| Homology vs DNA |
 Query= Contig-U00735-1 (Contig-U00735-1Q) /CSM_Contig/Contig-U00735-1Q.Seq.d
(666 letters)
Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ387196) Dictyostelium discoideum cDNA clone:dds12d19, 5' ... 1108 0.0 1
(BJ360099) Dictyostelium discoideum cDNA clone:ddc4c09, 5' e... 1080 0.0 1
(AU073399) Dictyostelium discoideum slug cDNA, clone SSH106. 476 e-130 1
(AU270745) Dictyostelium discoideum vegetative cDNA clone:VS... 149 2e-31 1
(AU270744) Dictyostelium discoideum vegetative cDNA clone:VS... 149 2e-31 1
(CP000923) Thermoanaerobacter sp. X514, complete genome. 76 2e-12 2
(AE013049) Thermoanaerobacter tengcongensis MB4, section 76 ... 52 3e-11 4
(ET632099) smoo_c_226 Solobacterium moorei W5408 genomic lib... 82 3e-11 1
(CP000924) Thermoanaerobacter pseudethanolicus ATCC 33223, c... 68 5e-07 1
(AF280689) Bacteroides fragilis isolate BFR 2393 glutamine s... 56 6e-07 3
(AF280688) Bacteroides fragilis isolate Tal2480 glutamine sy... 56 6e-07 3
(AF280679) Bacteroides fragilis isolate 1297 glutamine synth... 56 6e-07 3
(AF280656) Bacteroides fragilis isolate 1429 glutamine synth... 56 6e-07 3
(AF280650) Bacteroides fragilis isolate 28794 glutamine synt... 56 6e-07 3
(AF280644) Bacteroides fragilis isolate BFR81R glutamine syn... 56 6e-07 3
(AF280643) Bacteroides fragilis isolate BFR3392 glutamine sy... 56 6e-07 3
(AF280641) Bacteroides fragilis isolate Tal3636 glutamine sy... 56 6e-07 3
(AF280640) Bacteroides fragilis isolate BFR271R glutamine sy... 56 6e-07 3
(AF280638) Bacteroides fragilis isolate 127 glutamine synthe... 56 6e-07 3
(EK324728) 1095467003004 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-06 1
(EK306136) 1095462382226 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-06 1
(EK157726) 1095458012454 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-06 1
(CP001348) Clostridium cellulolyticum H10, complete genome. 66 2e-06 1
(BH153298) ENTSD82TF Entamoeba histolytica Sheared DNA Entam... 50 2e-06 2
(EJ737778) 1092961210553 Global-Ocean-Sampling_GS-30-02-01-1... 60 6e-06 2
(EJ741737) 1092962022921 Global-Ocean-Sampling_GS-30-02-01-1... 60 8e-06 2
(DQ010164) Ruminococcus albus 8 glutamine synthetase type II... 58 4e-04 1
(AF483911) Prevotella bryantii strain B14 type III glutamine... 58 4e-04 1
(U72362) Prevotella melaninogenica glutamine synthetase (gln... 50 0.031 2
(AF280697) Bacteroides fragilis isolate F70B glutamine synth... 34 0.067 3
(AF280696) Bacteroides fragilis isolate 136 glutamine synthe... 34 0.067 3
(AF280693) Bacteroides fragilis isolate 70 glutamine synthet... 34 0.067 3
(AF280687) Bacteroides fragilis isolate 135 glutamine synthe... 34 0.067 3
(AF280684) Bacteroides fragilis isolate 1475 glutamine synth... 34 0.067 3
(AF280682) Bacteroides fragilis isolate 126 glutamine synthe... 34 0.067 3
(AF280681) Bacteroides fragilis isolate D2187 glutamine synt... 34 0.067 3
(AF280680) Bacteroides fragilis isolate AN209 glutamine synt... 34 0.067 3
(AF280677) Bacteroides fragilis isolate F126A glutamine synt... 34 0.067 3
(AF280669) Bacteroides fragilis isolate GAI 20273 glutamine ... 34 0.067 3
(AF280666) Bacteroides fragilis isolate F70A glutamine synth... 34 0.067 3
(AF280662) Bacteroides fragilis isolate F59G glutamine synth... 34 0.067 3
(AF280661) Bacteroides fragilis isolate F59D glutamine synth... 34 0.067 3
(AF280660) Bacteroides fragilis isolate F126E glutamine synt... 34 0.067 3
(AF280659) Bacteroides fragilis isolate F126C glutamine synt... 34 0.067 3
(AF280655) Bacteroides fragilis isolate 1332 glutamine synth... 34 0.067 3
(AF280653) Bacteroides fragilis isolate 1208 glutamine synth... 34 0.067 3
(AF280652) Bacteroides fragilis isolate D3251 glutamine synt... 34 0.067 3
(AF280651) Bacteroides fragilis isolate 31959 glutamine synt... 34 0.067 3
(AF280648) Bacteroides fragilis isolate 93 glutamine synthet... 34 0.067 3
(AF280647) Bacteroides fragilis isolate 80 glutamine synthet... 34 0.067 3
(AF280645) Bacteroides fragilis isolate 59 glutamine synthet... 34 0.067 3
(AF280639) Bacteroides fragilis isolate 134 glutamine synthe... 34 0.067 3
(AZ529714) ENTCL86TR Entamoeba histolytica Sheared DNA Entam... 50 0.11 1
(AP010656) Candidatus Azobacteroides pseudotrichonymphae gen... 50 0.11 1
(AC079813) Homo sapiens chromosome 3 clone RP11-413E19, WORK... 34 0.25 2
(AC084358) Homo sapiens 12p BAC RP11-418C2 (Roswell Park Can... 34 0.25 2
(GN009435) Sequence 1876 from Patent EP2014669. 34 0.26 2
(U61375) Human cosmid LL12NC01-N-184C4, ETV6 gene, exons 4 a... 34 0.27 2
(AF231770) Homo sapiens ETV6/AML1 translocation breakpoint r... 34 0.28 2
(BX537720) Homo sapiens genomic DNA; cDNA DKFZp686O01244 (fr... 34 0.30 2
(AR448093) Sequence 761 from patent US 6673549. 34 0.32 2
(BI490961) df01g05.w1 Morton Fetal Cochlea Homo sapiens cDNA... 34 0.32 2
(AW019931) df01g05.y1 Morton Fetal Cochlea Homo sapiens cDNA... 34 0.32 2
(ER498070) 1093015355694 Global-Ocean-Sampling_GS-35-01-01-1... 48 0.43 1
(ER451892) 1092963853179 Global-Ocean-Sampling_GS-35-01-01-1... 48 0.43 1
(BB058799) Mus musculus 2 days neonate sympathetic ganglion ... 48 0.43 1
(AE001437) Clostridium acetobutylicum ATCC 824, complete gen... 48 0.43 1
(AC122667) Rattus norvegicus clone CH230-80G17, WORKING DRAF... 46 1.7 1
(AC115439) Rattus norvegicus clone CH230-184F24, *** SEQUENC... 46 1.7 1
(AC168620) Strongylocentrotus purpuratus clone R3-3046F10, W... 46 1.7 1
(EJ102966) 1091140874464 Global-Ocean-Sampling_GS-27-01-01-1... 36 3.0 2
(EU185098) Ovis aries clone INRA-164H8, complete sequence. 40 5.5 3
(CU463257) Zebrafish DNA sequence from clone CH73-274K11 in ... 44 6.7 1
(CR759741) Zebrafish DNA sequence from clone CH211-278A17 in... 44 6.7 1
(AL844567) Zebrafish DNA sequence from clone DKEY-77D17 in l... 44 6.7 1
(AL928873) Mouse DNA sequence from clone RP23-104C18 on chro... 44 6.7 1
(AC140243) Mus musculus BAC clone RP23-470F3 from 9, complet... 44 6.7 1
(CR382129) Yarrowia lipolytica strain CLIB122 chromosome C c... 44 6.7 1
(AC203480) Microcebus murinus clone CH257-202P9, WORKING DRA... 44 6.7 1
(AC193459) Zea mays chromosome 2 clone CH201-382F16; ZMMBBc0... 44 6.7 1
(AK086417) Mus musculus 15 days embryo head cDNA, RIKEN full... 44 6.7 1
(AK046940) Mus musculus 10 days neonate cerebellum cDNA, RIK... 44 6.7 1
(AK035923) Mus musculus 16 days neonate cerebellum cDNA, RIK... 44 6.7 1
(AK032655) Mus musculus 10 days neonate cerebellum cDNA, RIK... 44 6.7 1
(ED218121) AUAC-aav05h02.g1 Ascaris suum whole genome shotgu... 44 6.7 1
(ED173236) AUAC-aak33c09.b1 Ascaris suum whole genome shotgu... 44 6.7 1
(AV347868) Mus musculus adult male olfactory brain cDNA, RIK... 44 6.7 1
(DB872507) Lipochromis sp. 'matumbi hunter' cDNA clone:hm772... 44 6.7 1
(AL730376) Danio rerio embryonic inner ear subtracted cDNA l... 44 6.7 1
(AI592660) mt58d08.y1 Soares_thymus_2NbMT Mus musculus cDNA ... 44 6.7 1
(BP758692) Mus musculus mRNA, clone: mib14030, 3' end, expre... 44 6.7 1
(BP758057) Mus musculus mRNA, clone: mib07054, 3' end, expre... 44 6.7 1
(BG148484) uu79b10.y1 Soares_mouse_NMGB_bcell Mus musculus c... 44 6.7 1
(AA920511) vz26g02.r1 Soares_thymus_2NbMT Mus musculus cDNA ... 44 6.7 1
(BE944269) UI-M-BH3-avt-b-01-0-UI.s1 NIH_BMAP_M_S4 Mus muscu... 44 6.7 1
(BB623056) Mus musculus 10 days neonate cerebellum cDNA, RIK... 44 6.7 1
(BB126962) Mus musculus 16 days neonate cerebellum cDNA, RIK... 44 6.7 1
(AA276535) vc44g11.r1 Soares mouse 3NbMS Mus musculus cDNA c... 44 6.7 1
(AA184659) mt58d08.r1 Soares_thymus_2NbMT Mus musculus cDNA ... 44 6.7 1
(CU207366) Gramella forsetii KT0803 complete circular genome. 44 6.7 1
(CP000885) Clostridium phytofermentans ISDg, complete genome. 44 6.7 1
(CP000388) Pseudoalteromonas atlantica T6c, complete genome. 44 6.7 1
(CU633646) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 40 9.4 3
>(BJ387196) Dictyostelium discoideum cDNA clone:dds12d19, 5' end,
single read.
Length = 560
Score = 1108 bits (559), Expect = 0.0
Identities = 559/559 (100%)
Strand = Plus / Plus
Query: 108 gtcgtatcatttcatgtattcaagaggttgaatggaagatgtggagattaggcatgccat 167
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 gtcgtatcatttcatgtattcaagaggttgaatggaagatgtggagattaggcatgccat 60
Query: 168 tgaaaaccagacataatgaagtcgcaccaggtcaatatgaagtcgcaccaatctttgaac 227
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tgaaaaccagacataatgaagtcgcaccaggtcaatatgaagtcgcaccaatctttgaac 120
Query: 228 gtgctaatattgcagccgatcataatatgatgttgatggatattttaaagaatgtttcaa 287
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gtgctaatattgcagccgatcataatatgatgttgatggatattttaaagaatgtttcaa 180
Query: 288 ctaaacatggtttggtttgtcttttccatgagaaaccatttgctggtgtcaatggttctg 347
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ctaaacatggtttggtttgtcttttccatgagaaaccatttgctggtgtcaatggttctg 240
Query: 348 gtaaacataacaattggtccctttcaaccgatggtggtagtaatcttttggagccaggtc 407
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gtaaacataacaattggtccctttcaaccgatggtggtagtaatcttttggagccaggtc 300
Query: 408 atacaccatcacaaaatgcacgtttcattcttttccttacagcaattattagagcagtcg 467
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 atacaccatcacaaaatgcacgtttcattcttttccttacagcaattattagagcagtcg 360
Query: 468 atattcatgctgatcttcttcgtgcatcagtcgcagtaccaggtaatgagcatcgtttag 527
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 atattcatgctgatcttcttcgtgcatcagtcgcagtaccaggtaatgagcatcgtttag 420
Query: 528 gtgccaatgaagcaccaccagcaatcatttcaatctatctcggtaaggaacttgataccg 587
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 gtgccaatgaagcaccaccagcaatcatttcaatctatctcggtaaggaacttgataccg 480
Query: 588 tgattaacaatatcattaacaataccgatattcaagcaccaggttcagatgatatggatt 647
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tgattaacaatatcattaacaataccgatattcaagcaccaggttcagatgatatggatt 540
Query: 648 tgggtgtcgttgggttccc 666
|||||||||||||||||||
Sbjct: 541 tgggtgtcgttgggttccc 559
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 707,560,591
Number of extensions: 37499650
Number of successful extensions: 2778575
Number of sequences better than 10.0: 103
Length of query: 666
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 642
Effective length of database: 99,340,224,878
Effective search space: 63776424371676
Effective search space used: 63776424371676
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U00735-1 (Contig-U00735-1Q) /CSM_Contig/Contig-U00735-1Q.Seq.d
(666 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54WR9) RecName: Full=Type-3 glutamine synthetase; EC=... 439 e-122
CP001124_3048(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 281 1e-74
CP000568_195(CP000568|pid:none) Clostridium thermocellum ATCC 27... 280 4e-74
CP001114_1380(CP001114|pid:none) Deinococcus deserti VCD115, com... 276 3e-73
CP001071_1230(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 274 1e-72
CP000885_3336(CP000885|pid:none) Clostridium phytofermentans ISD... 273 3e-72
CP000568_1524(CP000568|pid:none) Clostridium thermocellum ATCC 2... 273 4e-72
CP000359_1193(CP000359|pid:none) Deinococcus geothermalis DSM 11... 271 1e-71
CP000252_3065(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 269 6e-71
CP001097_890(CP001097|pid:none) Chlorobium limicola DSM 245, com... 266 5e-70
CP000721_442(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 266 5e-70
CP001348_555(CP001348|pid:none) Clostridium cellulolyticum H10, ... 264 2e-69
CP000108_1564(CP000108|pid:none) Chlorobium chlorochromatii CaD3... 262 8e-69
CP000854_3495(CP000854|pid:none) Mycobacterium marinum M, comple... 262 8e-69
CP000511_3956(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 261 1e-68
CP001107_677(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 261 2e-68
AE000513_1989(AE000513|pid:none) Deinococcus radiodurans R1 chro... 261 2e-68
CP001110_1640(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 260 3e-68
CP001108_1475(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 259 5e-68
CT573071_568(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 258 8e-68
CP000096_1380(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 258 1e-67
AP011115_3675(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 258 1e-67
CP001101_909(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 258 1e-67
AP008957_3844(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 256 4e-67
CP001099_742(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 255 7e-67
CP000607_1213(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 254 2e-66
AE006470_1391(AE006470|pid:none) Chlorobium tepidum TLS, complet... 254 2e-66
CP000325_2300(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 253 5e-66
BA000022_1934(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 249 7e-65
A53371(A53371;S76251) glutamate-ammonia ligase (EC 6.3.1.2) type... 249 7e-65
AJ006703_1(AJ006703|pid:none) Pseudanabaena sp gene encoding for... 248 1e-64
CP000859_2266(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 247 2e-64
AP010904_1073(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 246 3e-64
AM778942_33(AM778942|pid:none) Microcystis aeruginosa PCC 7806 g... 246 4e-64
AP009552_904(AP009552|pid:none) Microcystis aeruginosa NIES-843 ... 246 6e-64
CT971583_1458(CT971583|pid:none) Synechococcus WH7803 complete g... 246 6e-64
CP000112_102(CP000112|pid:none) Desulfovibrio desulfuricans G20,... 246 6e-64
CP001344_3762(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 244 1e-63
AF251806_1(AF251806|pid:none) Synechococcus PCC7942 glutamine sy... 244 1e-63
CP000951_239(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 244 2e-63
CP000383_1710(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 243 4e-63
CP000388_4167(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 241 1e-62
CP000510_3297(CP000510|pid:none) Psychromonas ingrahamii 37, com... 240 2e-62
AE017285_1252(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 237 2e-61
AM398681_531(AM398681|pid:none) Flavobacterium psychrophilum JIP... 236 6e-61
CP000685_2334(CP000685|pid:none) Flavobacterium johnsoniae UW101... 235 8e-61
(P15623) RecName: Full=Glutamine synthetase; Short=GS; ... 231 2e-59
AE015928_543(AE015928|pid:none) Bacteroides thetaiotaomicron VPI... 231 2e-59
A37191(A37191) glutamate-ammonia ligase (EC 6.3.1.2) - Bacteroid... 231 2e-59
CP001358_1573(CP001358|pid:none) Desulfovibrio desulfuricans sub... 229 4e-59
AP010656_521(AP010656|pid:none) Candidatus Azobacteroides pseudo... 229 7e-59
AF280641_1(AF280641|pid:none) Bacteroides fragilis isolate Tal36... 223 4e-57
AF280639_1(AF280639|pid:none) Bacteroides fragilis isolate 134 g... 222 9e-57
AF280638_1(AF280638|pid:none) Bacteroides fragilis isolate 127 g... 221 2e-56
AE015928_4337(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 219 7e-56
CP000140_3663(CP000140|pid:none) Parabacteroides distasonis ATCC... 215 8e-55
AP008971_992(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 203 4e-51
AB369922_1(AB369922|pid:none) Chaetoceros compressus dGSIII mRNA... 203 4e-51
CR954201_493(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 200 3e-50
CP001324_642(CP001324|pid:none) Micromonas sp. RCC299 chromosome... 198 1e-49
CP000581_516(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 197 3e-49
U72362_1(U72362|pid:none) Prevotella melaninogenica glutamine sy... 189 5e-47
AF251004_1(AF251004|pid:none) Dunaliella tertiolecta glutamine s... 158 1e-37
AF251001_1(AF251001|pid:none) Skeletonema costatum glutamine syn... 154 2e-36
AF251002_1(AF251002|pid:none) Thalassiosira pseudonana glutamine... 149 9e-35
AJ224996_2(AJ224996|pid:none) Lactobacillus rhamnosus glnR, glnA... 74 5e-12
FM177140_1815(FM177140|pid:none) Lactobacillus casei BL23 comple... 71 2e-11
CP000359_1194(CP000359|pid:none) Deinococcus geothermalis DSM 11... 70 7e-11
AM263198_1314(AM263198|pid:none) Listeria welshimeri serovar 6b ... 69 9e-11
AH1599(AH1599) glutamine synthetases homolog glnA [imported] - L... 69 9e-11
CR936503_1320(CR936503|pid:none) Lactobacillus sakei strain 23K ... 69 9e-11
CP000746_164(CP000746|pid:none) Actinobacillus succinogenes 130Z... 68 2e-10
AL935256_179(AL935256|pid:none) Lactobacillus plantarum strain W... 68 2e-10
AP007281_1135(AP007281|pid:none) Lactobacillus reuteri JCM 1112 ... 66 8e-10
DQ857764_1(DQ857764|pid:none) Lactobacillus reuteri glutamine sy... 66 8e-10
AP008230_4328(AP008230|pid:none) Desulfitobacterium hafniense Y5... 66 1e-09
AP006627_2171(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 66 1e-09
CP000232_1267(CP000232|pid:none) Moorella thermoacetica ATCC 390... 65 2e-09
CP001321_1478(CP001321|pid:none) Haemophilus parasuis SH0165, co... 65 2e-09
CP001087_4507(CP001087|pid:none) Desulfobacterium autotrophicum ... 65 2e-09
CP000687_1929(CP000687|pid:none) Actinobacillus pleuropneumoniae... 65 2e-09
CP001091_2029(CP001091|pid:none) Actinobacillus pleuropneumoniae... 65 2e-09
CP000569_1911(CP000569|pid:none) Actinobacillus pleuropneumoniae... 65 2e-09
(Q60182) RecName: Full=Glutamine synthetase; Short=GS; ... 64 3e-09
CP000771_254(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 64 3e-09
BA000004_2360(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 64 3e-09
CP000724_3271(CP000724|pid:none) Alkaliphilus metalliredigens QY... 64 3e-09
CP000141_686(CP000141|pid:none) Carboxydothermus hydrogenoforman... 64 4e-09
CP000817_1682(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 64 4e-09
AP009389_731(AP009389|pid:none) Pelotomaculum thermopropionicum ... 64 4e-09
AE017333_1894(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 64 4e-09
AE016827_262(AE016827|pid:none) Mannheimia succiniciproducens MB... 64 4e-09
CP000885_624(CP000885|pid:none) Clostridium phytofermentans ISDg... 64 5e-09
AE017285_3376(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 64 5e-09
(P43794) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 64 5e-09
(Q9CDL9) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 64 5e-09
AE009441_1784(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 64 5e-09
CP001034_937(CP001034|pid:none) Natranaerobius thermophilus JW/N... 63 7e-09
CP001615_408(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 63 7e-09
CP001638_1146(CP001638|pid:none) Geobacillus sp. WCH70, complete... 63 7e-09
AE009439_338(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 63 7e-09
AE016879_3512(AE016879|pid:none) Bacillus anthracis str. Ames, c... 63 7e-09
CP000485_3149(CP000485|pid:none) Bacillus thuringiensis str. Al ... 63 7e-09
(P19064) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 63 7e-09
CP000227_3397(CP000227|pid:none) Bacillus cereus Q1, complete ge... 63 7e-09
CP000232_1270(CP000232|pid:none) Moorella thermoacetica ATCC 390... 63 7e-09
CP000057_911(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 63 9e-09
CP001197_2080(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 63 9e-09
CP000764_2243(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 63 9e-09
CP000672_1291(CP000672|pid:none) Haemophilus influenzae PittGG, ... 63 9e-09
CP000422_689(CP000422|pid:none) Pediococcus pentosaceus ATCC 257... 63 9e-09
CP000414_655(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 62 1e-08
CP000930_2259(CP000930|pid:none) Heliobacterium modesticaldum Ic... 62 1e-08
CP000813_1619(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 62 1e-08
AP008955_3353(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 62 1e-08
CP000560_1641(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 62 2e-08
CP000682_1590(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 62 2e-08
CP000947_726(CP000947|pid:none) Haemophilus somnus 2336, complet... 62 2e-08
CP000436_424(CP000436|pid:none) Haemophilus somnus 129PT, comple... 62 2e-08
CP000903_3373(CP000903|pid:none) Bacillus weihenstephanensis KBA... 62 2e-08
CP001104_401(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 62 2e-08
CP000559_1251(CP000559|pid:none) Methanocorpusculum labreanum Z,... 62 2e-08
CP000102_230(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 61 3e-08
AE008384_964(AE008384|pid:none) Methanosarcina mazei strain Goe1... 61 3e-08
(Q9CLP2) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 61 3e-08
CP000774_955(CP000774|pid:none) Parvibaculum lavamentivorans DS-... 61 3e-08
BA000028_1651(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 60 4e-08
(Q9HH09) RecName: Full=Glutamine synthetase; Short=GS; ... 60 4e-08
CP001117_109(CP001117|pid:none) Deinococcus deserti VCD115 plasm... 60 4e-08
AP009351_1223(AP009351|pid:none) Staphylococcus aureus subsp. au... 60 6e-08
(Q5HPN2) RecName: Full=Glutamine synthetase; Short=GS; ... 60 6e-08
(P60890) RecName: Full=Glutamine synthetase; Short=GS; ... 60 6e-08
AE009948_1717(AE009948|pid:none) Streptococcus agalactiae 2603V/... 60 6e-08
(Q6GHC6) RecName: Full=Glutamine synthetase; Short=GS; ... 60 6e-08
AP006716_1600(AP006716|pid:none) Staphylococcus haemolyticus JCS... 60 6e-08
EU685105_3(EU685105|pid:none) Streptococcus salivarius predicted... 60 6e-08
DQ489736_1121(DQ489736|pid:none) Leuconostoc citreum KM20, compl... 60 6e-08
CP000504_143(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 60 8e-08
AP008934_1451(AP008934|pid:none) Staphylococcus saprophyticus su... 60 8e-08
CP000239_1290(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 60 8e-08
AL445067_263(AL445067|pid:none) Thermoplasma acidophilum complet... 60 8e-08
BA000023_1512(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 59 1e-07
CP000024_1675(CP000024|pid:none) Streptococcus thermophilus CNRZ... 59 1e-07
CP001337_414(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 59 1e-07
AY764257_2(AY764257|pid:none) Streptococcus thermophilus strain ... 59 1e-07
CP000023_1645(CP000023|pid:none) Streptococcus thermophilus LMG ... 59 1e-07
(P10656) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 59 1e-07
AE017261_533(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 59 1e-07
CP000879_1733(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 59 1e-07
CP000774_2702(CP000774|pid:none) Parvibaculum lavamentivorans DS... 59 1e-07
CP000721_4126(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 59 2e-07
CP001402_1751(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 59 2e-07
CP001185_1221(CP001185|pid:none) Thermosipho africanus TCF52B, c... 59 2e-07
CP000743_149(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 59 2e-07
CP000660_1059(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 59 2e-07
CP001399_1719(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 59 2e-07
DQ319904_1(DQ319904|pid:none) Clostridium beijerinckii strain NC... 59 2e-07
AP009389_733(AP009389|pid:none) Pelotomaculum thermopropionicum ... 59 2e-07
CP000360_3138(CP000360|pid:none) Acidobacteria bacterium Ellin34... 58 2e-07
AM946015_1586(AM946015|pid:none) Streptococcus uberis 0140J comp... 58 2e-07
AM167904_1927(AM167904|pid:none) Bordetella avium 197N complete ... 58 3e-07
CP000033_1410(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 58 3e-07
CP000820_1735(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 58 3e-07
CP000473_1875(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 58 3e-07
AE017198_1404(AE017198|pid:none) Lactobacillus johnsonii NCC 533... 58 3e-07
CP000240_2726(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 58 3e-07
(P23794) RecName: Full=Glutamine synthetase; Short=GS; ... 58 3e-07
CP000744_3722(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 58 3e-07
S11899(S11899) glutamate-ammonia ligase (EC 6.3.1.2) - Sulfolobu... 58 3e-07
CP000909_819(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 57 4e-07
CP001275_1502(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 57 4e-07
CP000875_4012(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 57 4e-07
CP001365_2343(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 57 4e-07
(P36205) RecName: Full=Glutamine synthetase; Short=GS; ... 57 5e-07
CP000716_969(CP000716|pid:none) Thermosipho melanesiensis BI429,... 57 5e-07
CP000099_651(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 57 5e-07
CP000780_1682(CP000780|pid:none) Candidatus Methanoregula boonei... 57 5e-07
CP000387_294(CP000387|pid:none) Streptococcus sanguinis SK36, co... 57 5e-07
CP000561_1586(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 57 6e-07
CP000725_213(CP000725|pid:none) Streptococcus gordonii str. Chal... 57 6e-07
CP000517_1209(CP000517|pid:none) Lactobacillus helveticus DPC 45... 57 6e-07
CP001634_286(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 57 6e-07
AJ249658_1(AJ249658|pid:none) Anabaena azollae glnA gene. 57 6e-07
AP010904_611(AP010904|pid:none) Desulfovibrio magneticus RS-1 DN... 57 6e-07
CP000450_1192(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 57 6e-07
CP000742_513(CP000742|pid:none) Methanococcus vannielii SB, comp... 57 6e-07
CP000804_2435(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 57 6e-07
CT573213_5054(CT573213|pid:none) Frankia alni str. ACN14A chromo... 57 6e-07
A82957(A82957) probable glutamine synthetase PA5522 [imported] -... 57 6e-07
CP000686_2645(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 56 8e-07
CP000412_1188(CP000412|pid:none) Lactobacillus delbrueckii subsp... 56 8e-07
CP000473_4774(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 56 8e-07
CP000249_3107(CP000249|pid:none) Frankia sp. CcI3, complete geno... 56 8e-07
CP000505_1078(CP000505|pid:none) Thermofilum pendens Hrk 5, comp... 56 8e-07
CP001337_2572(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 56 8e-07
CP001400_1591(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 56 8e-07
CP000377_1022(CP000377|pid:none) Silicibacter sp. TM1040, comple... 56 8e-07
CP000117_147(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 56 8e-07
AM180088_2728(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 56 8e-07
X00147_1(X00147|pid:none) Anabaena glnA gene encoding glutamine-... 56 8e-07
AE008692_493(AE008692|pid:none) Zymomonas mobilis subsp. mobilis... 56 8e-07
AE004091_1568(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 56 8e-07
CP000702_1770(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 56 1e-06
FM210539_1(FM210539|pid:none) Haloferax mediterranei glnA gene f... 56 1e-06
CP000232_1724(CP000232|pid:none) Moorella thermoacetica ATCC 390... 56 1e-06
AP009384_1499(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 56 1e-06
BX640415_270(BX640415|pid:none) Bordetella pertussis strain Toha... 56 1e-06
CP000918_533(CP000918|pid:none) Streptococcus pneumoniae 70585, ... 56 1e-06
CP000780_1938(CP000780|pid:none) Candidatus Methanoregula boonei... 56 1e-06
CP000749_3484(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 56 1e-06
CP000920_486(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 56 1e-06
BA000045_1052(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 55 1e-06
CP000867_1453(CP000867|pid:none) Methanococcus maripaludis C6, c... 55 1e-06
CP000264_1515(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 55 1e-06
CP000143_1751(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 55 2e-06
CP000089_3733(CP000089|pid:none) Dechloromonas aromatica RCB, co... 55 2e-06
CP001078_912(CP001078|pid:none) Clostridium botulinum E3 str. Al... 55 2e-06
CP000386_1110(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 55 2e-06
CP001154_1864(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 55 2e-06
CP001150_1485(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 55 2e-06
FM204884_1701(FM204884|pid:none) Streptococcus equi subsp. zooep... 55 2e-06
AE017126_1036(AE017126|pid:none) Prochlorococcus marinus subsp. ... 55 2e-06
CP000438_5845(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 55 2e-06
CP001129_267(CP001129|pid:none) Streptococcus equi subsp. zooepi... 55 2e-06
X60160_1(X60160|pid:none) T.maritima glnA gene for glutamine syn... 55 2e-06
CP000816_1220(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, c... 55 2e-06
BX842646_241(BX842646|pid:none) Bdellovibrio bacteriovorus compl... 55 2e-06
CP001338_2579(CP001338|pid:none) Candidatus Methanosphaerula pal... 55 2e-06
CP000878_1028(CP000878|pid:none) Prochlorococcus marinus str. MI... 55 2e-06
CP000744_6238(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 55 2e-06
CP000774_3226(CP000774|pid:none) Parvibaculum lavamentivorans DS... 55 2e-06
CP001098_2111(CP001098|pid:none) Halothermothrix orenii H 168, c... 54 3e-06
CP000159_372(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 54 3e-06
FM178379_2939(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 54 3e-06
CP000969_1803(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 54 3e-06
AJ311159_3(AJ311159|pid:none) Pseudomonas sp. KIE171 species iso... 54 3e-06
BX548175_729(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 54 4e-06
AM902716_2286(AM902716|pid:none) Bordetella petrii strain DSM 12... 54 4e-06
CP000260_1667(CP000260|pid:none) Streptococcus pyogenes MGAS1027... 54 4e-06
CP000680_4497(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 54 4e-06
CP000407_156(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 54 4e-06
CR936257_2178(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 54 4e-06
CP000724_1264(CP000724|pid:none) Alkaliphilus metalliredigens QY... 54 4e-06
AE004092_1446(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 54 4e-06
CT573071_1223(CT573071|pid:none) Kuenenia stuttgartiensis genome... 54 4e-06
CP000262_1654(CP000262|pid:none) Streptococcus pyogenes MGAS1075... 54 4e-06
AE009949_1603(AE009949|pid:none) Streptococcus pyogenes MGAS8232... 54 4e-06
AM114193_2136(AM114193|pid:none) Uncultured methanogenic archaeo... 54 4e-06
CP000609_383(CP000609|pid:none) Methanococcus maripaludis C5, co... 54 4e-06
CP000250_1133(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 54 5e-06
CP000667_3288(CP000667|pid:none) Salinispora tropica CNB-440, co... 54 5e-06
T45145(T45145) glutamate-ammonia ligase (EC 6.3.1.2) [imported] ... 54 5e-06
AJ965256_876(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 54 5e-06
AE015451_4486(AE015451|pid:none) Pseudomonas putida KT2440 compl... 54 5e-06
(Q9HNI2) RecName: Full=Glutamine synthetase; Short=GS; ... 54 5e-06
CP000821_292(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 54 5e-06
CP000009_1071(CP000009|pid:none) Gluconobacter oxydans 621H, com... 54 5e-06
CP000027_1083(CP000027|pid:none) Dehalococcoides ethenogenes 195... 54 5e-06
CP000949_3817(CP000949|pid:none) Pseudomonas putida W619, comple... 54 5e-06
CP000688_940(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 54 5e-06
CP000542_3092(CP000542|pid:none) Verminephrobacter eiseniae EF01... 54 5e-06
(P43386) RecName: Full=Glutamine synthetase; Short=GS; ... 54 5e-06
AE009442_978(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 54 5e-06
CP000781_879(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 54 5e-06
(P43518) RecName: Full=Glutamine synthetase; Short=GS; ... 54 5e-06
AB038390_1(AB038390|pid:none) Shewanella benthica glnA gene for ... 53 7e-06
CP000852_1735(CP000852|pid:none) Caldivirga maquilingensis IC-16... 53 7e-06
CP000781_2320(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 53 7e-06
CP000377_1836(CP000377|pid:none) Silicibacter sp. TM1040, comple... 53 7e-06
CP000393_3347(CP000393|pid:none) Trichodesmium erythraeum IMS101... 53 7e-06
AF169960_1(AF169960|pid:none) Trichodesmium sp. IMS101 glutamine... 53 7e-06
CP000745_449(CP000745|pid:none) Methanococcus maripaludis C7, co... 53 7e-06
CP000552_1002(CP000552|pid:none) Prochlorococcus marinus str. MI... 53 7e-06
CP000908_2343(CP000908|pid:none) Methylobacterium extorquens PA1... 53 7e-06
CP000481_916(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 53 7e-06
CP000388_1018(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 53 7e-06
CP001029_2299(CP001029|pid:none) Methylobacterium populi BJ001, ... 53 7e-06
CP001147_1622(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 53 7e-06
CP001001_5057(CP001001|pid:none) Methylobacterium radiotolerans ... 53 7e-06
CP000031_2245(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 53 9e-06
AF027611_1(AF027611|pid:none) Synechococcus WH8103 glutamine syn... 53 9e-06
CP000554_1630(CP000554|pid:none) Prochlorococcus marinus str. MI... 53 9e-06
(P33035) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 53 9e-06
CP001251_168(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 53 9e-06
BX950851_27(BX950851|pid:none) Erwinia carotovora subsp. atrosep... 53 9e-06
CU468135_30(CU468135|pid:none) Erwinia tasmaniensis strain ET1/9... 53 9e-06
AE003849_1835(AE003849|pid:none) Xylella fastidiosa 9a5c, comple... 53 9e-06
CR555306_2333(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 53 9e-06
AM743169_142(AM743169|pid:none) Stenotrophomonas maltophilia K27... 53 9e-06
CP001111_109(CP001111|pid:none) Stenotrophomonas maltophilia R55... 53 9e-06
CP001337_1739(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 53 9e-06
AY144623_1(AY144623|pid:none) Pantoea agglomerans glutamine synt... 53 9e-06
AP009389_909(AP009389|pid:none) Pelotomaculum thermopropionicum ... 53 9e-06
CP000553_768(CP000553|pid:none) Prochlorococcus marinus str. NAT... 53 9e-06
CP000095_755(CP000095|pid:none) Prochlorococcus marinus str. NAT... 53 9e-06
A47050(A47050;S23852) glutamate-ammonia ligase (EC 6.3.1.2) - Sy... 52 1e-05
AM778957_118(AM778957|pid:none) Microcystis aeruginosa PCC 7806 ... 52 1e-05
CP000968_962(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 52 1e-05
CP001344_1613(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 52 1e-05
CP000116_2503(CP000116|pid:none) Thiobacillus denitrificans ATCC... 52 1e-05
AP009044_2132(AP009044|pid:none) Corynebacterium glutamicum R DN... 52 1e-05
CP001349_7095(CP001349|pid:none) Methylobacterium nodulans ORS 2... 52 1e-05
BA000035_2102(BA000035|pid:none) Corynebacterium efficiens YS-31... 52 1e-05
(P28605) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 52 1e-05
CT573326_3678(CT573326|pid:none) Pseudomonas entomophila str. L4... 52 1e-05
(P28786) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 52 2e-05
GM954332_1(GM954332|pid:none) Sequence 1286 from Patent WO200814... 52 2e-05
AM942759_2858(AM942759|pid:none) Proteus mirabilis strain HI4320... 52 2e-05
CP000110_1178(CP000110|pid:none) Synechococcus sp. CC9605, compl... 52 2e-05
CP000094_2142(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 52 2e-05
AP008955_4925(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 52 2e-05
BA000035_2125(BA000035|pid:none) Corynebacterium efficiens YS-31... 52 2e-05
CP000302_3432(CP000302|pid:none) Shewanella denitrificans OS217,... 52 2e-05
CP000076_2428(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 52 2e-05
CP001503_2365(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 52 2e-05
CP000606_3547(CP000606|pid:none) Shewanella loihica PV-4, comple... 52 2e-05
AJ936968_1(AJ936968|pid:none) Xanthomonas arboricola pv. pruni p... 52 2e-05
CP001213_782(CP001213|pid:none) Bifidobacterium animalis subsp. ... 52 2e-05
CR378674_89(CR378674|pid:none) Photobacterium profundum SS9; seg... 52 2e-05
CR936257_38(CR936257|pid:none) Natronomonas pharaonis DSM 2160 c... 52 2e-05
CP000097_1255(CP000097|pid:none) Synechococcus sp. CC9902, compl... 52 2e-05
AE008922_185(AE008922|pid:none) Xanthomonas campestris pv. campe... 52 2e-05
CP000094_344(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 52 2e-05
CP000859_2267(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 52 2e-05
AP009178_1519(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 52 2e-05
AM920689_208(AM920689|pid:none) Xanthomonas campestris pv. campe... 52 2e-05
CP000477_243(CP000477|pid:none) Methanosaeta thermophila PT, com... 52 2e-05
CP000088_986(CP000088|pid:none) Thermobifida fusca YX, complete ... 51 3e-05
CP000783_3920(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 51 3e-05
BA000004_3867(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 51 3e-05
AY741198_15(AY741198|pid:none) Uncultured archaeon GZfos23H7 clo... 51 3e-05
CP000153_1881(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 51 3e-05
M13746_1(M13746|pid:none) E.coli glnA gene encoding glutamine sy... 51 3e-05
CP001392_1097(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 51 3e-05
CP000850_3448(CP000850|pid:none) Salinispora arenicola CNS-205, ... 51 3e-05
CP000539_1165(CP000539|pid:none) Acidovorax sp. JS42, complete g... 51 3e-05
AM260479_2279(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 51 3e-05
CP000269_1078(CP000269|pid:none) Janthinobacterium sp. Marseille... 51 3e-05
CP000503_264(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 51 3e-05
AE014299_4290(AE014299|pid:none) Shewanella oneidensis MR-1, com... 51 3e-05
CP000469_298(CP000469|pid:none) Shewanella sp. ANA-3, complete g... 51 3e-05
CP000961_4592(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 51 3e-05
FM253131_1(FM253131|pid:none) Bradyrhizobium betae partial glnA ... 51 3e-05
AP009153_202(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 51 3e-05
CP000444_3693(CP000444|pid:none) Shewanella sp. MR-7, complete g... 51 3e-05
CP000880_3509(CP000880|pid:none) Salmonella enterica subsp. ariz... 51 3e-05
AE004091_297(AE004091|pid:none) Pseudomonas aeruginosa PAO1, com... 51 3e-05
CP000931_353(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 51 3e-05
NRL(2GLSA) glutamate--ammonia ligase (EC 6.3.1.2), chain A - Sal... 51 3e-05
CP000647_4133(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 51 3e-05
CP000252_3051(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 51 3e-05
AM933173_3298(AM933173|pid:none) Salmonella enterica subsp. ente... 51 3e-05
AF072440_2(AF072440|pid:none) Enterobacter gergoviae GTPase (bip... 51 3e-05
CP000744_386(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp... 51 3e-05
CP000267_2928(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 51 3e-05
(P0A1P6) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 51 3e-05
GM954251_1(GM954251|pid:none) Sequence 1205 from Patent WO200814... 51 3e-05
AP006725_27(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044 ... 51 3e-05
(P15106) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 51 3e-05
AM942444_1255(AM942444|pid:none) Corynebacterium urealyticum DSM... 51 3e-05
EU016562_11(EU016562|pid:none) Uncultured marine microorganism H... 51 3e-05
CP000653_4060(CP000653|pid:none) Enterobacter sp. 638, complete ... 50 5e-05
CP000300_1830(CP000300|pid:none) Methanococcoides burtonii DSM 6... 50 5e-05
CP001052_2557(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 50 5e-05
AE016795_847(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 50 5e-05
CP000932_962(CP000932|pid:none) Campylobacter lari RM2100, compl... 50 5e-05
AP009384_3648(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 50 5e-05
CP000352_2055(CP000352|pid:none) Ralstonia metallidurans CH34, c... 50 5e-05
CU928162_4444(CU928162|pid:none) Escherichia coli ED1a chromosom... 50 5e-05
AP008232_2230(AP008232|pid:none) Sodalis glossinidius str. 'mors... 50 5e-05
U61271_1(U61271|pid:none) Streptococcus agalactiae glutamine syn... 50 5e-05
AF440524_15(AF440524|pid:none) Pseudomonas aeruginosa strain SG1... 50 5e-05
CP000511_2875(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 50 5e-05
CP001600_3720(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 50 5e-05
CP000440_2178(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 50 6e-05
AM270336_65(AM270336|pid:none) Aspergillus niger contig An15c009... 50 6e-05
CP001344_83(CP001344|pid:none) Cyanothece sp. PCC 7425, complete... 50 6e-05
CP000507_3406(CP000507|pid:none) Shewanella amazonensis SB2B, co... 50 6e-05
AK066867_1(AK066867|pid:none) Oryza sativa Japonica Group cDNA c... 50 6e-05
CP000090_2039(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 50 6e-05
AM286415_27(AM286415|pid:none) Yersinia enterocolitica subsp. en... 50 6e-05
AY714853_28(AY714853|pid:none) Uncultured archaeon GZfos31B6 clo... 50 6e-05
BX571859_237(BX571859|pid:none) Photorhabdus luminescens subsp. ... 50 6e-05
CP000380_440(CP000380|pid:none) Burkholderia cenocepacia AU 1054... 50 6e-05
AF182395_1(AF182395|pid:none) Xanthomonas citri glnAB operon gen... 50 6e-05
CU695240_419(CU695240|pid:none) Ralstonia solanacearum strain Mo... 50 6e-05
CP000781_4658(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 50 6e-05
CP000563_302(CP000563|pid:none) Shewanella baltica OS155, comple... 50 6e-05
CT573326_352(CT573326|pid:none) Pseudomonas entomophila str. L48... 50 6e-05
AP009256_1123(AP009256|pid:none) Bifidobacterium adolescentis AT... 50 6e-05
FJ899553_1(FJ899553|pid:none) Yersinia enterocolitica strain C64... 50 6e-05
AM747720_2220(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 50 6e-05
AF013513_1(AF013513|pid:none) Vibrio cholerae glutamine syntheta... 50 6e-05
CP000100_2154(CP000100|pid:none) Synechococcus elongatus PCC 794... 50 6e-05
AE008923_204(AE008923|pid:none) Xanthomonas axonopodis pv. citri... 50 6e-05
CP001146_169(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 50 6e-05
CP000447_325(CP000447|pid:none) Shewanella frigidimarina NCIMB 4... 50 6e-05
AP011115_884(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl... 50 6e-05
CP000431_1148(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 50 6e-05
CP001068_1067(CP001068|pid:none) Ralstonia pickettii 12J chromos... 50 8e-05
AY835457_1(AY835457|pid:none) Saccharum officinarum glutamine sy... 50 8e-05
CP000806_4428(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 50 8e-05
AP007255_696(AP007255|pid:none) Magnetospirillum magneticum AMB-... 50 8e-05
CP000680_4112(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 50 8e-05
CP000529_2755(CP000529|pid:none) Polaromonas naphthalenivorans C... 50 8e-05
EU016573_21(EU016573|pid:none) Uncultured marine microorganism H... 50 8e-05
AM181176_1475(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 50 8e-05
AM920689_1847(AM920689|pid:none) Xanthomonas campestris pv. camp... 50 8e-05
AL646052_1259(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 50 8e-05
CP000050_1737(CP000050|pid:none) Xanthomonas campestris pv. camp... 50 8e-05
AE008922_2307(AE008922|pid:none) Xanthomonas campestris pv. camp... 50 8e-05
CP000698_2193(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 50 8e-05
CP001103_1575(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 50 8e-05
CU633749_1830(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 50 8e-05
T42066(T42066) glutamate-ammonia ligase (EC 6.3.1.2) - Streptomy... 50 8e-05
CR954246_156(CR954246|pid:none) Pseudoalteromonas haloplanktis s... 50 8e-05
CP000826_4863(CP000826|pid:none) Serratia proteamaculans 568, co... 50 8e-05
CP000304_351(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 50 8e-05
CU234118_3984(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 50 8e-05
CP000493_1148(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 49 1e-04
BA000023_170(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 49 1e-04
CP000284_2441(CP000284|pid:none) Methylobacillus flagellatus KT,... 49 1e-04
AM260480_609(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 49 1e-04
A72521(A72521)probable glutamine synthetase APE2142 - Aeropyrum ... 49 1e-04
AE009952_3753(AE009952|pid:none) Yersinia pestis KIM, complete g... 49 1e-04
CP000975_1198(CP000975|pid:none) Methylacidiphilum infernorum V4... 49 1e-04
AP009179_353(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic D... 49 1e-04
AE017042_25(AE017042|pid:none) Yersinia pestis biovar Microtus s... 49 1e-04
CP000240_980(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 49 1e-04
AP007150_468(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 49 1e-04
BA000002_1396(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple... 49 1e-04
CP000076_378(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 49 1e-04
CP000812_2039(CP000812|pid:none) Thermotoga lettingae TMO, compl... 49 1e-04
BA000012_3965(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 49 1e-04
AL939111_277(AL939111|pid:none) Streptomyces coelicolor A3(2) co... 49 1e-04
CP000750_3263(CP000750|pid:none) Kineococcus radiotolerans SRS30... 49 1e-04
CP000494_4305(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 49 1e-04
CP000323_1435(CP000323|pid:none) Psychrobacter cryohalolentis K5... 49 1e-04
AB499894_2(AB499894|pid:none) Pseudomonas syringae tp, gs, vioA,... 49 1e-04
(P22248) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 49 2e-04
CP001013_3559(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 49 2e-04
AX503498_1(AX503498|pid:none) Sequence 1 from Patent EP1229121. ... 49 2e-04
AE016958_1962(AE016958|pid:none) Mycobacterium avium subsp. para... 49 2e-04
AB037422_1(AB037422|pid:none) Pseudomonas syringae pv. tabaci ps... 49 2e-04
EF577442_1(EF577442|pid:none) Rhizobium giardinii bv. giardinii ... 49 2e-04
AX764199_1(AX764199|pid:none) Sequence 11 from Patent WO03040681. 49 2e-04
CU207211_886(CU207211|pid:none) Herminiimonas arsenicoxydans chr... 49 2e-04
AM849034_1601(AM849034|pid:none) Clavibacter michiganensis subsp... 49 2e-04
CP000075_4816(CP000075|pid:none) Pseudomonas syringae pv. syring... 48 2e-04
BA000030_6012(BA000030|pid:none) Streptomyces avermitilis MA-468... 48 2e-04
AM181176_5725(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 48 2e-04
CP000716_1597(CP000716|pid:none) Thermosipho melanesiensis BI429... 48 2e-04
(P51120) RecName: Full=Glutamine synthetase; EC=6.3.1.2... 48 2e-04
AP009389_728(AP009389|pid:none) Pelotomaculum thermopropionicum ... 48 2e-04
CP000686_2904(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 48 2e-04
EU408356_15(EU408356|pid:none) Uncultured bacterium BLR7 genomic... 48 2e-04
AM746676_7223(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 48 2e-04
AE016853_345(AE016853|pid:none) Pseudomonas syringae pv. tomato ... 48 2e-04
AF082873_1(AF082873|pid:none) Herbaspirillum seropedicae glnAntr... 48 2e-04
CP000494_1833(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 48 2e-04
AM260525_1294(AM260525|pid:none) Bartonella tribocorum CIP 10547... 48 2e-04
CP000804_1852(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 48 2e-04
CP000462_258(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 48 2e-04
CP000769_4358(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 48 2e-04
CP001634_1701(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 48 2e-04
CP001280_2573(CP001280|pid:none) Methylocella silvestris BL2, co... 48 2e-04
CP000076_5837(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 48 3e-04
AM182976_1(AM182976|pid:none) Bradyrhizobium elkanii partial gln... 48 3e-04
AP011115_893(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl... 48 3e-04
CP001635_1620(CP001635|pid:none) Variovorax paradoxus S110 chrom... 48 3e-04
AE010300_1312(AE010300|pid:none) Leptospira interrogans serovar ... 48 3e-04
AE017283_655(AE017283|pid:none) Propionibacterium acnes KPA17120... 48 3e-04
CR931997_675(CR931997|pid:none) Corynebacterium jeikeium K411 co... 48 3e-04
AE016822_767(AE016822|pid:none) Leifsonia xyli subsp. xyli str. ... 48 3e-04
CP001010_598(CP001010|pid:none) Polynucleobacter necessarius sub... 48 3e-04
CP001616_458(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 48 3e-04
AM849034_1603(AM849034|pid:none) Clavibacter michiganensis subsp... 48 3e-04
CP001601_1732(CP001601|pid:none) Corynebacterium aurimucosum ATC... 48 3e-04
BX842631_21(BX842631|pid:none) Neurospora crassa DNA linkage gro... 48 3e-04
AE017180_1824(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 48 3e-04
CP000926_1772(CP000926|pid:none) Pseudomonas putida GB-1, comple... 48 3e-04
CP000058_4677(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 48 3e-04
AF027612_1(AF027612|pid:none) Synechococcus WH5701 glutamine syn... 47 4e-04
DQ020036_1(DQ020036|pid:none) Nostoc sp. PCC 7906 glutamine synt... 47 4e-04
CP000158_2047(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 47 4e-04
AP009247_439(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 47 4e-04
CP001089_1857(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 47 4e-04
CP001390_2958(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 47 4e-04
CP000094_5403(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 47 4e-04
EU864034_5(EU864034|pid:none) Azospirillum brasilense histone ac... 47 4e-04
CP000814_664(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 47 4e-04
CP000248_2596(CP000248|pid:none) Novosphingobium aromaticivorans... 47 4e-04
FM209186_3282(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 47 4e-04
CP000509_2250(CP000509|pid:none) Nocardioides sp. JS614, complet... 47 4e-04
CP001124_3046(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 47 4e-04
CP000655_1247(CP000655|pid:none) Polynucleobacter necessarius su... 47 4e-04
AE016958_1966(AE016958|pid:none) Mycobacterium avium subsp. para... 47 4e-04
A83391(A83391) probable glutamine synthetase PA2040 [imported] -... 47 4e-04
AM420293_1578(AM420293|pid:none) Saccharopolyspora erythraea NRR... 47 4e-04
AF323964_2(AF323964|pid:none) Azospirillum brasilense PII protei... 47 4e-04
>(Q54WR9) RecName: Full=Type-3 glutamine synthetase;
EC=6.3.1.2; AltName: Full=Type-3 glutamate--ammonia
ligase; Short=Type-3 GS;
Length = 735
Score = 439 bits (1129), Expect = e-122
Identities = 214/221 (96%), Positives = 214/221 (96%)
Frame = +2
Query: 2 FYLARPDLVNCGRTLIGAKPPKGQEMEDHYFGTMNSRIISCIQEVEWKMWRLGMPLKTRH 181
FYLARPDLVNCGRTLIGAKPPKGQEMEDHYFGTMNSRIISCIQEVEWKMWRLGMPLKTRH
Sbjct: 235 FYLARPDLVNCGRTLIGAKPPKGQEMEDHYFGTMNSRIISCIQEVEWKMWRLGMPLKTRH 294
Query: 182 NEVAPGQYEVAPIFERANIAADHNMMLMDILKNVSTKHGLVCLFHEKPFAGVNGSGKHNN 361
NEVAPGQYEVAPIFERANIAADHNMMLMDILKNVSTKHGLVCLFHEKPFAGVNGSGKHNN
Sbjct: 295 NEVAPGQYEVAPIFERANIAADHNMMLMDILKNVSTKHGLVCLFHEKPFAGVNGSGKHNN 354
Query: 362 WSLSTDGGSNLLEPGHTPSQNARFILFLTAIIRAVDIHADLLRASVAVPGNEHRLGANEA 541
WSLSTDGGSNLLEPGHTPSQNARFILFLTAIIRAVDIHADLLRASVAVPGNEHRLGANEA
Sbjct: 355 WSLSTDGGSNLLEPGHTPSQNARFILFLTAIIRAVDIHADLLRASVAVPGNEHRLGANEA 414
Query: 542 PPAIISIYLGKELDTVXXXXXXXTDIQAPGSDDMDLGVVGF 664
PPAIISIYLGKELDTV TDIQAPGSDDMDLGVVGF
Sbjct: 415 PPAIISIYLGKELDTVINNIINNTDIQAPGSDDMDLGVVGF 455
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,235,637,185
Number of extensions: 26508944
Number of successful extensions: 57820
Number of sequences better than 10.0: 1191
Number of HSP's gapped: 57686
Number of HSP's successfully gapped: 1191
Length of query: 222
Length of database: 1,051,180,864
Length adjustment: 124
Effective length of query: 98
Effective length of database: 649,847,548
Effective search space: 63685059704
Effective search space used: 63685059704
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
|