| Homology vs CSM-cDNA |
 |
| Homology vs DNA |
Query= Contig-U16058-1 (Contig-U16058-1Q) /CSM_Contig/Contig-U16058-1Q.Seq.d
(1978 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ369444) Dictyostelium discoideum cDNA clone:ddc50h18, 5' ... 1148 0.0 1
(BJ361670) Dictyostelium discoideum cDNA clone:ddc18a09, 5' ... 1108 0.0 1
(BJ375306) Dictyostelium discoideum cDNA clone:ddc18a09, 3' ... 789 0.0 2
(BJ401878) Dictyostelium discoideum cDNA clone:dds19o14, 3' ... 737 0.0 2
(BJ398445) Dictyostelium discoideum cDNA clone:dds12p12, 3' ... 664 0.0 2
(BJ399798) Dictyostelium discoideum cDNA clone:dds7d14, 3' e... 634 0.0 2
(BJ373967) Dictyostelium discoideum cDNA clone:ddc5k18, 3' e... 626 0.0 4
(C90744) Dictyostelium discoideum slug cDNA, clone SSJ896. 789 0.0 2
(C84843) Dictyostelium discoideum slug cDNA, clone SSG762. 789 0.0 2
(AU061353) Dictyostelium discoideum slug cDNA, clone SLD815. 601 e-167 1
(AU074238) Dictyostelium discoideum slug cDNA, clone SSJ896. 315 e-118 2
(BJ399795) Dictyostelium discoideum cDNA clone:dds7c14, 3' e... 369 3e-97 1
(EJ206090) 1092344349713 Global-Ocean-Sampling_GS-27-01-01-1... 58 0.001 1
(EK358970) 1095468871816 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.005 2
(EJ577014) 1092960116260 Global-Ocean-Sampling_GS-29-01-01-1... 52 0.011 2
(CA367257) 643033 NCCCWA 1RT Oncorhynchus mykiss cDNA clone ... 38 0.039 2
(CA364069) 638905 NCCCWA 1RT Oncorhynchus mykiss cDNA clone ... 38 0.039 2
(ER436428) 1092963797926 Global-Ocean-Sampling_GS-35-01-01-1... 52 0.082 1
(EJ540852) 1092955372369 Global-Ocean-Sampling_GS-29-01-01-1... 52 0.082 1
(CU062496) M.truncatula DNA sequence from clone MTH2-80K13 o... 40 0.094 10
(AZ364350) 1M0110K05R Mouse 10kb plasmid UUGC1M library Mus ... 38 0.11 2
(AZ470139) 1M0284M04F Mouse 10kb plasmid UUGC1M library Mus ... 38 0.11 2
(DB917768) Idiosepius paradoxus cDNA, clone:Ip_aB_030_F13, 5... 38 0.14 2
(ET855987) CHO_OF361xb09f1.ab1 CHO_OF Nicotiana tabacum geno... 38 0.32 3
(EJ610898) 1092962043359 Global-Ocean-Sampling_GS-29-01-01-1... 50 0.32 1
(CP001147) Thermodesulfovibrio yellowstonii DSM 11347, compl... 50 0.32 1
(FP017212) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 44 0.75 3
(AC129748) Rattus norvegicus clone CH230-140G10, *** SEQUENC... 48 1.3 1
(AC120252) Rattus norvegicus clone CH230-400J9, WORKING DRAF... 48 1.3 1
(ET210742) MUGQ_CH252P411G21Sp6_CP784_089 CHORI-252 Vervet M... 48 1.3 1
(ER928307) MUGQ_CH252P289H20T7_CP449_074 CHORI-252 Vervet Mo... 48 1.3 1
(BJ387127) Dictyostelium discoideum cDNA clone:dds12p12, 5' ... 48 1.3 1
(AZ604433) 1M0425I17F Mouse 10kb plasmid UUGC1M library Mus ... 38 1.5 2
(BM165812) EST568335 PyBS Plasmodium yoelii yoelii cDNA clon... 36 1.6 2
(AC180442) Strongylocentrotus purpuratus clone R3-3102M04, W... 36 2.0 7
(EK318761) 1095462421546 Global-Ocean-Sampling_GS-31-01-01-1... 44 2.1 2
(BM162918) EST565441 PyBS Plasmodium yoelii yoelii cDNA clon... 36 2.1 2
(FJ429092) Architeuthis dux isolate 5-32 mitochondrion, comp... 32 2.2 5
(BD428971) Method and nucleic acids for pharmacogenomic meth... 44 2.2 3
(AX348450) Sequence 145 from Patent WO0202806. 44 2.2 3
(AX346984) Sequence 2055 from Patent WO0200928. 44 2.2 3
(DD061407) Methods and nucleic acids for the analysis of he... 40 2.2 2
(AX598969) Sequence 309 from Patent WO02077272. 40 2.2 2
(AC079100) Homo sapiens chromosome 15 clone RP11-107O19 map ... 40 2.3 3
(EJ648260) 1092953001871 Global-Ocean-Sampling_GS-30-02-01-1... 44 2.3 2
(EJ696959) 1092956021938 Global-Ocean-Sampling_GS-30-02-01-1... 44 2.3 2
(AC137827) Medicago truncatula clone mth2-20g23, complete se... 40 2.4 7
(AC155124) Bos taurus clone CH240-42P7, WORKING DRAFT SEQUEN... 36 2.5 2
(AL031632) Caenorhabditis elegans YAC Y32B12B. 36 3.4 4
(DD391929) Method and nucleic acids for the improved treatme... 40 3.9 2
(CQ807185) Sequence 635 from Patent WO2004035803. 40 3.9 2
(AX795961) Sequence 304 from Patent WO03052135. 40 3.9 2
(AX767563) Sequence 211 from Patent WO03044226. 40 3.9 2
(AZ432323) 1M0217M07R Mouse 10kb plasmid UUGC1M library Mus ... 38 4.8 2
(EB992633) 16052802 ZF42 Danio rerio cDNA clone 4276949, mRN... 36 4.9 3
(AL935307) Zebrafish DNA sequence from clone DKEY-63P22. 46 5.0 1
(AL713996) Zebrafish DNA sequence from clone BUSM1-201C3 in ... 46 5.0 1
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 46 5.0 1
(AC115682) Dictyostelium discoideum chromosome 2 map 4101105... 46 5.0 1
(AC125491) Homo sapiens 12 BAC RP11-235E24 (Roswell Park Can... 46 5.0 1
(AC079621) Homo sapiens BAC clone CTD-3045A19 from 7, comple... 46 5.0 1
(AC133299) Rattus norvegicus clone CH230-272I24, WORKING DRA... 46 5.0 1
(AC128118) Rattus norvegicus clone CH230-417M21, WORKING DRA... 46 5.0 1
(AC069317) Homo sapiens chromosome 7 clone RP11-415F5, WORKI... 46 5.0 1
(CU104786) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 46 5.0 1
(ET766280) CHO_OF166xc04f1.ab1 CHO_OF Nicotiana tabacum geno... 46 5.0 1
(EK266264) 1095462226929 Global-Ocean-Sampling_GS-31-01-01-1... 46 5.0 1
(EJ916451) 1093018563576 Global-Ocean-Sampling_GS-30-02-01-1... 46 5.0 1
(ED981137) OA_CBa0182M01.f OA_CBa Oryza australiensis genomi... 46 5.0 1
(ED945166) OA_CBa0126H12.r OA_CBa Oryza australiensis genomi... 46 5.0 1
(ED869661) OA_CBa0046J13.f OA_CBa Oryza australiensis genomi... 46 5.0 1
(DE942787) Macropus eugenii DNA, BAC clone: MEB1-137N23_F, 5... 46 5.0 1
(CW603319) OA_ABa0142B10.f OA_ABa Oryza australiensis genomi... 46 5.0 1
(EX006780) BGBV-aae37b01.g1 Snail_EST_pSMART Biomphalaria gl... 46 5.0 1
(EX004672) BGBV-aae17f10.b1 Snail_EST_pSMART Biomphalaria gl... 46 5.0 1
(M64430) Vaccinia virus MRNA capping enzyme small subunit gene. 28 5.4 5
(CR792433) Zebrafish DNA sequence from clone DKEY-200G10 in ... 36 5.5 5
(AZ351664) 1M0089N14R Mouse 10kb plasmid UUGC1M library Mus ... 38 5.7 2
(ET856139) CHO_OF361xb10f1.ab1 CHO_OF Nicotiana tabacum geno... 38 6.2 2
(CT715514) Danio rerio EST, clone ZF_mu_272l12 5'. 38 6.4 2
(AC020342) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 32 6.4 9
(CT562645) A BAC library has been constructed from cultivar ... 30 6.6 4
(EI338246) GM_WBc0081A01.r GM_WBc Glycine max genomic clone ... 40 7.0 2
(DX585159) MUGQ_CH252P055M22T7_GL449_083 CHORI-252 Vervet Mo... 44 7.5 2
(AE017196) Wolbachia endosymbiont of Drosophila melanogaster... 32 7.9 2
(EK052947) 1092959723952 Global-Ocean-Sampling_GS-31-01-01-1... 38 8.0 3
(EJ072578) 1095458095792 Global-Ocean-Sampling_GS-26-01-01-1... 36 8.7 2
(AG907464) Oryza sativa Indica Group genomic DNA, BAC end se... 40 8.7 2
(AC103856) Homo sapiens chromosome 15 clone RP11-203L21 map ... 36 8.8 3
(EJ089294) 1095460148502 Global-Ocean-Sampling_GS-26-01-01-1... 40 9.6 3
>(BJ369444) Dictyostelium discoideum cDNA clone:ddc50h18, 5' end,
single read.
Length = 591
Score = 1148 bits (579), Expect = 0.0
Identities = 579/579 (100%)
Strand = Plus / Plus
Query: 904 gatgaaggcatggagaattcatagttttgatggtacctatggtatgaaaatggatgaaat 963
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 13 gatgaaggcatggagaattcatagttttgatggtacctatggtatgaaaatggatgaaat 72
Query: 964 ttcagttccacatattaatgatgatcaagtattggttaaagtatcagcagtttcattaaa 1023
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73 ttcagttccacatattaatgatgatcaagtattggttaaagtatcagcagtttcattaaa 132
Query: 1024 ctatagagataaagcaataatggatggaacctatggtattaaatttgaaaaaggtttaat 1083
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 133 ctatagagataaagcaataatggatggaacctatggtattaaatttgaaaaaggtttaat 192
Query: 1084 accagtatctgatacttgtggcataattgaaaaagttggaaaaaatgtaaagaaatttaa 1143
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 193 accagtatctgatacttgtggcataattgaaaaagttggaaaaaatgtaaagaaatttaa 252
Query: 1144 agttggtgatagagttgtaaatcatttcttatctcactggatggaaggtgaagcgaaaag 1203
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 253 agttggtgatagagttgtaaatcatttcttatctcactggatggaaggtgaagcgaaaag 312
Query: 1204 taatgaagaacaattcagttatggtggtccgttaaatggcggtttagcaaaatacattat 1263
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 313 taatgaagaacaattcagttatggtggtccgttaaatggcggtttagcaaaatacattat 372
Query: 1264 tcttgatgaaaactcatgtttaataccaccaaaacattacacagatgaagaatgctcaac 1323
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 373 tcttgatgaaaactcatgtttaataccaccaaaacattacacagatgaagaatgctcaac 432
Query: 1324 attacccattgcagcatgtacagcgtggtattcgttaatgaatgtcggtggaattgaatc 1383
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 433 attacccattgcagcatgtacagcgtggtattcgttaatgaatgtcggtggaattgaatc 492
Query: 1384 aaaattaaaatcaaatcaaactgttttaattcaaggcactggcggtgtctcattattcgc 1443
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 493 aaaattaaaatcaaatcaaactgttttaattcaaggcactggcggtgtctcattattcgc 552
Query: 1444 tcttcaaatatcacattcaattggtgcaaaaactatact 1482
|||||||||||||||||||||||||||||||||||||||
Sbjct: 553 tcttcaaatatcacattcaattggtgcaaaaactatact 591
Score = 500 bits (252), Expect = e-136
Identities = 252/252 (100%)
Strand = Plus / Plus
Query: 404 gatgaaggcatggagaattcatagttttgatggtacctatggtatgaaaatggatgaaat 463
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 13 gatgaaggcatggagaattcatagttttgatggtacctatggtatgaaaatggatgaaat 72
Query: 464 ttcagttccacatattaatgatgatcaagtattggttaaagtatcagcagtttcattaaa 523
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 73 ttcagttccacatattaatgatgatcaagtattggttaaagtatcagcagtttcattaaa 132
Query: 524 ctatagagataaagcaataatggatggaacctatggtattaaatttgaaaaaggtttaat 583
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 133 ctatagagataaagcaataatggatggaacctatggtattaaatttgaaaaaggtttaat 192
Query: 584 accagtatctgatacttgtggcataattgaaaaagttggaaaaaatgtaaagaaatttaa 643
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 193 accagtatctgatacttgtggcataattgaaaaagttggaaaaaatgtaaagaaatttaa 252
Query: 644 agttggtgatag 655
||||||||||||
Sbjct: 253 agttggtgatag 264
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,940,058,925
Number of extensions: 122598619
Number of successful extensions: 10464523
Number of sequences better than 10.0: 92
Length of query: 1978
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1954
Effective length of database: 96,409,374,237
Effective search space: 188383917259098
Effective search space used: 188383917259098
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U16058-1 (Contig-U16058-1Q) /CSM_Contig/Contig-U16058-1Q.Seq.d
(1978 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AP008934_1634(AP008934|pid:none) Staphylococcus saprophyticus su... 284 1e-74
FP236842_2507(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 272 4e-71
CP000786_3034(CP000786|pid:none) Leptospira biflexa serovar Pato... 209 2e-52
BA000012_3024(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 209 4e-52
CU633457_338(CU633457|pid:none) Podospora anserina genomic DNA c... 207 1e-51
AP006726_240(AP006726|pid:none) Klebsiella pneumoniae NTUH-K2044... 202 5e-50
CP000113_2217(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 201 6e-50
CP000698_18(CP000698|pid:none) Geobacter uraniireducens Rf4, com... 201 6e-50
CP001029_3298(CP001029|pid:none) Methylobacterium populi BJ001, ... 198 7e-49
CP001389_2431(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 197 9e-49
CP000908_3105(CP000908|pid:none) Methylobacterium extorquens PA1... 197 1e-48
CP001510_3123(CP001510|pid:none) Methylobacterium extorquens AM1... 197 2e-48
CP000113_6622(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 196 2e-48
CP001298_3320(CP001298|pid:none) Methylobacterium chloromethanic... 195 6e-48
CP000494_5038(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 194 8e-48
CU234118_2653(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 194 1e-47
CP000628_792(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 194 1e-47
CP000350_2176(CP000350|pid:none) Leptospira borgpetersenii serov... 193 2e-47
AM746676_4300(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 192 3e-47
AE010300_3155(AE010300|pid:none) Leptospira interrogans serovar ... 192 3e-47
CP000271_1565(CP000271|pid:none) Burkholderia xenovorans LB400 c... 192 4e-47
CP000738_2334(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 192 5e-47
AP007164_310(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 192 5e-47
AM920437_2499(AM920437|pid:none) Penicillium chrysogenum Wiscons... 190 2e-46
CP000787_207(CP000787|pid:none) Leptospira biflexa serovar Patoc... 189 4e-46
CP000778_203(CP000778|pid:none) Leptospira biflexa serovar Patoc... 189 4e-46
CP001635_4920(CP001635|pid:none) Variovorax paradoxus S110 chrom... 188 5e-46
AL591688_2459(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 187 1e-45
CP001074_3485(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 186 3e-45
CP001472_1412(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 186 4e-45
AM236080_3713(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 184 8e-45
FJ851547_66(FJ851547|pid:none) Pseudomonas nitroreducens strain ... 183 2e-44
CP000386_251(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 183 2e-44
AM270327_58(AM270327|pid:none) Aspergillus niger contig An14c020... 182 3e-44
AM270216_5(AM270216|pid:none) Aspergillus niger contig An10c0050... 182 3e-44
AP007154_509(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 181 9e-44
AM270342_16(AM270342|pid:none) Aspergillus niger contig An15c015... 181 9e-44
CP000272_1198(CP000272|pid:none) Burkholderia xenovorans LB400 c... 181 9e-44
CP000975_1569(CP000975|pid:none) Methylacidiphilum infernorum V4... 179 3e-43
CP000394_98(CP000394|pid:none) Granulibacter bethesdensis CGDNIH... 179 3e-43
AP007157_659(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 179 3e-43
CP000884_361(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 177 1e-42
CP000075_1152(CP000075|pid:none) Pseudomonas syringae pv. syring... 177 1e-42
CP000159_1647(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 177 1e-42
AP009386_185(AP009386|pid:none) Burkholderia multivorans ATCC 17... 177 2e-42
CP000459_365(CP000459|pid:none) Burkholderia cenocepacia HI2424 ... 176 2e-42
CP000959_790(CP000959|pid:none) Burkholderia cenocepacia MC0-3 c... 176 4e-42
CP000152_2589(CP000152|pid:none) Burkholderia sp. 383 chromosome... 175 5e-42
CP000285_807(CP000285|pid:none) Chromohalobacter salexigens DSM ... 175 5e-42
CP000615_705(CP000615|pid:none) Burkholderia vietnamiensis G4 ch... 175 5e-42
AM260480_508(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 174 8e-42
CP000058_1176(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 174 1e-41
CP000960_836(CP000960|pid:none) Burkholderia cenocepacia MC0-3 c... 173 2e-41
CP000304_2808(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 172 4e-41
AE017340_1590(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 172 4e-41
CU633750_325(CU633750|pid:none) Cupriavidus taiwanensis str. LMG... 172 5e-41
CP001280_2928(CP001280|pid:none) Methylocella silvestris BL2, co... 170 2e-40
CP000926_4742(CP000926|pid:none) Pseudomonas putida GB-1, comple... 170 2e-40
AP007166_491(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 169 3e-40
CP000158_100(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 169 3e-40
AM746676_3253(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 169 4e-40
CP000271_729(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 168 6e-40
CP001001_1393(CP001001|pid:none) Methylobacterium radiotolerans ... 168 6e-40
CT573326_655(CT573326|pid:none) Pseudomonas entomophila str. L48... 168 8e-40
AE015451_4696(AE015451|pid:none) Pseudomonas putida KT2440 compl... 167 1e-39
CP001053_2023(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 167 1e-39
CP000086_1422(CP000086|pid:none) Burkholderia thailandensis E264... 166 2e-39
CP000526_888(CP000526|pid:none) Burkholderia mallei SAVP1 chromo... 166 3e-39
CP000570_3084(CP000570|pid:none) Burkholderia pseudomallei 668 c... 166 3e-39
CP000103_1567(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 162 5e-38
CP000251_742(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C... 160 2e-37
CP001016_366(CP001016|pid:none) Beijerinckia indica subsp. indic... 158 8e-37
CP001157_1627(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 157 1e-36
AP007169_82(AP007169|pid:none) Aspergillus oryzae RIB40 genomic ... 155 7e-36
CP000090_1644(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 154 9e-36
CP000943_3439(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 154 1e-35
CP000157_1464(CP000157|pid:none) Erythrobacter litoralis HTCC259... 152 3e-35
CP000248_1426(CP000248|pid:none) Novosphingobium aromaticivorans... 152 4e-35
CP000251_3515(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 150 1e-34
CU633457_226(CU633457|pid:none) Podospora anserina genomic DNA c... 149 5e-34
CR555308_161(CR555308|pid:none) Azoarcus sp. EbN1 plasmid 2. 147 1e-33
AM260480_1710(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 146 2e-33
BA000012_6446(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 143 2e-32
AP008957_1982(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 142 6e-32
CP001503_1053(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 137 1e-30
AE008923_201(AE008923|pid:none) Xanthomonas axonopodis pv. citri... 136 3e-30
AM039952_185(AM039952|pid:none) Xanthomonas campestris pv. vesic... 135 7e-30
CP001230_456(CP001230|pid:none) Persephonella marina EX-H1, comp... 135 7e-30
BA000012_1487(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 134 2e-29
AM269993_32(AM269993|pid:none) Aspergillus niger contig An01c047... 122 5e-26
CP000386_2026(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 117 2e-24
CP000267_1461(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 116 3e-24
CP000724_662(CP000724|pid:none) Alkaliphilus metalliredigens QYM... 115 5e-24
AM270397_18(AM270397|pid:none) Aspergillus niger contig An18c004... 115 8e-24
CP000319_3375(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 113 2e-23
AL009126_1907(AL009126|pid:none) Bacillus subtilis subsp. subtil... 112 5e-23
CP000774_2083(CP000774|pid:none) Parvibaculum lavamentivorans DS... 111 9e-23
CP000529_1408(CP000529|pid:none) Polaromonas naphthalenivorans C... 111 1e-22
CP001096_979(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 111 1e-22
CU234118_1042(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 110 1e-22
AM942759_1191(AM942759|pid:none) Proteus mirabilis strain HI4320... 110 2e-22
CP001176_1985(CP001176|pid:none) Bacillus cereus B4264, complete... 109 3e-22
BX572595_284(BX572595|pid:none) Rhodopseudomonas palustris CGA00... 108 6e-22
CP001283_2057(CP001283|pid:none) Bacillus cereus AH820, complete... 108 6e-22
CP001215_2389(CP001215|pid:none) Bacillus anthracis str. CDC 684... 108 7e-22
DQ191658_1(DQ191658|pid:none) Solanum tuberosum NADPH quinone ox... 108 7e-22
AE014299_631(AE014299|pid:none) Shewanella oneidensis MR-1, comp... 108 7e-22
CP000463_665(CP000463|pid:none) Rhodopseudomonas palustris BisA5... 108 7e-22
AM446658_1(AM446658|pid:none) Vitis vinifera contig VV78X130333.... 108 9e-22
CP000494_6528(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 108 9e-22
AP008229_1325(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 107 1e-21
CP000758_1160(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 107 2e-21
CP001176_2528(CP001176|pid:none) Bacillus cereus B4264, complete... 107 2e-21
BT070906_1(BT070906|pid:none) Picea sitchensis clone WS02758_L18... 107 2e-21
CP000875_338(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 107 2e-21
CP000708_1539(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 107 2e-21
CP001488_1644(CP001488|pid:none) Brucella melitensis ATCC 23457 ... 107 2e-21
AE014291_1685(AE014291|pid:none) Brucella suis 1330 chromosome I... 107 2e-21
CP001635_3467(CP001635|pid:none) Variovorax paradoxus S110 chrom... 107 2e-21
CP000539_938(CP000539|pid:none) Acidovorax sp. JS42, complete ge... 106 3e-21
CP000557_887(CP000557|pid:none) Geobacillus thermodenitrificans ... 106 3e-21
CP000250_4465(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 106 3e-21
AE017194_2179(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 106 3e-21
CU914166_431(CU914166|pid:none) Ralstonia solanacearum strain IP... 106 3e-21
CP001392_858(CP001392|pid:none) Diaphorobacter sp. TPSY, complet... 106 4e-21
CU459003_1027(CU459003|pid:none) Magnetospirillum gryphiswaldens... 105 5e-21
CP000903_1918(CP000903|pid:none) Bacillus weihenstephanensis KBA... 105 6e-21
CP000227_3202(CP000227|pid:none) Bacillus cereus Q1, complete ge... 105 8e-21
CP001283_3432(CP001283|pid:none) Bacillus cereus AH820, complete... 105 8e-21
CP000001_2360(CP000001|pid:none) Bacillus cereus E33L, complete ... 105 8e-21
CP000360_2641(CP000360|pid:none) Acidobacteria bacterium Ellin34... 104 1e-20
CP001177_2095(CP001177|pid:none) Bacillus cereus AH187, complete... 104 1e-20
CP000121_107(CP000121|pid:none) Anabaena variabilis ATCC 29413 p... 104 1e-20
EU686632_16(EU686632|pid:none) Uncultured marine group III eurya... 104 1e-20
AM040264_1750(AM040264|pid:none) Brucella melitensis biovar Abor... 103 2e-20
CP000863_1938(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 103 2e-20
AE017333_909(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 103 2e-20
CP000283_4323(CP000283|pid:none) Rhodopseudomonas palustris BisB... 103 2e-20
AE017355_3235(AE017355|pid:none) Bacillus thuringiensis serovar ... 103 2e-20
AP007159_262(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 103 2e-20
CP001196_3276(CP001196|pid:none) Oligotropha carboxidovorans OM5... 103 2e-20
AE016877_2507(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 103 2e-20
BX640413_117(BX640413|pid:none) Bordetella pertussis strain Toha... 103 2e-20
CP000001_3188(CP000001|pid:none) Bacillus cereus E33L, complete ... 103 2e-20
BT052074_1(BT052074|pid:none) Medicago truncatula clone MTYF9_FA... 103 2e-20
CP000485_1774(CP000485|pid:none) Bacillus thuringiensis str. Al ... 103 2e-20
CP000485_2988(CP000485|pid:none) Bacillus thuringiensis str. Al ... 103 3e-20
CP001407_3418(CP001407|pid:none) Bacillus cereus 03BB102, comple... 103 3e-20
CP000271_505(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 103 3e-20
CU459141_687(CU459141|pid:none) Acinetobacter baumannii str. AYE... 103 3e-20
CP000774_2392(CP000774|pid:none) Parvibaculum lavamentivorans DS... 103 3e-20
CP001635_1783(CP001635|pid:none) Variovorax paradoxus S110 chrom... 103 3e-20
AP008957_5483(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 101 9e-20
AE016877_1966(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 101 1e-19
CP000713_989(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 101 1e-19
CP000058_2653(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 101 1e-19
CR543861_1596(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 101 1e-19
CP001176_3356(CP001176|pid:none) Bacillus cereus B4264, complete... 100 2e-19
CP001025_1247(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 100 2e-19
CP000115_2735(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 100 2e-19
AP009385_1257(AP009385|pid:none) Burkholderia multivorans ATCC 1... 100 2e-19
CP000090_955(CP000090|pid:none) Ralstonia eutropha JMP134 chromo... 100 3e-19
CP001177_3241(CP001177|pid:none) Bacillus cereus AH187, complete... 100 3e-19
CP000968_355(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 100 3e-19
CP000316_3206(CP000316|pid:none) Polaromonas sp. JS666, complete... 100 3e-19
CP000903_2426(CP000903|pid:none) Bacillus weihenstephanensis KBA... 100 3e-19
AP011115_1205(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 100 3e-19
CP001638_851(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 100 3e-19
CP001283_3316(CP001283|pid:none) Bacillus cereus AH820, complete... 100 3e-19
AM269998_25(AM269998|pid:none) Aspergillus niger contig An02c003... 99 4e-19
(Q5R4S7) RecName: Full=Quinone oxidoreductase; EC=1.6.5... 99 4e-19
CP000001_3055(CP000001|pid:none) Bacillus cereus E33L, complete ... 99 4e-19
CP001068_2184(CP001068|pid:none) Ralstonia pickettii 12J chromos... 99 6e-19
AP007151_197(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 99 6e-19
AE017355_3131(AE017355|pid:none) Bacillus thuringiensis serovar ... 99 6e-19
CU468230_651(CU468230|pid:none) Acinetobacter baumannii str. SDF... 99 7e-19
CP000542_2761(CP000542|pid:none) Verminephrobacter eiseniae EF01... 99 7e-19
CP000781_1608(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 98 1e-18
CP000512_1233(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 98 1e-18
FM209186_4183(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 98 1e-18
AP007154_246(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 98 1e-18
CP000352_924(CP000352|pid:none) Ralstonia metallidurans CH34, co... 98 1e-18
CP000378_854(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 97 2e-18
AB209714_1(AB209714|pid:none) Homo sapiens mRNA for crystallin, ... 97 2e-18
CP000103_1365(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 97 2e-18
CP000822_1196(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 97 3e-18
CP001032_169(CP001032|pid:none) Opitutus terrae PB90-1, complete... 97 3e-18
DQ499448_1(DQ499448|pid:none) Sus scrofa zeta-crystallin (CRYZ) ... 97 3e-18
(Q0MVN8) RecName: Full=Quinone oxidoreductase; EC=1.6.5... 97 3e-18
(Q08257) RecName: Full=Quinone oxidoreductase; EC=1.6.5... 97 3e-18
CP001074_1206(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 97 3e-18
CR628336_1701(CR628336|pid:none) Legionella pneumophila str. Par... 97 3e-18
EF089399_80(EF089399|pid:none) Uncultured marine bacterium EB0_3... 96 4e-18
CP000157_659(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 96 4e-18
AM902716_1632(AM902716|pid:none) Bordetella petrii strain DSM 12... 96 4e-18
CP000469_3558(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 96 4e-18
BX842646_278(BX842646|pid:none) Bdellovibrio bacteriovorus compl... 96 4e-18
BX294018_9(BX294018|pid:none) Neurospora crassa DNA linkage grou... 96 4e-18
CP000820_93(CP000820|pid:none) Frankia sp. EAN1pec, complete gen... 96 5e-18
BA000012_2906(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 96 5e-18
BA000028_1376(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 96 5e-18
AE017354_1703(AE017354|pid:none) Legionella pneumophila subsp. p... 96 5e-18
CP000485_2252(CP000485|pid:none) Bacillus thuringiensis str. Al ... 96 5e-18
CP000958_1315(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 96 6e-18
BC003800_1(BC003800|pid:none) Mus musculus crystallin, zeta, mRN... 96 6e-18
EU016640_19(EU016640|pid:none) Uncultured Group I marine crenarc... 95 8e-18
CP001408_1301(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 95 8e-18
AP009385_2187(AP009385|pid:none) Burkholderia multivorans ATCC 1... 95 8e-18
CP001510_691(CP001510|pid:none) Methylobacterium extorquens AM1,... 95 8e-18
AE016879_3150(AE016879|pid:none) Bacillus anthracis str. Ames, c... 95 1e-17
CU633897_290(CU633897|pid:none) Podospora anserina genomic DNA c... 95 1e-17
EU016630_35(EU016630|pid:none) Uncultured Group I marine crenarc... 95 1e-17
U70048_1(U70048|pid:none) Bos taurus zeta-crystallin (CRYZ) mRNA... 95 1e-17
CP000031_227(CP000031|pid:none) Ruegeria pomeroyi DSS-3, complet... 94 1e-17
CP000086_1051(CP000086|pid:none) Burkholderia thailandensis E264... 94 1e-17
AY917144_1(AY917144|pid:none) Thlaspi caerulescens putative quin... 94 1e-17
CP000378_1629(CP000378|pid:none) Burkholderia cenocepacia AU 105... 94 1e-17
CP001029_881(CP001029|pid:none) Methylobacterium populi BJ001, c... 94 1e-17
AM260480_454(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 94 1e-17
CP001131_2913(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 94 2e-17
AM920437_1339(AM920437|pid:none) Penicillium chrysogenum Wiscons... 94 2e-17
CP000908_937(CP000908|pid:none) Methylobacterium extorquens PA1,... 94 2e-17
CP000088_358(CP000088|pid:none) Thermobifida fusca YX, complete ... 94 2e-17
CP001359_3001(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 94 2e-17
BX571965_1220(BX571965|pid:none) Burkholderia pseudomallei strai... 94 2e-17
CP000447_3637(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 94 2e-17
AJ634062_12(AJ634062|pid:none) Bacillus amyloliquefaciens dif ge... 94 2e-17
AM260479_1036(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 93 3e-17
AM454331_2(AM454331|pid:none) Vitis vinifera contig VV78X125775.... 93 3e-17
CP000151_2391(CP000151|pid:none) Burkholderia sp. 383 chromosome... 93 3e-17
CP000509_125(CP000509|pid:none) Nocardioides sp. JS614, complete... 93 3e-17
AM747720_2343(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 93 3e-17
CP000158_2918(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 93 4e-17
CP000301_782(CP000301|pid:none) Rhodopseudomonas palustris BisB1... 93 4e-17
AF411784_1(AF411784|pid:none) Arabidopsis thaliana AT4g21580/F18... 93 4e-17
CP000614_2308(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 93 4e-17
CP000481_2097(CP000481|pid:none) Acidothermus cellulolyticus 11B... 93 4e-17
CP000667_4413(CP000667|pid:none) Salinispora tropica CNB-440, co... 92 7e-17
AP011115_2056(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 92 7e-17
CP000271_2154(CP000271|pid:none) Burkholderia xenovorans LB400 c... 92 9e-17
BA000035_180(BA000035|pid:none) Corynebacterium efficiens YS-314... 92 9e-17
CP000850_4790(CP000850|pid:none) Salinispora arenicola CNS-205, ... 92 9e-17
CP000058_288(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 92 9e-17
CP000699_127(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 92 9e-17
CP000267_2733(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 91 1e-16
EU016605_28(EU016605|pid:none) Uncultured Group I marine crenarc... 91 1e-16
AM167904_2657(AM167904|pid:none) Bordetella avium 197N complete ... 91 1e-16
CP000781_832(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 91 2e-16
CP000463_606(CP000463|pid:none) Rhodopseudomonas palustris BisA5... 91 2e-16
BC043076_1(BC043076|pid:none) Mus musculus crystallin, zeta, mRN... 91 2e-16
CU633749_1005(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 91 2e-16
CP000964_3176(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 91 2e-16
CP000431_2309(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 90 3e-16
CP000301_1016(CP000301|pid:none) Rhodopseudomonas palustris BisB... 90 3e-16
CP000647_1181(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 90 3e-16
CP001100_319(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 90 3e-16
CP000316_101(CP000316|pid:none) Polaromonas sp. JS666, complete ... 90 3e-16
AM747721_2112(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 90 3e-16
BX571866_284(BX571866|pid:none) Photorhabdus luminescens subsp. ... 90 3e-16
CP001150_2074(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 90 3e-16
CP000680_312(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 90 3e-16
CP000943_4077(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 90 3e-16
CP000143_2324(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 89 5e-16
BT034352_1(BT034352|pid:none) Zea mays full-length cDNA clone ZM... 89 5e-16
BT035789_1(BT035789|pid:none) Zea mays full-length cDNA clone ZM... 89 5e-16
CP000628_370(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 89 5e-16
CP000529_2556(CP000529|pid:none) Polaromonas naphthalenivorans C... 89 5e-16
CP000250_3341(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 89 5e-16
CP001130_1620(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 89 6e-16
CP000577_2353(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 89 6e-16
CP000529_2116(CP000529|pid:none) Polaromonas naphthalenivorans C... 89 6e-16
CP000680_119(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 89 6e-16
CP001022_267(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 89 6e-16
AP009384_29(AP009384|pid:none) Azorhizobium caulinodans ORS 571 ... 89 6e-16
AL646052_2064(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 89 8e-16
CP001001_3022(CP001001|pid:none) Methylobacterium radiotolerans ... 89 8e-16
BX640438_8(BX640438|pid:none) Bordetella bronchiseptica strain R... 89 8e-16
BX640422_97(BX640422|pid:none) Bordetella pertussis strain Toham... 89 8e-16
BX572602_220(BX572602|pid:none) Rhodopseudomonas palustris CGA00... 89 8e-16
CR931997_2033(CR931997|pid:none) Corynebacterium jeikeium K411 c... 89 8e-16
CP000934_1309(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 89 8e-16
CP000088_70(CP000088|pid:none) Thermobifida fusca YX, complete g... 89 8e-16
CP001096_3337(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 89 8e-16
CP000377_2516(CP000377|pid:none) Silicibacter sp. TM1040, comple... 89 8e-16
CP001052_2005(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 88 1e-15
CP001298_1876(CP001298|pid:none) Methylobacterium chloromethanic... 88 1e-15
AE007869_808(AE007869|pid:none) Agrobacterium tumefaciens str. C... 88 1e-15
F97459(F97459)probable quinone oxidoreductase [imported] - Agrob... 88 1e-15
CP000698_178(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 88 1e-15
CU458896_1097(CU458896|pid:none) Mycobacterium abscessus chromos... 88 1e-15
CP000555_1251(CP000555|pid:none) Methylibium petroleiphilum PM1,... 87 2e-15
CP000083_3183(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 87 2e-15
CU234118_4695(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 87 2e-15
AK221446_1(AK221446|pid:none) Arabidopsis thaliana mRNA for quin... 87 2e-15
CP001601_116(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 87 2e-15
AM180088_2090(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 87 2e-15
CP000875_3230(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 87 2e-15
CP000283_2081(CP000283|pid:none) Rhodopseudomonas palustris BisB... 87 2e-15
AM747721_689(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 87 2e-15
CP001195_49(CP001195|pid:none) Rhizobium leguminosarum bv. trifo... 87 3e-15
CP001089_1072(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 87 3e-15
CP000774_1379(CP000774|pid:none) Parvibaculum lavamentivorans DS... 87 3e-15
AE007872_184(AE007872|pid:none) Agrobacterium tumefaciens str. C... 87 3e-15
BX640424_13(BX640424|pid:none) Bordetella parapertussis strain 1... 87 3e-15
CP000094_5440(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 87 3e-15
AP008955_1530(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 87 3e-15
AE014292_378(AE014292|pid:none) Brucella suis 1330 chromosome II... 87 3e-15
AE017224_750(AE017224|pid:none) Brucella abortus biovar 1 str. 9... 87 3e-15
CP000407_313(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 87 3e-15
CP000362_966(CP000362|pid:none) Roseobacter denitrificans OCh 11... 87 3e-15
CP000090_2081(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 87 3e-15
CP000826_3047(CP000826|pid:none) Serratia proteamaculans 568, co... 87 3e-15
CP000271_664(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 87 3e-15
CP001037_2984(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 87 3e-15
AE007889_4(AE007889|pid:none) Agrobacterium tumefaciens str. C58... 87 3e-15
CP000661_2411(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 86 4e-15
CP000283_2015(CP000283|pid:none) Rhodopseudomonas palustris BisB... 86 4e-15
CP000386_681(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 86 4e-15
CP000386_2345(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 86 4e-15
AM270247_17(AM270247|pid:none) Aspergillus niger contig An11c030... 86 4e-15
AF1510(AF1510) oxidoreductase homolog lin0622 [imported] - Liste... 86 4e-15
AH0201(AH0201) probable Zinc-binding dehydrogenase [imported] - ... 86 5e-15
CP001189_1461(CP001189|pid:none) Gluconacetobacter diazotrophicu... 86 5e-15
BX936398_2414(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 86 5e-15
CP000360_4579(CP000360|pid:none) Acidobacteria bacterium Ellin34... 86 5e-15
AE009952_1788(AE009952|pid:none) Yersinia pestis KIM, complete g... 86 5e-15
CP000950_1716(CP000950|pid:none) Yersinia pseudotuberculosis YPI... 86 5e-15
CP000356_361(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 86 5e-15
CP001400_2333(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 86 7e-15
CP000720_1601(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 86 7e-15
CP001389_694(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 86 7e-15
CP000473_4466(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 86 7e-15
CP000264_3889(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 86 7e-15
CP000482_2695(CP000482|pid:none) Pelobacter propionicus DSM 2379... 86 7e-15
CP001401_2382(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 86 7e-15
CP000449_1643(CP000449|pid:none) Maricaulis maris MCS10, complet... 86 7e-15
CP001615_2688(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 85 9e-15
CP000875_3940(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 85 9e-15
EF583999_31(EF583999|pid:none) Uncultured haloarchaeon clone fos... 85 9e-15
CP001614_4085(CP001614|pid:none) Teredinibacter turnerae T7901, ... 85 9e-15
CP000908_1649(CP000908|pid:none) Methylobacterium extorquens PA1... 85 9e-15
CP000454_1487(CP000454|pid:none) Arthrobacter sp. FB24, complete... 85 9e-15
(Q28452) RecName: Full=Quinone oxidoreductase; EC=1.6.5... 85 9e-15
CP001002_48(CP001002|pid:none) Methylobacterium radiotolerans JC... 85 9e-15
AE1151(AE1151) oxidoreductase homolog lmo0613 [imported] - Liste... 85 9e-15
CP001096_2187(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 85 9e-15
CU694393_156(CU694393|pid:none) Ralstonia solanacearum strain Mo... 85 1e-14
AK226382_1(AK226382|pid:none) Arabidopsis thaliana mRNA for quin... 85 1e-14
CP001399_133(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 85 1e-14
CP000356_850(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 85 1e-14
FJ650070_1(FJ650070|pid:none) Capsella grandiflora ecotype 10 cl... 85 1e-14
CP001196_2462(CP001196|pid:none) Oligotropha carboxidovorans OM5... 85 1e-14
AF457462_1(AF457462|pid:none) Myxococcus xanthus putative oxidor... 85 1e-14
CP000075_313(CP000075|pid:none) Pseudomonas syringae pv. syringa... 84 1e-14
AM889285_523(AM889285|pid:none) Gluconacetobacter diazotrophicus... 84 1e-14
CP000353_660(CP000353|pid:none) Ralstonia metallidurans CH34 meg... 84 1e-14
CP000884_5012(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 84 1e-14
AM238664_366(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 84 2e-14
CP000441_2160(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 84 2e-14
AP009384_1313(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 84 2e-14
CP000927_4812(CP000927|pid:none) Caulobacter sp. K31, complete g... 84 2e-14
CP000250_3071(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 83 3e-14
CP000094_1951(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 83 3e-14
CP000927_3054(CP000927|pid:none) Caulobacter sp. K31, complete g... 83 3e-14
AE006641_2280(AE006641|pid:none) Sulfolobus solfataricus P2, com... 83 3e-14
BT047246_1(BT047246|pid:none) Salmo salar clone ssal-rgb2-624-27... 83 3e-14
AM849034_1769(AM849034|pid:none) Clavibacter michiganensis subsp... 83 3e-14
CP001404_2442(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 83 3e-14
CP000432_624(CP000432|pid:none) Rhodococcus jostii RHA1 plasmid ... 83 3e-14
CP000077_1037(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 83 4e-14
CP000750_306(CP000750|pid:none) Kineococcus radiotolerans SRS302... 83 4e-14
(P12276) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 83 4e-14
AJ721051_1(AJ721051|pid:none) Gallus gallus mRNA for hypothetica... 83 4e-14
AE017352_167(AE017352|pid:none) Cryptococcus neoformans var. neo... 83 4e-14
CU458896_204(CU458896|pid:none) Mycobacterium abscessus chromoso... 83 4e-14
BC120317_1(BC120317|pid:none) Bos taurus tumor protein p53 induc... 83 4e-14
EF032014_5(EF032014|pid:none) Candidatus Endobugula sertula BryS... 83 4e-14
CP000884_4368(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 83 4e-14
EF032014_6(EF032014|pid:none) Candidatus Endobugula sertula BryS... 83 4e-14
CP000301_2082(CP000301|pid:none) Rhodopseudomonas palustris BisB... 83 4e-14
AE005673_767(AE005673|pid:none) Caulobacter crescentus CB15, com... 82 6e-14
CP000852_1584(CP000852|pid:none) Caldivirga maquilingensis IC-16... 82 6e-14
CP000094_3333(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 82 6e-14
CP000379_1716(CP000379|pid:none) Burkholderia cenocepacia AU 105... 82 6e-14
AL445065_185(AL445065|pid:none) Thermoplasma acidophilum complet... 82 6e-14
FJ650066_1(FJ650066|pid:none) Capsella grandiflora ecotype 7 clo... 82 6e-14
AL939117_280(AL939117|pid:none) Streptomyces coelicolor A3(2) co... 82 6e-14
AM746676_8576(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 82 7e-14
CP001096_720(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 82 7e-14
GM958272_1(GM958272|pid:none) Sequence 5226 from Patent WO200814... 82 7e-14
CP000152_3037(CP000152|pid:none) Burkholderia sp. 383 chromosome... 82 7e-14
AM114193_577(AM114193|pid:none) Uncultured methanogenic archaeon... 82 7e-14
CP000272_76(CP000272|pid:none) Burkholderia xenovorans LB400 chr... 82 7e-14
CU633749_1872(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 82 7e-14
FJ650079_1(FJ650079|pid:none) Capsella grandiflora ecotype 8 clo... 82 7e-14
AE006641_695(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 82 7e-14
CR936257_2396(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 82 9e-14
CP000656_2430(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 82 9e-14
CP000580_3712(CP000580|pid:none) Mycobacterium sp. JLS, complete... 82 9e-14
CP000394_1348(CP000394|pid:none) Granulibacter bethesdensis CGDN... 82 9e-14
A82968(A82968) alcohol dehydrogenase PA5427 [imported] - Pseudom... 82 9e-14
AE007869_1560(AE007869|pid:none) Agrobacterium tumefaciens str. ... 82 9e-14
AM260525_1188(AM260525|pid:none) Bartonella tribocorum CIP 10547... 82 9e-14
AE010299_758(AE010299|pid:none) Methanosarcina acetivorans str. ... 82 9e-14
CP000283_1536(CP000283|pid:none) Rhodopseudomonas palustris BisB... 82 9e-14
CP000388_1350(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 82 9e-14
CP000653_2260(CP000653|pid:none) Enterobacter sp. 638, complete ... 82 9e-14
CR931837_30(CR931837|pid:none) uncultured bacterial sequence, be... 82 9e-14
CP000910_608(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 81 1e-13
AE000516_4030(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 81 1e-13
BX294139_100(BX294139|pid:none) Rhodopirellula baltica SH 1 comp... 81 1e-13
BX897700_515(BX897700|pid:none) Bartonella quintana str. Toulous... 81 1e-13
CP001052_1788(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 81 1e-13
CP000463_2284(CP000463|pid:none) Rhodopseudomonas palustris BisA... 81 1e-13
CR936503_1832(CR936503|pid:none) Lactobacillus sakei strain 23K ... 81 2e-13
AF081920_18(AF081920|pid:none) Pseudomonas fluorescens strain Pf... 81 2e-13
CU633438_447(CU633438|pid:none) Podospora anserina genomic DNA c... 81 2e-13
CP000393_480(CP000393|pid:none) Trichodesmium erythraeum IMS101,... 81 2e-13
BX572595_25(BX572595|pid:none) Rhodopseudomonas palustris CGA009... 81 2e-13
BX294154_97(BX294154|pid:none) Rhodopirellula baltica SH 1 compl... 81 2e-13
CP001177_3238(CP001177|pid:none) Bacillus cereus AH187, complete... 81 2e-13
AE016879_3147(AE016879|pid:none) Bacillus anthracis str. Ames, c... 81 2e-13
AM942444_1943(AM942444|pid:none) Corynebacterium urealyticum DSM... 81 2e-13
BX294149_253(BX294149|pid:none) Rhodopirellula baltica SH 1 comp... 81 2e-13
CP001349_6170(CP001349|pid:none) Methylobacterium nodulans ORS 2... 80 2e-13
CP000903_2478(CP000903|pid:none) Bacillus weihenstephanensis KBA... 80 2e-13
CP000744_6130(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 80 2e-13
CP000449_2954(CP000449|pid:none) Maricaulis maris MCS10, complet... 80 2e-13
CP000686_3656(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 80 2e-13
AE016825_2043(AE016825|pid:none) Chromobacterium violaceum ATCC ... 80 2e-13
CP000301_2940(CP000301|pid:none) Rhodopseudomonas palustris BisB... 80 2e-13
CP000388_1802(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 80 2e-13
AP011115_7209(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 80 3e-13
DQ889941_1(DQ889941|pid:none) Candidatus Endobugula sertula isol... 80 3e-13
CP000352_2112(CP000352|pid:none) Ralstonia metallidurans CH34, c... 80 3e-13
CP000270_2078(CP000270|pid:none) Burkholderia xenovorans LB400 c... 80 3e-13
CP000806_3074(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 80 4e-13
CP000628_2089(CP000628|pid:none) Agrobacterium radiobacter K84 c... 80 4e-13
AY891387_1(AY891387|pid:none) Synthetic construct Homo sapiens c... 80 4e-13
CP000698_3251(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 80 4e-13
BX927315_4(BX927315|pid:none) Zebrafish DNA sequence from clone ... 80 4e-13
(Q53FA7) RecName: Full=Putative quinone oxidoreductase; ... 80 4e-13
CP000509_175(CP000509|pid:none) Nocardioides sp. JS614, complete... 80 4e-13
AP009493_3754(AP009493|pid:none) Streptomyces griseus subsp. gri... 79 5e-13
AX066059_1(AX066059|pid:none) Sequence 403 from Patent WO0100842... 79 5e-13
AM260480_1980(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 79 5e-13
CP000249_987(CP000249|pid:none) Frankia sp. CcI3, complete genome. 79 5e-13
CP000758_271(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188... 79 5e-13
CU640366_86(CU640366|pid:none) Podospora anserina genomic DNA ch... 79 5e-13
AJ580915_23(AJ580915|pid:none) Streptomyces parvulus Tu4055 clus... 79 5e-13
AE006641_2137(AE006641|pid:none) Sulfolobus solfataricus P2, com... 79 5e-13
EU967359_1(EU967359|pid:none) Zea mays clone 301989 oxidoreducta... 79 6e-13
CP000854_1478(CP000854|pid:none) Mycobacterium marinum M, comple... 79 6e-13
CP000949_5003(CP000949|pid:none) Pseudomonas putida W619, comple... 79 6e-13
AE016853_1826(AE016853|pid:none) Pseudomonas syringae pv. tomato... 79 6e-13
CP000826_3172(CP000826|pid:none) Serratia proteamaculans 568, co... 79 6e-13
AM260479_2320(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 79 6e-13
CP000133_2436(CP000133|pid:none) Rhizobium etli CFN 42, complete... 79 6e-13
CP001341_1481(CP001341|pid:none) Arthrobacter chlorophenolicus A... 79 6e-13
CP001074_2536(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 79 8e-13
CU695238_32(CU695238|pid:none) Ralstonia solanacearum strain Mol... 79 8e-13
AH1771(AH1771) zinc-binding dehydrogenase homolog lin2718 [impor... 79 8e-13
CP000158_11(CP000158|pid:none) Hyphomonas neptunium ATCC 15444, ... 79 8e-13
CP001636_742(CP001636|pid:none) Variovorax paradoxus S110 chromo... 79 8e-13
CT573326_4949(CT573326|pid:none) Pseudomonas entomophila str. L4... 79 8e-13
CU914168_1652(CU914168|pid:none) Ralstonia solanacearum strain I... 79 8e-13
AM746676_9165(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 79 8e-13
CP001191_2094(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 79 8e-13
CP001349_454(CP001349|pid:none) Methylobacterium nodulans ORS 20... 78 1e-12
CP001053_2155(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 78 1e-12
(P12785) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 78 1e-12
X13415_1(X13415|pid:none) Rat mRNA for fatty acid synthase (EC 2... 78 1e-12
CP000155_3320(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 78 1e-12
AM746676_3196(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 78 1e-12
AM236080_2816(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 78 1e-12
M76767_1(M76767|pid:none) Rattus norvegicus fatty acid synthase ... 78 1e-12
BA000030_1206(BA000030|pid:none) Streptomyces avermitilis MA-468... 78 1e-12
M84761_1(M84761|pid:none) Rat fatty acid synthase gene, complete... 78 1e-12
(P19096) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 78 1e-12
CP000113_3827(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 78 1e-12
AM746336_7(AM746336|pid:none) Streptomyces collinus kirromycin b... 78 1e-12
AM902716_1249(AM902716|pid:none) Bordetella petrii strain DSM 12... 78 1e-12
CP000908_1516(CP000908|pid:none) Methylobacterium extorquens PA1... 78 1e-12
AK147214_1(AK147214|pid:none) Mus musculus 15 days embryo brain ... 78 1e-12
AK080374_1(AK080374|pid:none) Mus musculus 3 days neonate thymus... 78 1e-12
AK171499_1(AK171499|pid:none) Mus musculus B6-derived CD11 +ve d... 78 1e-12
CP000852_1688(CP000852|pid:none) Caldivirga maquilingensis IC-16... 78 1e-12
BA000004_363(BA000004|pid:none) Bacillus halodurans C-125 DNA, c... 77 2e-12
EU016628_18(EU016628|pid:none) Uncultured Group I marine crenarc... 77 2e-12
CP000949_3194(CP000949|pid:none) Pseudomonas putida W619, comple... 77 2e-12
CP000875_1496(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 77 2e-12
CP000712_5060(CP000712|pid:none) Pseudomonas putida F1, complete... 77 2e-12
CP001298_1719(CP001298|pid:none) Methylobacterium chloromethanic... 77 2e-12
CP001325_179(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 77 2e-12
AE000516_3345(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 77 2e-12
BA000012_5609(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 77 2e-12
AF357202_5(AF357202|pid:none) Streptomyces nodosus amphotericin ... 77 2e-12
AP011115_3981(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 77 2e-12
AB050251_1(AB050251|pid:none) Hyla japonica mRNA for zeta-crysta... 77 2e-12
CP000821_2572(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 77 3e-12
>AP008934_1634(AP008934|pid:none) Staphylococcus saprophyticus subsp.
saprophyticus ATCC 15305 DNA, complete genome.
Length = 337
Score = 284 bits (726), Expect = 1e-74
Identities = 142/333 (42%), Positives = 217/333 (65%), Gaps = 1/333 (0%)
Frame = +2
Query: 911 AWRIHSFDGTYGMKMDEISVPHINDDQVLVKVSAVSLNYRDKAIMDGTYGIKFEK-GLIP 1087
AW++ +F G +K E+ P I +DQ+L+KV++VSLNYRD AI++G Y + K IP
Sbjct: 3 AWQLENF-GLDNLKQVELEKPEIAEDQILIKVNSVSLNYRDTAIVEGIYTPELLKFPFIP 61
Query: 1088 VSDTCGIIEXXXXXXXXXXXXDRVVNHFLSHWMEGEAKSNEEQFSYGGPLNGGLAKYIIL 1267
VSD GI+ DRV +H + W++G+ KS+E+ + G ++GGL++Y++L
Sbjct: 62 VSDASGIVVEIGSKVTKFKKGDRVTSHMFTKWLDGKPKSDEQSHALGATVDGGLSEYMVL 121
Query: 1268 DENSCLIPPKHYTDEECSTLPIAACTAWYSLMNVGGIESKLKSNQTVLIQGTGGVSLFAL 1447
+EN+ + P+ TD + STLP+AA W+SL+ G I K+ VL+QGTGGVS+FA+
Sbjct: 122 NENAAVFSPETLTDNQSSTLPVAAFVNWFSLVEYGNI----KAGDKVLVQGTGGVSIFAI 177
Query: 1448 QISHSIGAKTILLTSNEEKKERLLKMGATHVINYKTHNEWEKEVMKLTNDQGVNHVLDVV 1627
QI+ ++GA+ I +S++EK E+ ++GA+ VINYKTH +WEKEV KLTN +GV H+++VV
Sbjct: 178 QIASALGAEVIATSSSDEKLEKAKELGASKVINYKTHPDWEKEVQKLTNGKGVEHIVEVV 237
Query: 1628 GGDYINRSIRCSHTHGHIYMIGFLKESNAKINLFDALFKRINLHGIGVSPKDSFQEMINQ 1807
GG I +SI GHIY+IGFL+ A +NLF L K+ + G+ + +F++ N+
Sbjct: 238 GGSSIAKSIDALAFQGHIYVIGFLENMEANVNLFALLAKQARIQGVNLGHHRAFED-FNK 296
Query: 1808 LSTNFIFKPVIDTIYDFDDSIKAFQHLSRGSFG 1906
PVIDT+Y FD + +A++H +G+FG
Sbjct: 297 ALDQINIDPVIDTVYSFDQAKEAYEHQMKGAFG 329
Score = 60.8 bits (146), Expect = 2e-07
Identities = 32/68 (47%), Positives = 46/68 (67%), Gaps = 1/68 (1%)
Frame = +3
Query: 411 AWRIHSFDGTYGMKMDEISVPHINDDQVLVKVSAVSLNYRDKAIMDGTYGIKFEK-GLIP 587
AW++ +F G +K E+ P I +DQ+L+KV++VSLNYRD AI++G Y + K IP
Sbjct: 3 AWQLENF-GLDNLKQVELEKPEIAEDQILIKVNSVSLNYRDTAIVEGIYTPELLKFPFIP 61
Query: 588 VSDTCGII 611
VSD GI+
Sbjct: 62 VSDASGIV 69
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,491,171,066
Number of extensions: 42300084
Number of successful extensions: 90204
Number of sequences better than 10.0: 3378
Number of HSP's gapped: 87921
Number of HSP's successfully gapped: 3566
Length of query: 659
Length of database: 1,051,180,864
Length adjustment: 135
Effective length of query: 524
Effective length of database: 614,245,399
Effective search space: 321864589076
Effective search space used: 321864589076
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|