
Sbjct: 53 ISEINSAVKLFQEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHDLTK 112
Query: 1518 IRKPIIAAVNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGK 1697
IRKPIIAAVNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGK
Sbjct: 113 IRKPIIAAVNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGCGGTQRLIRAIGK 172
Query: 1698 SKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVN 1877
SKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVN
Sbjct: 173 SKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKEAVN 232
Query: 1878 ASYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTWHNK 2012
ASYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTWHNK
Sbjct: 233 ASYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTWHNK 277
Score = 68.2 bits (165), Expect = 1e-09
Identities = 33/33 (100%), Positives = 33/33 (100%)
Frame = +2
Query: 755 VAMAKEAVNASYELTLQEGIRFERRMFHSTFGT 853
VAMAKEAVNASYELTLQEGIRFERRMFHSTFGT
Sbjct: 224 VAMAKEAVNASYELTLQEGIRFERRMFHSTFGT 256
Score = 51.6 bits (122), Expect = 1e-04
Identities = 21/21 (100%), Positives = 21/21 (100%)
Frame = +1
Query: 982 HDQKEGMNAFVEKRTPTWHNK 1044
HDQKEGMNAFVEKRTPTWHNK
Sbjct: 257 HDQKEGMNAFVEKRTPTWHNK 277
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,842,606,472
Number of extensions: 53859049
Number of successful extensions: 152391
Number of sequences better than 10.0: 4885
Number of HSP's gapped: 147044
Number of HSP's successfully gapped: 6042
Length of query: 722
Length of database: 1,051,180,864
Length adjustment: 136
Effective length of query: 586
Effective length of database: 611,008,840
Effective search space: 358051180240
Effective search space used: 358051180240
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
2 |
| VH (FL, L) |
0 |
| VF (FL, S) |
1 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
2 |
| SS (DIR, S) |
3 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |