Contig-U15843-1 |
Contig ID |
Contig-U15843-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
gap included |
Contig length |
2248 |
Chromosome number (1..6, M) |
3 |
Chromosome length |
6358359 |
Start point |
2972365 |
End point |
2973924 |
Strand (PLUS/MINUS) |
PLUS |
Number of clones |
15 |
Number of EST |
27 |
Link to clone list |
U15843 |
List of clone(s) |
est1=CFF337F,1,606 est2=CFF608F,1,546 est3=CFG208F,2,575 est4=CFJ163F,2,603 est5=CFJ263F,2,523 est6=SFD801F,2,545 est7=SFJ278F,2,540 est8=VFA512F,2,616 est9=VFF165F,2,598 est10=VFJ861F,2,542 est11=VFK845F,2,542 est12=CFI626F,13,614 est13=AFH283E,45,1538 est14=VFJ861Z,784,1502 est15=CFI626Z,836,1540 est16=VFA512Z,837,1449 est17=CFF337Z,847,1507 est18=CFJ263Z,848,1539 est19=CFJ163Z,849,1540 est20=VFF165Z,849,1538 est21=SFD801Z,850,1532 est22=VFK845Z,852,1537 est23=CFG208Z,891,1503 est24=SFJ278Z,904,1489 est25=VSE108Z,975,1559 est26=VSC131Z,988,1559 est27=CFF608Z,1561,2248
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 2.21 |
Homology vs DNA |
Query= Contig-U15843-1 (Contig-U15843-1Q) /CSM_Contig/Contig-U15843-1Q.Seq.d (2258 letters)
Database: ddbj_B 98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(X07560) Dictyostelium discoideum DdPYR5-6 gene for UMP synt... 1524 0.0 2 (BJ372337) Dictyostelium discoideum cDNA clone:ddc12o02, 3' ... 1253 0.0 1 (BJ375703) Dictyostelium discoideum cDNA clone:ddc19m15, 3' ... 1245 0.0 1 (BJ343008) Dictyostelium discoideum cDNA clone:dda15e22, 3' ... 1176 0.0 1 (BJ433602) Dictyostelium discoideum cDNA clone:ddv22j12, 3' ... 1162 0.0 2 (BJ372123) Dictyostelium discoideum cDNA clone:ddc11j09, 3' ... 1162 0.0 2 (BJ428314) Dictyostelium discoideum cDNA clone:ddv11a17, 3' ... 1154 0.0 2 (BJ399907) Dictyostelium discoideum cDNA clone:dds8b02, 3' e... 1154 0.0 2 (BJ375704) Dictyostelium discoideum cDNA clone:ddc19m16, 3' ... 1154 0.0 2 (BJ375315) Dictyostelium discoideum cDNA clone:ddc18c08, 3' ... 1154 0.0 2 (BJ433049) Dictyostelium discoideum cDNA clone:ddv20j16, 3' ... 1049 0.0 4 (BJ429015) Dictyostelium discoideum cDNA clone:ddv2g03, 3' e... 1043 0.0 2 (BJ372573) Dictyostelium discoideum cDNA clone:ddc13o02, 3' ... 1005 0.0 3 (AU262874) Dictyostelium discoideum vegetative cDNA clone:VS... 1007 0.0 1 (BJ326220) Dictyostelium discoideum cDNA clone:dda15e22, 5' ... 1003 0.0 1 (AU262353) Dictyostelium discoideum vegetative cDNA clone:VS... 981 0.0 1 (BJ410843) Dictyostelium discoideum cDNA clone:ddv2g03, 5' e... 963 0.0 2 (BJ358786) Dictyostelium discoideum cDNA clone:ddc11j09, 5' ... 950 0.0 2 (BJ361680) Dictyostelium discoideum cDNA clone:ddc18c08, 5' ... 965 0.0 1 (BJ361995) Dictyostelium discoideum cDNA clone:ddc19m15, 5' ... 944 0.0 2 (BJ410168) Dictyostelium discoideum cDNA clone:ddv11a17, 5' ... 936 0.0 2 (BJ401935) Dictyostelium discoideum cDNA clone:dds19k20, 3' ... 914 0.0 1 (BJ359180) Dictyostelium discoideum cDNA clone:ddc13o02, 5' ... 888 0.0 2 (BJ358969) Dictyostelium discoideum cDNA clone:ddc12o02, 5' ... 831 0.0 2 (BJ415380) Dictyostelium discoideum cDNA clone:ddv22j12, 5' ... 825 0.0 2 (BJ388113) Dictyostelium discoideum cDNA clone:dds8b02, 5' e... 823 0.0 2 (BJ389736) Dictyostelium discoideum cDNA clone:dds19k20, 5' ... 821 0.0 2 (BJ414853) Dictyostelium discoideum cDNA clone:ddv20j16, 5' ... 819 0.0 2 (BJ361996) Dictyostelium discoideum cDNA clone:ddc19m16, 5' ... 739 0.0 3 (EU288194) Candida tropicalis orotidine-5'-phosphate decarbo... 54 4e-12 4 (EU288195) Candida tropicalis microsatellite URA3 sequence; ... 54 4e-12 4 (AZ930397) 474.dhz53g07.s1 Saccharomyces unisporus NRRL Y-15... 66 1e-11 4 (AF040702) Candida tropicalis orotidine-5'-phosphate decarbo... 54 2e-11 4 (AY623794) Candida glycerinogenes orotidine-5'-monophosphate... 78 2e-10 3 (Y09221) P.anomala URA3 gene. 62 1e-09 5 (AU270687) Dictyostelium discoideum vegetative cDNA clone:VS... 78 2e-09 1 (AF109400) Candida albicans orotidine-5'-monophosphate decar... 52 1e-08 4 (GE633999) LINN_XX_012_K19_LINN12.CR_K19 R. communis develop... 64 2e-08 2 (M86236) Candida boidinii orotidine-5'-phosphate decarboxyla... 68 4e-08 3 (EU636775) Debaryomyces polymorphus strain VKPM Y2524 GEA2p-... 50 1e-07 2 (AF279259) Zygosaccharomyces bailii orotidine-5'-phosphate d... 58 3e-07 2 (X14198) Candida albicans URA3 gene for orotidine-5'-monopho... 52 6e-07 2 (DI088747) Recombinant vector series efficient for research ... 52 6e-07 2 (AB072914) Expression vector pMFXU4 DNA, complete sequence. 68 6e-07 3 (DQ015899) Synthetic construct loxP-URA3-loxP disruption cas... 52 7e-07 2 (AY656808) Cloning vector pGT-GFP-URA3-14, partial sequence. 52 9e-07 2 (EG658180) RCLEQ42TP Castor bean cDNA library from leaves, 1... 64 1e-06 2 (DQ414693) Functional Analysis plasmid pFA-CaURA3, complete ... 52 1e-06 2 (FJ160464) Epitope tagging vector pFA-HA-URA3, complete sequ... 52 2e-06 2 (FJ160460) Epitope tagging vector pFA-MYC-URA3, complete seq... 52 2e-06 2 (DQ414696) Functional Analysis plasmid pFA-CaURA3-MAL2prom, ... 52 2e-06 2 (AF173954) Cloning vector pGEM-URA3, complete sequence. 52 2e-06 2 (DQ015896) Synthetic construct arg4::MET3-cre-URA3 cassette,... 52 2e-06 2 (U08629) Pichia stipitis CBS 6054 ATCC 58785 orotidine-5'-ph... 54 2e-06 3 (FJ160456) Epitope tagging vector pFA-TAP-CaURA3, complete s... 52 2e-06 2 (DQ414702) Functional Analysis plasmid pFA-GFP-CaURA3, compl... 52 2e-06 2 (DQ414699) Functional Analysis plasmid pFA-CaURA3-MET3prom, ... 52 2e-06 2 (AF181970) Integrating vector CIp10, complete sequence. 52 2e-06 2 (FJ160455) Epitope tagging vector pFA-lacZ-CaURA3, complete ... 52 2e-06 3 (DQ015894) Candida integrating vector CIp20, complete sequence. 52 2e-06 2 (EA012039) Sequence 21 from patent US 7125970. 52 3e-06 2 (EA012040) Sequence 22 from patent US 7125970. 52 3e-06 2 (AF173953) Cloning vector pDDB57 complete sequence. 52 3e-06 2 (DQ015895) Candida integrating vector CIp30, complete sequence. 52 3e-06 2 (EF667963) Expression vector pPZ3TA, complete sequence. 52 5e-06 2 (ER959449) CH260-110G21_T7 CHORI-260 Meleagris gallopavo gen... 64 2e-05 1 (EK291669) 1095462332513 Global-Ocean-Sampling_GS-31-01-01-1... 64 2e-05 1 (L13661) Candida glabrata orotidine-5'-phosphate decarboxyla... 62 9e-05 2 (CR380955) Candida glabrata strain CBS138 chromosome I compl... 62 1e-04 1 (AY771209) Candida glabrata genotype 32 orotidine 5'-phospha... 62 1e-04 1 (AY771207) Candida glabrata genotype 34 orotidine 5'-phospha... 62 1e-04 1 (AY771206) Candida glabrata genotype 30 orotidine 5'-phospha... 62 1e-04 1 (AY771205) Candida glabrata genotype 29 orotidine 5'-phospha... 62 1e-04 1 (AY771204) Candida glabrata genotype 28 orotidine 5'-phospha... 62 1e-04 1 (AY771203) Candida glabrata genotype 23 orotidine 5'-phospha... 62 1e-04 1 (AY771202) Candida glabrata genotype 16 orotidine 5'-phospha... 62 1e-04 1 (AY771201) Candida glabrata genotype 26 orotidine 5'-phospha... 62 1e-04 1 (AY771200) Candida glabrata genotype 25 orotidine 5'-phospha... 62 1e-04 1 (AY771199) Candida glabrata genotype 22 orotidine 5'-phospha... 62 1e-04 1 (AY771198) Candida glabrata genotype 20 orotidine 5'-phospha... 62 1e-04 1 (AY771197) Candida glabrata genotype 33 orotidine 5'-phospha... 62 1e-04 1 (AY771196) Candida glabrata genotype 3 orotidine 5'-phosphat... 62 1e-04 1 (AY771195) Candida glabrata genotype 4 orotidine 5'-phosphat... 62 1e-04 1 (AY771194) Candida glabrata genotype 31 orotidine 5'-phospha... 62 1e-04 1 (AY771193) Candida glabrata genotype 19 orotidine 5'-phospha... 62 1e-04 1 (AY771192) Candida glabrata genotype 12 orotidine 5'-phospha... 62 1e-04 1 (AY771191) Candida glabrata genotype 7 orotidine 5'-phosphat... 62 1e-04 1 (AY771190) Candida glabrata genotype 1 orotidine 5'-phosphat... 62 1e-04 1 (AY771189) Candida glabrata genotype 18 orotidine 5'-phospha... 62 1e-04 1 (AY771188) Candida glabrata genotype 36 orotidine 5'-phospha... 62 1e-04 1 (AY771187) Candida glabrata genotype 24 orotidine 5'-phospha... 62 1e-04 1 (AY771186) Candida glabrata genotype 21 orotidine 5'-phospha... 62 1e-04 1 (AY771185) Candida glabrata genotype 14 orotidine 5'-phospha... 62 1e-04 1 (AY771184) Candida glabrata genotype 10 orotidine 5'-phospha... 62 1e-04 1 (AY771183) Candida glabrata genotype 6 orotidine 5'-phosphat... 62 1e-04 1 (AY771182) Candida glabrata genotype 27 orotidine 5'-phospha... 62 1e-04 1 (AY771181) Candida glabrata genotype 17 orotidine 5'-phospha... 62 1e-04 1 (AY771180) Candida glabrata genotype 15 orotidine 5'-phospha... 62 1e-04 1 (AY771179) Candida glabrata genotype 13 orotidine 5'-phospha... 62 1e-04 1 (AY771178) Candida glabrata genotype 11 orotidine 5'-phospha... 62 1e-04 1 (AY771177) Candida glabrata genotype 8 orotidine 5'-phosphat... 62 1e-04 1 (AY771176) Candida glabrata genotype 2 orotidine 5'-phosphat... 62 1e-04 1 (BZ297157) CG3258.f1 Candida glabrata Random Genomic Library... 62 1e-04 1 (FC711540) CAXY6945.fwd CAXY Lottia gigantea from male gonad... 40 4e-04 2 (FC767810) CBBN4030.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 40 4e-04 2 (FC717451) CBBG11521.fwd CBBG Lottia gigantea 12,15,18h embr... 40 4e-04 2 (ER620507) 1093017399140 Global-Ocean-Sampling_GS-36-01-01-2... 60 4e-04 1 (AC117081) Dictyostelium discoideum chromosome 2 map 5862124... 46 8e-04 2 (AL408366) T3 end of clone AV0AA008A11 of library AV0AA from... 54 0.002 3 (DR413705) gPGC_EST03547 Embryonic gonadal PGC cDNA Library ... 56 0.006 1 (CJ978219) Bursaphelenchus mucronatus cDNA clone: Bm_U1_39A0... 56 0.006 1 (CV631885) Mdfrt3100p08.y1 Mdfrt Malus x domestica cDNA clon... 50 0.010 2 (CV151096) Mdst6005c19.y1 Mdst Malus x domestica cDNA clone ... 50 0.012 2 (CV150766) Mdst6010a15.y1 Mdst Malus x domestica cDNA clone ... 50 0.013 2 (DT580681) she01-17ms2-d07 She01 Saruma henryi cDNA clone sh... 48 0.015 2 (CV096789) FAMU_USDA_FP_4812 Vitis shuttleworthii L., grape ... 42 0.018 2 (CE809308) tigr-gss-dog-17000317870121 Dog Library Canis lup... 42 0.023 2 (AL395008) T7 end of clone AR0AA020H11 of library AR0AA from... 54 0.024 1 (CP000502) Pichia stipitis CBS 6054 chromosome 8, complete s... 54 0.024 1 (AY771208) Candida glabrata genotype 35 orotidine 5'-phospha... 54 0.024 1 (AM989984) Zygosaccharomyces rouxii strain CBS 732 Contig5. 54 0.024 1 (AJ302032) Candida dubliniensis URA3 gene for orotidine-5'-p... 44 0.034 2 (CR382133) Debaryomyces hansenii strain CBS767 chromosome A ... 52 0.093 1 (U32943) Schistocerca americana Antennapedia homeotic protei... 42 0.19 2 (AC197917) Zea mays chromosome 8 clone CH201-287E9; ZMMBBc02... 36 0.25 7 (AW802623) IL5-UM0073-220300-047-c09 UM0073 Homo sapiens cDN... 40 0.29 2 (ER555251) 1093016310577 Global-Ocean-Sampling_GS-35-01-01-1... 36 0.46 4 (AJ719322) Gallus gallus mRNA for hypothetical protein, clon... 48 0.49 2 (X95886) E.magnusii URA3 gene. 38 0.50 2 (EX784589) CAHC6237.fwd CAHC Laccaria bicolor Vegetative myc... 46 0.61 2 (EE197358) CC-F01_008_L11 Cherry of different development st... 42 0.65 2 (EX795327) CAHG4425.rev CAHG Laccaria bicolor Vegetative myc... 46 0.65 2 (AG431934) Mus musculus molossinus DNA, clone:MSMg01-307K01.... 40 0.69 2 (CB894784) EST647576 HOGA Medicago truncatula cDNA clone HOG... 38 0.73 2 (EX805936) CAPN1358.rev CAPN Laccaria bicolor Mycelium inter... 46 0.74 2 (EX795328) CAHG4425.fwd CAHG Laccaria bicolor Vegetative myc... 46 0.75 2 (EX805937) CAPN1358.fwd CAPN Laccaria bicolor Mycelium inter... 46 0.76 2 (DR083949) CAST017F11 cassava tuber Manihot esculenta cDNA c... 34 0.84 3 (AL276787) Tetraodon nigroviridis genome survey sequence T7 ... 40 0.93 2 (AL236169) Tetraodon nigroviridis genome survey sequence T7 ... 40 0.94 2 (CW932036) EDCCB21TF A. castellanii, 6-8 kb library from tot... 38 1.00 2 (CV495540) 40926.1 Cold Sweetening B Solanum tuberosum cDNA ... 38 1.0 2 (CV494061) 38674.1 Cold Sweetening B Solanum tuberosum cDNA ... 38 1.1 2 (DH482617) Monosiga ovata DNA, fosmid clone: MOF-037B10, gen... 36 1.1 2 (CV429208) 51663.1 After-Cooking Darkening C Solanum tuberos... 38 1.2 2 (EG011475) STDB005M13u STDB Solanum tuberosum cDNA clone STD... 38 1.3 2 (AY964183) Dekkera bruxellensis strain CBS 2499 orotidine-5'... 40 1.4 3 (DR084567) CAST032C05 cassava tuber Manihot esculenta cDNA c... 34 1.4 3 (M29395) Mouse orotidine-5'-monophosphate decarboxylase mRNA... 48 1.5 1 (BC095981) Mus musculus uridine monophosphate synthetase, mR... 48 1.5 1 (AC165079) Mus musculus BAC clone RP24-92K17 from chromosome... 48 1.5 1 (AK159955) Mus musculus osteoclast-like cell cDNA, RIKEN ful... 48 1.5 1 (AK159808) Mus musculus osteoclast-like cell cDNA, RIKEN ful... 48 1.5 1 (AK090102) Mus musculus colon RCB-0549 Cle-H3 cDNA, RIKEN fu... 48 1.5 1 (AK035997) Mus musculus 16 days neonate cerebellum cDNA, RIK... 48 1.5 1 (AK035821) Mus musculus 16 days neonate cerebellum cDNA, RIK... 48 1.5 1 (EK176847) 1095458101506 Global-Ocean-Sampling_GS-31-01-01-1... 48 1.5 1 (EJ077998) 1095458137642 Global-Ocean-Sampling_GS-26-01-01-1... 48 1.5 1 (AV579390) Mus musculus cDNA, Abe mouse ES cell cDNA library... 48 1.5 1 (AV516782) Mus musculus cDNA, Abe mouse ES cell cDNA library... 48 1.5 1 (AV493790) Mus musculus cDNA, Abe mouse ES cell cDNA library... 48 1.5 1 (AV457616) Mus musculus cDNA, Abe mouse ES cell cDNA library... 48 1.5 1 (DV063496) NEONATAL_19_B22.x1 FH NEONATAL Mus musculus cDNA ... 48 1.5 1 (AV168581) Mus musculus 13-day embryo head cDNA, partial seq... 48 1.5 1 (CX566442) UI-M-IB0-cun-l-16-0-UI.r1 NIH_BMAP_IB0 Mus muscul... 48 1.5 1 (CX220020) MNS35401 Mouse Neurosphere Normalized cDNA librar... 48 1.5 1 (CV860862) gonad_EST08338 Embryonic gonad cDNA Library Gallu... 48 1.5 1 (CV853820) gonad_EST01296 Embryonic gonad cDNA Library Gallu... 48 1.5 1 (CN702376) E0461E11-5 NIA Mouse E11.5 whole embryo cDNA libr... 48 1.5 1 (CN701255) E0447B08-5 NIA Mouse E11.5 whole embryo cDNA libr... 48 1.5 1 (CN697886) E0400G10-5 NIA Mouse E11.5 whole embryo cDNA libr... 48 1.5 1 (CN694080) E0345G05-5 NIA Mouse E10.5 whole embryo cDNA libr... 48 1.5 1 (CN684549) E0195C09-5 NIA Mouse Embryonic Stem (ES) cell (Li... 48 1.5 1 (CN684425) E0193E09-5 NIA Mouse Embryonic Stem (ES) cell (Li... 48 1.5 1 (CN674690) A0952E01-5 NIA Mouse Embryonic Stem (ES) cell (Li... 48 1.5 1 (CN666066) A0834H12-5 NIA Mouse E13.5 whole embryo cDNA libr... 48 1.5 1 (CN527549) UI-M-HQ0-cpd-h-23-0-UI.r1 NIH_BMAP_HQ0 Mus muscul... 48 1.5 1 (CK391330) K0830C04-5 NIA Mouse 8.5-dpc Whole Embryo cDNA Li... 48 1.5 1 (CK390822) K0823G06-5 NIA Mouse 8.5-dpc Whole Embryo cDNA Li... 48 1.5 1 (CK390796) K0823E01-5 NIA Mouse 8.5-dpc Whole Embryo cDNA Li... 48 1.5 1 (AJ741771) Gallus gallus EST, clone 1g10s3. 48 1.5 1 (AJ741766) Gallus gallus EST, clone 1g10r2. 48 1.5 1 (CF169285) B0811F11-5 NIA Mouse Newborn Kidney cDNA Library ... 48 1.5 1 (CF166550) B0772E04-5 NIA Mouse Embryonic Germ Cell cDNA Lib... 48 1.5 1 (CD563238) B0460G07-5 NIA Mouse E6.5 Whole Embryo cDNA Libra... 48 1.5 1 (CB193409) AGENCOURT_11213078 NIH_MGC_135 Mus musculus cDNA ... 48 1.5 1 (CA884143) B0108C01-5N NIA Mouse Neural Stem Cell (Different... 48 1.5 1 (CA569772) K0447B08-5N NIA Mouse Mesenchymal Stem Cell cDNA ... 48 1.5 1 (CA543389) C0633E02-5N NIA Mouse Trophoblast Stem Cell cDNA ... 48 1.5 1 (CA538915) C0272G04-5N NIA Mouse 7.5-dpc Whole Embryo cDNA L... 48 1.5 1 (BX278624) Gallus gallus multi-tissues normalized library (g... 48 1.5 1 (BU511613) AGENCOURT_10129098 NIH_MGC_134 Mus musculus cDNA ... 48 1.5 1 (BU126552) 603151346F1 CSEQCHL19 Gallus gallus cDNA clone Ch... 48 1.5 1 (BQ257732) NISC_kp05e07.q2 Baker mouse embryo e7.5 Mus muscu... 48 1.5 1 (BG146125) uu93c10.y1 Soares_mouse_NMGB_bcell Mus musculus c... 48 1.5 1 (FC860482) Sm12F12 Cell cultures of Saussurea medusa Saussur... 48 1.5 1 (AV817983) Arabidopsis thaliana cDNA clone:RAFL09-96-G21, 3'... 44 1.5 2 (CN463076) 6055.1 After-Cooking Darkening A Solanum tuberosu... 38 1.5 2 (CV651653) 75603.1 Low Molecular Weight Solanum tuberosum cD... 38 1.5 2 (EJ961971) 1093022008963 Global-Ocean-Sampling_GS-30-02-01-1... 36 1.7 2 (CE728091) tigr-gss-dog-17000315440555 Dog Library Canis lup... 34 1.7 3 (CV476804) 25638.1 Developing Tubers Solanum tuberosum cDNA ... 38 1.8 2 (CE480293) tigr-gss-dog-17000364769283 Dog Library Canis lup... 36 1.8 2 (BF154151) 054F01 Mature tuber lambda ZAP Solanum tuberosum ... 38 1.9 2 (CE396312) tigr-gss-dog-17000334507844 Dog Library Canis lup... 36 2.0 2 (CD660595) EtESTef52f08.y1 Eimeria tenella M5-6 Excised cDNA... 36 2.0 2 (DN938907) 10502.2 After-Cooking Darkening A Solanum tuberos... 38 2.1 2 (U91653) Plasmodium falciparum isolate V458, merozoite surfa... 36 2.1 2 (DN942170) 662.3 Tuber Skin Solanum tuberosum cDNA clone 662... 38 2.1 2 (DN590499) 91433.1 Late Blight-Challenged Tubers Solanum tub... 38 2.2 2 (DH628027) Rattus norvegicus DNA, BAC clone: RNB1-163D13, 3'... 36 2.2 2 (AC008718) Homo sapiens chromosome 5 clone CTB-87P9, WORKING... 44 2.2 5 (AM909126) Solanum tuberosum EST, clone 7F1. 38 2.2 2 (CO008258) EST796593 Coccidioides posadasii spherule cDNA li... 38 2.3 2 (CN463778) 7331.1 After-Cooking Darkening A Solanum tuberosu... 38 2.3 2 (CV473558) 21806.1 Developing Tubers Solanum tuberosum cDNA ... 38 2.3 2 (DH503802) Monosiga ovata DNA, fosmid clone: MOF-073N16, gen... 36 2.3 2 (CX660015) PO01016H12 Poplar SC cDNA library Populus alba x ... 40 2.3 2 (CV497053) 61216.1 Mixed Leaf Solanum tuberosum cDNA clone 6... 38 2.3 2 (CV495096) 40296.1 Cold Sweetening B Solanum tuberosum cDNA ... 38 2.3 2 (DH477855) Monosiga ovata DNA, fosmid clone: MOF-028L23, gen... 36 2.3 2 (CX175840) G05_69-39_13.ab1 leaf inoculated with Marssonia p... 40 2.3 2 (CV492985) 37238.1 Cold Sweetening B Solanum tuberosum cDNA ... 38 2.4 2 (CN214414) 28118 Suspension culture Solanum tuberosum cDNA, ... 38 2.4 2 (CN462933) 5851.1 After-Cooking Darkening A Solanum tuberosu... 38 2.4 2 (CA838974) MCT022D09_171043 Ice plant Lambda Uni-Zap XR expr... 36 2.4 2 (FE745418) CAYC2988.b1 CAYC Petrolisthes cinctipes heart, ne... 36 2.5 2 (DN939394) 6055.3 After-Cooking Darkening A Solanum tuberosu... 38 2.5 2 (FH941545) CHO_OF6729xm22r1.ab1 CHO_OF6 Nicotiana tabacum ge... 38 2.6 2 (FH678433) CHO_OF5049xk22f1.ab1 CHO_OF5 Nicotiana tabacum ge... 36 2.6 2 (EJ839148) 1093017818627 Global-Ocean-Sampling_GS-30-02-01-1... 36 2.6 2 (FH338894) CHO_OF4603xk02f1.ab1 CHO_OF4 Nicotiana tabacum ge... 36 2.6 2 (FF735329) XABT48860.fwd Gateway compatible cien cDNA librar... 32 2.7 3 (EK330176) 1095467021432 Global-Ocean-Sampling_GS-31-01-01-1... 36 2.7 2 (CO008259) EST796594 Coccidioides posadasii spherule cDNA li... 38 2.7 2 (FH136102) CHO_OF3663xk06f1.ab1 CHO_OF3 Nicotiana tabacum ge... 38 2.8 2 (FH550737) CHO_OF4501xo03f1.ab1 CHO_OF4 Nicotiana tabacum ge... 36 2.8 2 (FH471066) CHO_OF4330xg18r1.ab1 CHO_OF4 Nicotiana tabacum ge... 38 2.8 2 (FH136157) CHO_OF3663xk06r1.ab1 CHO_OF3 Nicotiana tabacum ge... 38 2.9 2 (DV445492) CV01016A1F08.f1 CV01-normalized library Manihot e... 34 2.9 3 (AC146855) Medicago truncatula clone mth2-16c23, complete se... 36 2.9 2 (EK971887) 1095521045607 Global-Ocean-Sampling_GS-33-01-01-1... 36 2.9 2 (FI033553) CHO_OF6446xi18r1.ab1 CHO_OF6 Nicotiana tabacum ge... 36 2.9 2 (EK304803) 1095462377085 Global-Ocean-Sampling_GS-31-01-01-1... 36 3.0 2 (DT482484) WS02519.B21_P05 PT-MB-N-A-15 Populus trichocarpa ... 40 3.0 2 (ER121731) 1095522042187 Global-Ocean-Sampling_GS-33-01-01-1... 36 3.0 2 (EK949171) 1095516076681 Global-Ocean-Sampling_GS-33-01-01-1... 38 3.0 2 (DY919258) CHAY2612.b1_H06.ab1 CHA(XYZ) common wild sunflowe... 36 3.1 2 (EJ571716) 1092960048501 Global-Ocean-Sampling_GS-29-01-01-1... 34 3.2 3 (DT517145) WS02433.B21_H04 PTxD-ICC-N-A-14 Populus trichocar... 40 3.3 2 (AY033329) Debaryomyces hansenii Dgea2p (DGEA2) gene, partia... 34 3.6 2 (DV441938) CV01005B2B01.f1 CV01-normalized library Manihot e... 34 3.8 2 (DV441068) CV01003A1H02.f1 CV01-normalized library Manihot e... 34 3.9 2 (CK103446) G117P40.5pR Populus tension wood cDNA library Pop... 34 3.9 3 (CO752316) Mdfrt3053l24.y1 Mdfrt Malus x domestica cDNA clon... 36 4.0 2 (CO418870) Mdfrt3035p24.y1 Mdfrt Malus x domestica cDNA clon... 36 4.4 2 (CA330829) haa67f10.y2 Fugu hgmpF adult brain Takifugu rubri... 36 4.5 2 (DH462789) Monosiga ovata DNA, fosmid clone: MOF-002G02, gen... 36 4.8 2 (CF644025) K15_H05 Filamentous Forced Diploid Ustilago maydi... 36 5.0 2 (DX795313) 2664059 VV07 Ustilago maydis genomic clone 115996... 36 5.2 2 (CF078541) QHK2O19.yg.ab1 QH_K sunflower H.paradoxus Heliant... 40 5.3 2 (DY267086) IC0AAA20BH11RM1 CitNFL Citrus clementina cDNA 5',... 34 5.3 3 (AG267785) Cyanidioschyzon merolae genomic DNA, forward end ... 36 5.5 2 (CE728814) tigr-gss-dog-17000315447506 Dog Library Canis lup... 36 5.5 2 (CB763976) AMGNNUC:MRBE3-00097-E12-A rat brain E15 (10374) R... 36 5.5 2 (EF147964) Populus trichocarpa clone WS0126_F02 unknown mRNA. 40 5.6 2 (CO752423) Mdfr3024c22.y1 Mdfr Malus x domestica cDNA clone ... 36 5.8 2 (AC192129) Pan troglodytes BAC clone CH251-621O12 from chrom... 46 5.8 1 (AL109952) Human DNA sequence from clone RP4-664K17 on chrom... 46 5.8 1 (EK383327) 1095469471459 Global-Ocean-Sampling_GS-31-01-01-1... 46 5.8 1 (EK352898) 1095468108569 Global-Ocean-Sampling_GS-31-01-01-1... 46 5.8 1 (EH212347) USDA-FP_175144 WHMH (pink hibiscus mealybug) Maco... 46 5.8 1 (AU261455) Dictyostelium discoideum vegetative cDNA clone:VS... 46 5.8 1 (CJ991110) Bursaphelenchus xylophilus cDNA clone: Bx_Kp_04D1... 46 5.8 1 (AM999887) Wolbachia endosymbiont of Culex quinquefasciatus ... 46 5.8 1 (AC109016) Rattus norvegicus clone CH230-21K5, *** SEQUENCIN... 40 5.9 6 (BK005555) TPA_inf: Rattus norvegicus mucin apoprotein precu... 36 6.0 3 (DQ976375) Yersinia enterocolitica strain E6 microsatellite ... 34 6.0 2 (CW427399) fsbb001f139g02k0 Sorghum methylation filtered lib... 36 6.2 2 (CA330843) haa67h10.y2 Fugu hgmpF adult brain Takifugu rubri... 36 6.3 2 (DX709716) 2189741 VV03 Ustilago maydis genomic clone 899388... 36 6.4 2 (DN756045) GL-Cf-12841 GLGC-LIB0001-cf Canis familiaris Norm... 36 6.4 2 (EG724765) GTE00007083 Guillardia theta non-normalised Guill... 36 6.4 2 (CN937759) 010525AVBC001549HT (AVBC) Royal Gala young shoot ... 36 6.5 2 (DV146500) CV03069B2F01.f1 CV03-normalized library Euphorbia... 32 6.5 3 (BE115879) UI-R-BS1-axv-e-03-0-UI.s1 UI-R-BS1 Rattus norvegi... 36 6.6 2 (DQ976374) Yersinia enterocolitica strain C16 microsatellite... 34 6.7 2 (DY280377) IC0AAA51AC05RM1 CitNFL Citrus clementina cDNA 5',... 34 6.7 3 (CN913922) 030109ABMA006089HT (ABMA) M9 phloem Malus x domes... 42 6.8 2 (BQ114952) EST600528 mixed potato tissues Solanum tuberosum ... 36 6.9 2 (DX769847) 2673562 VV07 Ustilago maydis genomic clone 116249... 36 7.0 2 (AU270941) Dictyostelium discoideum vegetative cDNA clone:VS... 38 7.1 2 (FD695167) CBHY5562.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.1 2 (BQ114953) EST600529 mixed potato tissues Solanum tuberosum ... 36 7.1 2 (BU867852) M105B09 Populus flower cDNA library Populus trich... 36 7.1 2 (FD665298) CBBW522.rev CBBW Mycosphaerella fijiensis MfEST4 ... 36 7.1 2 (FD692768) CBHY4190.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.1 2 (BP035364) Lotus japonicus cDNA, clone:MFB019g02_f, 3' end. 36 7.2 2 (EA167285) Sequence 31600 from patent US 7214786. 36 7.3 2 (BF053354) EST438584 potato leaves and petioles Solanum tube... 36 7.3 2 (FD686209) CBHX5588.rev CBHX Mycosphaerella fijiensis MfEST4... 36 7.3 2 (FD687727) CBHY1213.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.3 2 (EF081489) Picea sitchensis clone WS02811_H03 unknown mRNA. 36 7.4 2 (DR483464) WS02811.C21.1_H03 SS-IB-A-FL-13 Picea sitchensis ... 36 7.4 2 (DR477820) WS02811.CR_H03 SS-IB-A-FL-13 Picea sitchensis cDN... 36 7.4 2 (FD696086) CBHY6076.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.4 2 (FD695713) CBHY5874.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.4 2 (AY823554) Pennisetum glaucum dehydration responsive transcr... 36 7.4 2 (FD694890) CBHY5412.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.4 2 (CD725039) MK_17_59 Pennisetum glaucum seedlings exposed to ... 36 7.4 2 (CN516996) 662.1 Tuber Skin Solanum tuberosum cDNA clone 662... 38 7.4 2 (CW078388) 104_392_10896715_116_31926_091 Sorghum methylatio... 36 7.5 2 (DQ769438) Synthetic construct Yersinia pestis clone FLH0123... 34 7.5 2 (FD095621) CBFH34250.g1 CBFH: Normalized blue catfish cDNA l... 36 7.6 2 (CV308100) tj49e07.b7 Mouse 5' RACE clones Mus musculus cDNA... 34 7.6 2 (GE587225) CCPW11458.b1_D10.ab1 CCP(UWX) Globe Artichoke Cyn... 36 7.6 2 (BG547088) 602573887F1 NIH_MGC_77 Homo sapiens cDNA clone IM... 36 7.7 2 (FD672124) CBHU2074.rev CBHU Mycosphaerella fijiensis MfEST3... 36 7.7 2 (AC190515) Zea mays chromosome 2 clone CH201-221O12; ZMMBBc0... 40 7.8 2 (CV241743) WS02513.B21_B24 PT-MB-N-A-15 Populus trichocarpa ... 36 7.8 2 (CA741788) wia1c.pk003.f6 wia1c Triticum aestivum cDNA clone... 36 7.8 2 (AW141629) EST291693 Normalized rat embryo, Bento Soares Rat... 36 7.9 2 (CN911716) 021216ABMA002466HT (ABMA) M9 phloem Malus x domes... 42 7.9 2 (CK864317) 35650 In vitro Root Solanum tuberosum cDNA, mRNA ... 36 8.0 2 (BV363042) S231P6350FA3.T0 BedlingtonTerrier Canis familiari... 36 8.0 2 (DB878832) Populus nigra mRNA, clone: PnFL2-024_M01, 5'end. 36 8.0 2 (DT500128) PX0011.BR_E17 PT-X-FL-A-1 Populus trichocarpa cDN... 36 8.0 2 (DB883643) Populus nigra mRNA, clone: PnFL2-051_E12, 5'end. 36 8.1 2 (FD685971) CBHX5465.rev CBHX Mycosphaerella fijiensis MfEST4... 36 8.1 2 (CW365729) fsbb001f038g12f0 Sorghum methylation filtered lib... 36 8.1 2 (CO258682) VRK386 Vitis riparia bud - VRK Vitis riparia cDNA... 36 8.1 2 (FD672656) CBHU2369.rev CBHU Mycosphaerella fijiensis MfEST3... 36 8.2 2 (EX858297) CBNF4422.rev CBNF Phycomyces blakesleeanus NRRL15... 36 8.3 2 (GE995474) G1220P13FC13.T0 Neurospora crassa cDNA - 1 hour O... 36 8.3 2 (BU869087) M125H09 Populus flower cDNA library Populus trich... 36 8.4 2 (EJ037958) 1095454080879 Global-Ocean-Sampling_GS-26-01-01-1... 32 8.4 3 (DC888573) Citrus unshiu mRNA, clone: FBI0594, 5'-end sequen... 36 8.4 2 (BI434113) EST536874 P. infestans-challenged potato leaf, co... 36 8.5 2 (DX674233) 2195106 VV03 Ustilago maydis genomic clone 861877... 36 8.5 2 (CO252306) WS00816.B21_E20 WS-X-N-A-9 Picea glauca cDNA clon... 36 8.8 2 (BJ249080) Triticum aestivum cDNA clone:whf23f02, 5' end, si... 36 8.8 2 (DH624205) Rattus norvegicus DNA, BAC clone: RNB1-158B17, 5'... 36 8.8 2 (DH601840) Rattus norvegicus DNA, BAC clone: RNB1-128A07, 5'... 36 8.8 2 (CN911882) 021217ABMA002761HT (ABMA) M9 phloem Malus x domes... 42 8.9 2 (FD696087) CBHY6076.fwd CBHY Mycosphaerella fijiensis MfEST5... 36 9.0 2 (AA942398) LD26579.5prime LD Drosophila melanogaster embryo ... 36 9.0 2 (ES432160) EST1232367 ESTSYN-F Musa acuminata AAA Group cDNA... 36 9.0 2 (FD695088) CBHY5522.rev CBHY Mycosphaerella fijiensis MfEST5... 36 9.0 2 (FD687728) CBHY1213.fwd CBHY Mycosphaerella fijiensis MfEST5... 36 9.1 2 (EG718241) GTE00003807 Guillardia theta non-normalised Guill... 36 9.1 2 (CN911210) 021119ABMA001393HT (ABMA) M9 phloem Malus x domes... 42 9.2 2 (CV240067) WS0234.B21_E19 PT-MB-A-13 Populus trichocarpa cDN... 36 9.2 2 (EX952443) IB1_56_E05_A068.b1 Iris brevicaulis EST Library I... 36 9.2 2 (DH807050) Rattus norvegicus DNA, BAC clone: RNB1-404M14, 5'... 36 9.2 2 (BQ516573) EST623988 Generation of a set of potato cDNA clon... 36 9.2 2 (BZ248702) CH230-314H12.TV CHORI-230 Segment 2 Rattus norveg... 36 9.2 2 (FD667110) CBHT1705.rev CBHT Mycosphaerella fijiensis MfEST3... 36 9.3 2 (DH453563) Macropus eugenii DNA with T7 primer, fosmid clone... 36 9.3 2 (GH062814) G992P128RJ8.T0 Neurospora crassa cDNA - 1 hour He... 36 9.3 2 (GH077967) G992P149RK22.T0 Neurospora crassa cDNA - 1 hour H... 36 9.4 2 (CK268043) EST714121 potato abiotic stress cDNA library Sola... 36 9.4 2 (EX445348) GQ04113.B7_G05 GQ041 - Shoot tip - Dormant (Norma... 36 9.5 2 (FD692769) CBHY4190.fwd CBHY Mycosphaerella fijiensis MfEST5... 36 9.5 2 (FC846869) CBHN4453.fwd CBHN Metridium senile tentacle Metri... 36 9.5 2 (BB565615) Mus musculus adult male tongue cDNA, RIKEN full-l... 34 9.6 2 (EX815678) CBNA4657.fwd CBNA Phycomyces blakesleeanus NRRL15... 36 9.6 2 (CV196772) CGF1003504_F04 Seed coat from mid-season walnut e... 36 9.6 2 (FD667111) CBHT1705.fwd CBHT Mycosphaerella fijiensis MfEST3... 36 9.6 2 (GE952531) G1176P152RM20.T0 Neurospora crassa cDNA - 1 hour ... 36 9.6 2 (BZ142366) CH230-245D15.TV CHORI-230 Segment 2 Rattus norveg... 36 9.7 2 (EJ247378) 1095337027624 Global-Ocean-Sampling_GS-27-01-01-1... 42 9.7 2 (DT561964) EST1072604 GH_TMO Gossypium hirsutum cDNA, mRNA s... 36 9.8 2 (CK278568) EST724646 potato abiotic stress cDNA library Sola... 36 9.8 2 (ER266881) 1095527077804 Global-Ocean-Sampling_GS-33-01-01-1... 36 9.9 2 (EY688077) CS00-C2-003-056-G05-CT.F Sweet orange bark, green... 36 9.9 2 (BB565400) Mus musculus adult male tongue cDNA, RIKEN full-l... 34 10.0 2 (GH151206) G994P165FD5.T0 Neurospora crassa cDNA - 1 hour Ni... 36 10.0 2 (FD673533) CBHU2857.rev CBHU Mycosphaerella fijiensis MfEST3... 36 10.0 2 (FD672125) CBHU2074.fwd CBHU Mycosphaerella fijiensis MfEST3... 36 10.0 2
>(X07560) Dictyostelium discoideum DdPYR5-6 gene for UMP synthase (EC 2.4.2.10, EC 4.1.1.23). Length = 1870
Score = 1524 bits (769), Expect(2) = 0.0 Identities = 772/773 (99%) Strand = Plus / Plus
Query: 127 gagtggtattatttcaccaatttatattgatcttagagttacagtatcatcaccaccatt 186 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 322 gagtggtattatttcaccaatttatattgatcttagagttacagtatcatcaccaccatt 381
Query: 187 gttagcagcaattgcagagatgatgtatcaaaaggtttataaatctggtaatgcacaaga 246 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 382 gttagcagcaattgcagagatgatgtatcaaaaggtttataaatctggtaatgcacaaga 441
Query: 247 gacaccagcattagtatgtggtgtaccatatacagcattaccaattgcaacaggtatgtc 306 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 442 gacaccagcattagtatgtggtgtaccatatacagcattaccaattgcaacaggtatgtc 501
Query: 307 aattgccaacaatattccaatggtagtacgtagaaaagaagccaaagcatatggtaccaa 366 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 502 aattgccaacaatattccaatggtagtacgtagaaaagaagccaaagcatatggtaccaa 561
Query: 367 acaattgattgaaggtcgtttcaaagagggtgacaatgtattggttgttgaagatttagt 426 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 562 acaattgattgaaggtcgtttcaaagagggtgacaatgtattggttgttgaagatttagt 621
Query: 427 aacaagtggtgcaagtgtacttgaaacagttagagatttaaattcagttggtttaaaagt 486 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 622 aacaagtggtgcaagtgtacttgaaacagttagagatttaaattcagttggtttaaaagt 681
Query: 487 tacagacgtagtcgtgttattagatcgtcaacaaggtgccagacaagcacttgagaaaca 546 ||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| Sbjct: 682 tacagacgtagtcgtgttattagatcgtcaagaaggtgccagacaagcacttgagaaaca 741
Query: 547 aggctaccgtcttcactcagtctttacaatggaagagttaatcaacaccttaatcgaagc 606 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 742 aggctaccgtcttcactcagtctttacaatggaagagttaatcaacaccttaatcgaagc 801
Query: 607 tggtaaattaaccggccgtactttagagttggttcaatcattcttagacgccaatcgtaa 666 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 802 tggtaaattaaccggccgtactttagagttggttcaatcattcttagacgccaatcgtaa 861
Query: 667 tgtagtagtaccattaccaccaacccttgccccaccagcaccagcaccaattgttattaa 726 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 862 tgtagtagtaccattaccaccaacccttgccccaccagcaccagcaccaattgttattaa 921
Query: 727 taaaccatttgaagagagagctaaacttgcatcaaatccaatggcatctaaattattcac 786 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 922 taaaccatttgaagagagagctaaacttgcatcaaatccaatggcatctaaattattcac 981
Query: 787 attaatgtcaagcaagaagaccaatcttgcagttgcagctgatttaactgataaacaaca 846 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 982 attaatgtcaagcaagaagaccaatcttgcagttgcagctgatttaactgataaacaaca 1041
Query: 847 acttttagatttagcagaatcaattggttcagaaatttgtgttttgaagaccc 899 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1042 acttttagatttagcagaatcaattggttcagaaatttgtgttttgaagaccc 1094
Score = 1154 bits (582), Expect(2) = 0.0 Identities = 585/586 (99%) Strand = Plus / Plus
Query: 898 cccatgttgatatcattgataattatgatgaagagtttattaaatcattgaaatgcatag 957 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1092 cccatgttgatatcattgataattatgatgaagagtttattaaatcattgaaatgcatag 1151
Query: 958 cagcaaaacataatttcttgatttttgaagatagaaaattcgcagatattggaaacactg 1017 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1152 cagcaaaacataatttcttgatttttgaagatagaaaattcgcagatattggaaacactg 1211
Query: 1018 tgaaatatcaatttgagaatggtgtttataaaatctcaaaatgggcagacatggtcaccg 1077 |||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||| Sbjct: 1212 tgaaatatcaatttgagaatggtgtttataaaatctcaaaatgggcagtcatggtcaccg 1271
Query: 1078 tacatggtgtcgcaggttcatccattgtcgatggtttcaaatcaggtttgaaagagtatg 1137 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1272 tacatggtgtcgcaggttcatccattgtcgatggtttcaaatcaggtttgaaagagtatg 1331
Query: 1138 gttcaggtttattattattggctcaaatgtcatcaaaaggttctttgtgtgttggtgatt 1197 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1332 gttcaggtttattattattggctcaaatgtcatcaaaaggttctttgtgtgttggtgatt 1391
Query: 1198 atacaactcaaatgattgaaatggcaaataataacaaagaggaggttatgggtttaattt 1257 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1392 atacaactcaaatgattgaaatggcaaataataacaaagaggaggttatgggtttaattt 1451
Query: 1258 gtcaagaacgattaccatcaatgactgatggtttggttttaatgactccaggtgttcaat 1317 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1452 gtcaagaacgattaccatcaatgactgatggtttggttttaatgactccaggtgttcaat 1511
Query: 1318 tcaattcaactggtgatgctatgggtcaacaatataatactccagaatatatcattaaag 1377 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1512 tcaattcaactggtgatgctatgggtcaacaatataatactccagaatatatcattaaag 1571
Query: 1378 aaaagaatactgatgttatcattgttggtagaggtatttatcaaagtaatgatccaaaat 1437 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1572 aaaagaatactgatgttatcattgttggtagaggtatttatcaaagtaatgatccaaaat 1631
Query: 1438 ctgttgcaaataaatatagaactgctgcttgggaaacttatcaatc 1483 |||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1632 ctgttgcaaataaatatagaactgctgcttgggaaacttatcaatc 1677
Score = 977 bits (493), Expect(3) = 0.0 Identities = 499/501 (99%) Strand = Plus / Plus
Query: 1572 ttggttcaatcattcttagacgccaatcgtaatgtagtagtaccattaccaccaaccctt 1631 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 830 ttggttcaatcattcttagacgccaatcgtaatgtagtagtaccattaccaccaaccctt 889
Query: 1632 gccccaccagcaccagcaccaattgttattaataaaccatttgaagagagagctaaactt 1691 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 890 gccccaccagcaccagcaccaattgttattaataaaccatttgaagagagagctaaactt 949
Query: 1692 gcatcaaatccaatggcatctaaattattcacattaatgtcaagcaagaagaccaatctt 1751 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 950 gcatcaaatccaatggcatctaaattattcacattaatgtcaagcaagaagaccaatctt 1009
Query: 1752 gcagttgcagctgatttaactgataaacaacaacttttagatttagcagaatcaattggt 1811 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1010 gcagttgcagctgatttaactgataaacaacaacttttagatttagcagaatcaattggt 1069
Query: 1812 tcagaaatttgtgttttgaagacccatgttgatatcattgataattatgatgaagagttt 1871 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1070 tcagaaatttgtgttttgaagacccatgttgatatcattgataattatgatgaagagttt 1129
Query: 1872 attaaaccattgaaatgcatagcagcaaaacataatttcttgatttttgaagatagaaaa 1931 |||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1130 attaaatcattgaaatgcatagcagcaaaacataatttcttgatttttgaagatagaaaa 1189
Query: 1932 ttcgcagatattggaaacactgtgaaatatcaatttgagaatggtgtttataaaatctca 1991 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1190 ttcgcagatattggaaacactgtgaaatatcaatttgagaatggtgtttataaaatctca 1249
Query: 1992 aaatgggcagacatggtcaccgtacatggtgtcgcaggttcatccattgtcgatggtttc 2051 |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1250 aaatgggcagtcatggtcaccgtacatggtgtcgcaggttcatccattgtcgatggtttc 1309
Query: 2052 aaatcaggtttgaaagagtat 2072 ||||||||||||||||||||| Sbjct: 1310 aaatcaggtttgaaagagtat 1330
Score = 266 bits (134), Expect(3) = 0.0 Identities = 134/134 (100%) Strand = Plus / Plus
Query: 2070 tataatactccagaatatatcattaaagaaaagaatactgatgttatcattgttggtaga 2129 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1544 tataatactccagaatatatcattaaagaaaagaatactgatgttatcattgttggtaga 1603
Query: 2130 ggtatttatcaaagtaatgatccaaaatctgttgcaaataaatatagaactgctgcttgg 2189 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1604 ggtatttatcaaagtaatgatccaaaatctgttgcaaataaatatagaactgctgcttgg 1663
Query: 2190 gaaacttatcaatc 2203 |||||||||||||| Sbjct: 1664 gaaacttatcaatc 1677
Score = 46.1 bits (23), Expect(3) = 0.0 Identities = 23/23 (100%) Strand = Plus / Plus
Query: 2 aaaactcgttgtgtgtgtgtttg 24 ||||||||||||||||||||||| Sbjct: 203 aaaactcgttgtgtgtgtgtttg 225
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number of Hits to DB: 2,489,211,577 Number of extensions: 182338349 Number of successful extensions: 12355134 Number of sequences better than 10.0: 383 Length of query: 2258 Length of database: 98,766,808,389 Length adjustment: 24 Effective length of query: 2234 Effective length of database: 96,409,374,237 Effective search space: 215378542045458 Effective search space used: 215378542045458 X1: 11 (21.8 bits) S2: 23 (46.1 bits)
|
protein update |
2009. 7.19 |
Homology vs Protein |
Query= Contig-U15843-1 (Contig-U15843-1Q) /CSM_Contig/Contig-U15843-1Q.Seq.d (2258 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
CP000583_115(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 263 e-122 AF277454_1(AF277454|pid:none) Zea mays UMP synthase (UMPS) mRNA,... 259 e-117 BT042958_1(BT042958|pid:none) Zea mays full-length cDNA clone ZM... 254 e-115 CR954203_113(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 237 e-114 (Q42586) RecName: Full=Uridine 5'-monophosphate synthase; ... 242 e-113 AC146590_3(AC146590|pid:none) Medicago truncatula clone mth2-145... 249 e-112 BT059756_1(BT059756|pid:none) Salmo salar clone ssal-rgf-540-302... 233 e-111 AF277455_1(AF277455|pid:none) Nicotiana plumbaginifolia UMP synt... 245 e-111 JU0141(JU0141;S11907)UMP synthase - fruit fly (Drosophila melano... 241 e-110 AB185845_1(AB185845|pid:none) Euglena gracilis OPRT-OMPDC mRNA f... 216 e-110 AK102468_1(AK102468|pid:none) Oryza sativa Japonica Group cDNA c... 237 e-109 BC098033_1(BC098033|pid:none) Rattus norvegicus uridine monophos... 233 e-107 (Q5R514) RecName: Full=Uridine 5'-monophosphate synthase; ... 226 e-107 (P11172) RecName: Full=Uridine 5'-monophosphate synthase; ... 225 e-106 AB041359_1(AB041359|pid:none) Homo sapiens UMPS gene for UMP syn... 225 e-106 EU921894_1(EU921894|pid:none) Homo sapiens uridine monophosphate... 225 e-106 D86230_1(D86230|pid:none) Homo sapiens clone TA-UMPS/V109G mRNA ... 222 e-106 BT062894_1(BT062894|pid:none) Zea mays full-length cDNA clone ZM... 220 e-105 M36661_1(M36661|pid:none) Human orotidine 5'-monophosphate decar... 223 e-105 D86228_1(D86228|pid:none) Human clone TA-UMPS/R96G+G429R mRNA fo... 222 e-105 AK159808_1(AK159808|pid:none) Mus musculus osteoclast-like cell ... 226 e-104 (P31754) RecName: Full=Uridine 5'-monophosphate synthase; ... 220 e-104 BC082707_1(BC082707|pid:none) Xenopus laevis hypothetical LOC494... 222 e-102 DQ311230_1(DQ311230|pid:none) Bombyx mori uridine 5'-monophospha... 224 e-102 AK318761_1(AK318761|pid:none) Arabidopsis thaliana AT3G54470 mRN... 242 e-101 EU961333_1(EU961333|pid:none) Zea mays clone 234591 uridine 5-mo... 254 e-101 (Q25566) RecName: Full=Uridine 5'-monophosphate synthase; ... 191 1e-93 EU921891_1(EU921891|pid:none) Homo sapiens uridine monophosphate... 187 2e-83 AF210325_1(AF210325|pid:none) Oryza sativa clone C23033 truncate... 184 1e-82 FN357419_17(FN357419|pid:none) Schistosoma mansoni genome sequen... 177 2e-73 AF210322_1(AF210322|pid:none) Oryza sativa clone C28243 UMP synt... 186 1e-65 AB037418_1(AB037418|pid:none) Oryza sativa Japonica Group UMPS2 ... 184 4e-64 (P21593) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 197 9e-61 (P43230) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 193 6e-60 AJ534694_1(AJ534694|pid:none) Blakeslea trispora pyrG gene for o... 188 1e-57 A94699_1(A94699|pid:none) Sequence 1 from Patent WO9936432. 190 2e-57 (Q9Y720) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 192 2e-57 AB109469_1(AB109469|pid:none) Mortierella alpina ura3 gene for o... 185 2e-57 (P32431) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 194 3e-57 AY262090_1(AY262090|pid:none) Blakeslea trispora JM-9204 orotidi... 186 4e-57 (Q6IUR4) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 193 8e-57 (P14965) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 189 1e-56 (P33283) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 192 2e-56 (Q06375) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 190 2e-56 EU921893_1(EU921893|pid:none) Homo sapiens uridine monophosphate... 187 7e-55 AB242207_1(AB242207|pid:none) Pichia minuta var. minuta OmURA3 g... 186 9e-55 AB023638_1(AB023638|pid:none) Candida tropicalis URA3 gene for o... 189 2e-54 (Q9P8X9) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 178 4e-54 (Q9UVZ5) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 179 6e-54 (P13649) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 181 8e-54 DCMSOP(A25323)orotidine-5'-phosphate decarboxylase (EC 4.1.1.23)... 180 1e-53 (P32430) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 188 1e-53 EU288194_1(EU288194|pid:none) Candida tropicalis orotidine-5'-ph... 187 2e-53 (Q9C150) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 182 2e-53 AB425277_1(AB425277|pid:none) Reporter plasmid pSUR DNA, complet... 179 3e-53 AF173953_1(AF173953|pid:none) Cloning vector pDDB57 complete seq... 182 3e-53 FB341588_1(FB341588|pid:none) Sequence 1 from Patent EP1854878. 185 3e-53 AB215109_2(AB215109|pid:none) Cloning vector pSU0 DNA, complete ... 179 3e-53 EU288195_1(EU288195|pid:none) Candida tropicalis microsatellite ... 186 5e-53 (Q12604) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 181 6e-53 AM989984_63(AM989984|pid:none) Zygosaccharomyces rouxii strain C... 186 6e-53 AY656808_2(AY656808|pid:none) Cloning vector pGT-GFP-URA3-14, pa... 181 8e-53 CS596825_1(CS596825|pid:none) Sequence 3 from Patent EP1792993. 177 8e-53 AB006207_1(AB006207|pid:none) Candida tropicalis URA3 gene for O... 180 1e-52 (O42771) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 184 2e-52 (P41769) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 181 2e-52 (O93864) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 176 5e-52 AF450297_2(AF450297|pid:none) Clavispora lusitaniae Gea2p (GEA2)... 184 5e-52 (Q12724) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 180 9e-52 FJ913469_1(FJ913469|pid:none) Volvariella volvacea strain V23 or... 180 6e-51 (Q9HFN9) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 180 7e-51 (P79075) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 177 7e-51 (O94127) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 174 7e-51 AB109042_1(AB109042|pid:none) Pichia farinosa PsURA3 gene for or... 176 1e-49 AB109043_1(AB109043|pid:none) Pichia farinosa PsURA30 gene for o... 176 1e-49 AB017705_1(AB017705|pid:none) Aspergillus oryzae pyrG gene for o... 170 4e-49 DCUSOP(JQ0013)orotidine-5'-phosphate decarboxylase (EC 4.1.1.23)... 164 2e-48 (O13416) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 167 2e-48 AJ306421_1(AJ306421|pid:none) Yarrowia lipolytica ura3 gene for ... 166 1e-47 (P07817) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 164 2e-47 AM270266_45(AM270266|pid:none) Aspergillus niger contig An12c009... 162 5e-47 X96734_1(X96734|pid:none) A.niger pyrA gene. 162 5e-47 (Q9HF68) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 155 1e-46 (Q96WP7) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 161 1e-46 (Q8J269) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 160 1e-46 A15364_1(A15364|pid:none) major part of the 2.4 kb EcoR1 fragmen... 158 2e-46 (P10652) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 154 2e-46 (Q1E9A1) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 154 2e-46 AB171350_1(AB171350|pid:none) Macaca fascicularis brain cDNA clo... 169 3e-46 (Q9HFV8) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 153 7e-46 (Q4VWW3) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 154 7e-46 AB084379_1(AB084379|pid:none) Cryptococcus humicola URA3 gene fo... 162 7e-46 AY771196_1(AY771196|pid:none) Candida glabrata genotype 3 orotid... 187 2e-45 (O13410) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 154 2e-45 AY771189_1(AY771189|pid:none) Candida glabrata genotype 18 oroti... 186 2e-45 (P09463) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 158 7e-45 DCASOE(A29630) orotidine-5'-phosphate decarboxylase (EC 4.1.1.23... 149 9e-45 AY771206_1(AY771206|pid:none) Candida glabrata genotype 30 oroti... 184 1e-44 AY771205_1(AY771205|pid:none) Candida glabrata genotype 29 oroti... 184 1e-44 (Q9C131) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 149 1e-44 AY771199_1(AY771199|pid:none) Candida glabrata genotype 22 oroti... 184 2e-44 AB307739_1(AB307739|pid:none) Diplonema papillatum pyr6 mRNA for... 156 5e-43 AL080099_1(AL080099|pid:none) Homo sapiens mRNA; cDNA DKFZp564G1... 137 8e-40 DQ359751_1(DQ359751|pid:none) Myrothecium gramineum orotidine 5'... 136 2e-39 CP001037_3170(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 157 2e-36 AF067219_11(AF067219|pid:none) Caenorhabditis elegans cosmid R12... 153 2e-35 (Q8YSY4) RecName: Full=Bifunctional enzyme pyrF/pyrE; Includes: ... 147 1e-33 AC159455_41(AC159455|pid:none) Trypanosoma brucei chromosome 5 c... 147 2e-33 CP000806_501(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 146 4e-33 AM494953_57(AM494953|pid:none) Leishmania braziliensis chromosom... 142 5e-32 AB307737_3(AB307737|pid:none) Neobodo saliens pyrimidine biosynt... 141 9e-32 AB029444_5(AB029444|pid:none) Leishmania mexicana amazonensis de... 141 1e-31 AJ251007_1(AJ251007|pid:none) Saccharomyces bayanus partial ura3... 140 3e-31 AM502234_56(AM502234|pid:none) Leishmania infantum chromosome 16. 140 3e-31 DQ644938_1(DQ644938|pid:none) Rhizopus microsporus var. microspo... 137 8e-31 BA000008_605(BA000008|pid:none) Chlamydophila pneumoniae J138 ge... 138 1e-30 AB185846_1(AB185846|pid:none) Parabodo caudatus OMPDC-OPRT mRNA ... 138 1e-30 DQ644941_1(DQ644941|pid:none) Rhizopus homothallicus strain CBS ... 136 1e-30 EU921895_1(EU921895|pid:none) Homo sapiens uridine monophosphate... 137 1e-30 EF562581_1(EF562581|pid:none) Pilaira anomala strain NRRL 2526 o... 136 1e-30 DQ644946_1(DQ644946|pid:none) Rhizopus oryzae strain JCM 5580 or... 136 1e-30 DQ644935_1(DQ644935|pid:none) Rhizopus microsporus var. tuberosu... 135 2e-30 CR848038_131(CR848038|pid:none) Chlamydophila abortus strain S26... 136 3e-30 DQ990332_1(DQ990332|pid:none) Rhizopus oryzae strain NRRL 2710 o... 134 4e-30 EF562583_1(EF562583|pid:none) Pilaira caucasica strain NRRL 6282... 134 5e-30 DQ644944_1(DQ644944|pid:none) Rhizopus oryzae strain HUT 1233 or... 134 5e-30 DQ644951_1(DQ644951|pid:none) Rhizopus sexualis strain NRRL 2567... 133 8e-30 CP001291_1634(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 135 8e-30 DQ644942_1(DQ644942|pid:none) Rhizopus schipperae strain ATCC 96... 133 1e-29 DQ644954_1(DQ644954|pid:none) Rhizopus stolonifer var. reflexus ... 133 1e-29 DQ644936_1(DQ644936|pid:none) Rhizopus microsporus var. oligospo... 132 1e-29 DQ644943_1(DQ644943|pid:none) Rhizopus caespitosus strain CBS 42... 132 2e-29 (Q252Z2) RecName: Full=Orotate phosphoribosyltransferase; ... 132 4e-29 EF562598_1(EF562598|pid:none) Pilaira sp. Pi-5 orotidine-5'-mono... 131 5e-29 DQ644937_1(DQ644937|pid:none) Rhizopus azygosporus strain CBS 35... 130 7e-29 CP001287_2208(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 129 5e-28 BA000045_1079(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 129 6e-28 (P56814) RecName: Full=Orotate phosphoribosyltransferase; ... 118 8e-25 CP000505_1136(CP000505|pid:none) Thermofilum pendens Hrk 5, comp... 118 8e-25 CP000678_821(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 117 2e-24 (Q6LX60) RecName: Full=Orotate phosphoribosyltransferase; ... 117 2e-24 AY083796_1(AY083796|pid:none) Pyrococcus abyssi strain GE9 orota... 116 4e-24 AF058713_1(AF058713|pid:none) Pyrococcus abyssi orotate phosphor... 115 5e-24 CP001177_630(CP001177|pid:none) Bacillus cereus AH187, complete ... 112 4e-23 AE017194_687(AE017194|pid:none) Bacillus cereus ATCC 10987, comp... 112 4e-23 (O58855) RecName: Full=Orotate phosphoribosyltransferase; ... 112 4e-23 (Q0W6Q2) RecName: Full=Orotate phosphoribosyltransferase; ... 112 8e-23 (A2BJ25) RecName: Full=Orotate phosphoribosyltransferase; ... 112 8e-23 CP001398_1901(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 110 2e-22 CP000743_553(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 110 3e-22 AJ492198_1(AJ492198|pid:none) Haloferax volcanii pyrE2 gene for ... 109 5e-22 CP000742_792(CP000742|pid:none) Methanococcus vannielii SB, comp... 108 8e-22 CP001407_539(CP001407|pid:none) Bacillus cereus 03BB102, complet... 108 1e-21 CU638744_57(CU638744|pid:none) Podospora anserina genomic DNA ch... 108 1e-21 AY596297_2238(AY596297|pid:none) Haloarcula marismortui ATCC 430... 108 1e-21 (Q3IT15) RecName: Full=Orotate phosphoribosyltransferase; ... 107 1e-21 CP001365_580(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 107 1e-21 (Q9HNG2) RecName: Full=Orotate phosphoribosyltransferase; ... 107 2e-21 EU975806_1(EU975806|pid:none) Zea mays clone 501634 unknown mRNA. 107 2e-21 (O27888) RecName: Full=Orotate phosphoribosyltransferase; ... 107 2e-21 AJ292112_1(AJ292112|pid:none) Auxarthron zuffianum partial pyrG ... 104 2e-20 S14132(S14132;S13090)orotidine-5'-phosphate decarboxylase (EC 4.... 104 2e-20 AJ292114_1(AJ292114|pid:none) Auxarthron zuffianum partial pyrG ... 103 4e-20 (O08359) RecName: Full=Orotate phosphoribosyltransferase; ... 102 5e-20 (P21594) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 102 5e-20 (Q12709) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 102 8e-20 (Q8ZTG3) RecName: Full=Orotate phosphoribosyltransferase; ... 102 8e-20 (Q2NFI3) RecName: Full=Orotate phosphoribosyltransferase; ... 101 1e-19 (P14017) RecName: Full=Orotidine 5'-phosphate decarboxylase; ... 101 1e-19 CP000866_285(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 101 1e-19 EU252579_1(EU252579|pid:none) Sulfolobus islandicus strain REN2H... 100 2e-19 CP001140_473(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 100 2e-19 FJ826617_1(FJ826617|pid:none) Epichloe festucae strain E2368 oro... 100 2e-19 AE009441_2306(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 100 4e-19 (Q97CT9) RecName: Full=Orotate phosphoribosyltransferase; ... 99 5e-19 (A3CU84) RecName: Full=Orotate phosphoribosyltransferase; ... 99 5e-19 (P58859) RecName: Full=Orotate phosphoribosyltransferase; ... 99 7e-19 EU016665_14(EU016665|pid:none) Uncultured Group I marine crenarc... 99 9e-19 CP001014_1554(CP001014|pid:none) Thermoproteus neutrophilus V24S... 98 1e-18 CP001399_1475(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 98 1e-18 EU252580_1(EU252580|pid:none) Sulfolobus islandicus strain HVE10... 98 1e-18 (Q9UX09) RecName: Full=Orotate phosphoribosyltransferase; ... 98 1e-18 (O67742) RecName: Full=Orotate phosphoribosyltransferase; ... 98 1e-18 EU016615_8(EU016615|pid:none) Uncultured Group I marine crenarch... 97 3e-18 GM016257_45(GM016257|pid:none) Sequence 1087 from Patent EP19234... 96 4e-18 CP000855_1520(CP000855|pid:none) Thermococcus onnurineus NA1, co... 96 6e-18 AJ292106_1(AJ292106|pid:none) Uncinocarpus reesii partial pyrG g... 96 7e-18 (O28533) RecName: Full=Orotate phosphoribosyltransferase; ... 95 1e-17 (A1RRV2) RecName: Full=Orotate phosphoribosyltransferase; ... 95 1e-17 AJ292100_1(AJ292100|pid:none) Coccidioides immitis partial pyrG ... 94 2e-17 AP007255_1314(AP007255|pid:none) Magnetospirillum magneticum AMB... 94 2e-17 AJ292104_1(AJ292104|pid:none) Coccidioides immitis partial pyrG ... 94 2e-17 CP001080_1406(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 94 2e-17 AJ292103_1(AJ292103|pid:none) Coccidioides immitis partial pyrG ... 94 2e-17 CP000300_961(CP000300|pid:none) Methanococcoides burtonii DSM 62... 93 4e-17 (Q8Q0J4) RecName: Full=Orotate phosphoribosyltransferase; ... 92 6e-17 (Q9HM15) RecName: Full=Orotate phosphoribosyltransferase; ... 92 1e-16 CP000780_835(CP000780|pid:none) Candidatus Methanoregula boonei ... 91 1e-16 CP001638_969(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 91 2e-16 CT573213_1023(CT573213|pid:none) Frankia alni str. ACN14A chromo... 91 2e-16 CP001037_4043(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 90 4e-16 (Q8YM41) RecName: Full=Orotate phosphoribosyltransferase; ... 90 4e-16 CP000117_2350(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 89 9e-16 (Q71YI5) RecName: Full=Orotate phosphoribosyltransferase; ... 88 1e-15 AE017180_1627(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 88 1e-15 (Q8Y668) RecName: Full=Orotate phosphoribosyltransferase; ... 88 2e-15 CP001389_114(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 87 2e-15 CP000951_1187(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 87 2e-15 CP001124_2307(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 87 3e-15 CP000142_1430(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 86 4e-15 (Q8EUY4) RecName: Full=Orotate phosphoribosyltransferase; ... 86 4e-15 CP000682_1928(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 86 4e-15 CP001287_3428(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 86 4e-15 AP010904_4625(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 86 4e-15 CP000777_2301(CP000777|pid:none) Leptospira biflexa serovar Pato... 86 4e-15 BX842648_223(BX842648|pid:none) Bdellovibrio bacteriovorus compl... 86 6e-15 (B5ZNS6) RecName: Full=Orotate phosphoribosyltransferase; ... 86 6e-15 (Q92SC6) RecName: Full=Orotate phosphoribosyltransferase; ... 86 6e-15 CP001338_2246(CP001338|pid:none) Candidatus Methanosphaerula pal... 85 1e-14 CP001130_440(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 85 1e-14 CP000817_1425(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 85 1e-14 (Q970X1) RecName: Full=Orotate phosphoribosyltransferase; ... 84 2e-14 CP000878_303(CP000878|pid:none) Prochlorococcus marinus str. MIT... 84 2e-14 EF444931_3(EF444931|pid:none) Rhizobium leguminosarum bv. trifol... 84 2e-14 (Q1MM09) RecName: Full=Orotate phosphoribosyltransferase; ... 84 3e-14 CP001175_713(CP001175|pid:none) Listeria monocytogenes HCC23, co... 84 3e-14 CP000413_1050(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 84 3e-14 (Q2KCZ1) RecName: Full=Orotate phosphoribosyltransferase; ... 84 3e-14 CP000411_240(CP000411|pid:none) Oenococcus oeni PSU-1, complete ... 83 4e-14 CP000628_563(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 83 4e-14 (Q74J27) RecName: Full=Orotate phosphoribosyltransferase; ... 83 4e-14 CP000477_1280(CP000477|pid:none) Methanosaeta thermophila PT, co... 83 4e-14 BX294133_184(BX294133|pid:none) Rhodopirellula baltica SH 1 comp... 83 5e-14 CP001022_1903(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 83 5e-14 CP001344_259(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 83 5e-14 CP000113_4513(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 83 5e-14 (Q7UYX5) RecName: Full=Orotate phosphoribosyltransferase; ... 83 5e-14 CP000033_1302(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 82 8e-14 BA000043_1157(BA000043|pid:none) Geobacillus kaustophilus HTA426... 82 8e-14 (Q7VDR1) RecName: Full=Orotate phosphoribosyltransferase; ... 82 8e-14 (P65917) RecName: Full=Orotate phosphoribosyltransferase; ... 82 8e-14 CP000560_1454(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 81 1e-13 (A1KFK3) RecName: Full=Orotate phosphoribosyltransferase; ... 81 1e-13 CP000633_406(CP000633|pid:none) Agrobacterium vitis S4 chromosom... 81 2e-13 (Q3K146) RecName: Full=Orotate phosphoribosyltransferase; ... 81 2e-13 CP001197_1455(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 81 2e-13 (A2C0A9) RecName: Full=Orotate phosphoribosyltransferase; ... 80 2e-13 (Q83H88) RecName: Full=Orotate phosphoribosyltransferase; ... 80 2e-13 (Q55574) RecName: Full=Orotate phosphoribosyltransferase; ... 80 2e-13 AP009385_2978(AP009385|pid:none) Burkholderia multivorans ATCC 1... 80 2e-13 (Q83FI4) RecName: Full=Orotate phosphoribosyltransferase; ... 80 2e-13 (Q9CGM8) RecName: Full=Orotate phosphoribosyltransferase; ... 80 3e-13 CP000557_1004(CP000557|pid:none) Geobacillus thermodenitrificans... 80 3e-13 (Q11RP3) RecName: Full=Orotate phosphoribosyltransferase; ... 80 3e-13 CP000922_1776(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 80 3e-13 (Q4L5Q7) RecName: Full=Orotate phosphoribosyltransferase; ... 80 3e-13 AP008955_3769(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 80 4e-13 CP000435_273(CP000435|pid:none) Synechococcus sp. CC9311, comple... 80 4e-13 (Q163V5) RecName: Full=Orotate phosphoribosyltransferase; ... 80 4e-13 CP000086_3046(CP000086|pid:none) Burkholderia thailandensis E264... 80 4e-13 B72463(B72463)probable orotate phosphoribosyltransferase (EC 2.4... 80 4e-13 (Q9Y9D8) RecName: Full=Orotate phosphoribosyltransferase; ... 80 4e-13 BX571965_3271(BX571965|pid:none) Burkholderia pseudomallei strai... 79 5e-13 (Q3AN25) RecName: Full=Orotate phosphoribosyltransferase; ... 79 5e-13 CP000570_3729(CP000570|pid:none) Burkholderia pseudomallei 668 c... 79 5e-13 CP000806_1512(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 79 5e-13 (Q92AH7) RecName: Full=Orotate phosphoribosyltransferase; ... 79 7e-13 (A1SPW6) RecName: Full=Orotate phosphoribosyltransferase; ... 79 7e-13 CP000378_2771(CP000378|pid:none) Burkholderia cenocepacia AU 105... 79 7e-13 AM711867_494(AM711867|pid:none) Clavibacter michiganensis subsp.... 79 9e-13 AF068902_7(AF068902|pid:none) Streptococcus pneumoniae D-glutami... 79 9e-13 (Q9K9W3) RecName: Full=Orotate phosphoribosyltransferase; ... 79 9e-13 CP000390_1467(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 78 1e-12 AM747720_209(AM747720|pid:none) Burkholderia cenocepacia J2315 c... 78 2e-12 CU459141_138(CU459141|pid:none) Acinetobacter baumannii str. AYE... 78 2e-12 CP000918_709(CP000918|pid:none) Streptococcus pneumoniae 70585, ... 78 2e-12 CP000151_235(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 78 2e-12 CP000440_233(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 78 2e-12 AM849034_230(AM849034|pid:none) Clavibacter michiganensis subsp.... 78 2e-12 CU468230_3324(CU468230|pid:none) Acinetobacter baumannii str. SD... 77 2e-12 CP000412_1237(CP000412|pid:none) Lactobacillus delbrueckii subsp... 77 2e-12 (A3M9Y5) RecName: Full=Orotate phosphoribosyltransferase; ... 77 2e-12 CP000407_999(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 77 2e-12 CP000863_3535(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 77 2e-12 CP000936_728(CP000936|pid:none) Streptococcus pneumoniae Hungary... 77 2e-12 (A8LRS7) RecName: Full=Orotate phosphoribosyltransferase; ... 77 2e-12 (Q97RT8) RecName: Full=Orotate phosphoribosyltransferase; ... 77 2e-12 (Q6L2K9) RecName: Full=Orotate phosphoribosyltransferase; ... 77 2e-12 AM420293_6992(AM420293|pid:none) Saccharopolyspora erythraea NRR... 77 3e-12 (P25972) RecName: Full=Orotate phosphoribosyltransferase; ... 77 3e-12 CP000240_1450(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 77 3e-12 (Q6F6Z6) RecName: Full=Orotate phosphoribosyltransferase; ... 77 4e-12 CP000394_893(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 77 4e-12 CP000252_2578(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 77 4e-12 CP000239_2316(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 77 4e-12 (A0QLX9) RecName: Full=Orotate phosphoribosyltransferase; ... 77 4e-12 CP000360_1174(CP000360|pid:none) Acidobacteria bacterium Ellin34... 77 4e-12 CP000517_1147(CP000517|pid:none) Lactobacillus helveticus DPC 45... 76 5e-12 (Q03KS5) RecName: Full=Orotate phosphoribosyltransferase; ... 76 5e-12 (Q1GFQ6) RecName: Full=Orotate phosphoribosyltransferase; ... 76 6e-12 (Q5LZW8) RecName: Full=Orotate phosphoribosyltransferase; ... 75 8e-12 CP000100_2590(CP000100|pid:none) Synechococcus elongatus PCC 794... 75 8e-12 CP000408_1016(CP000408|pid:none) Streptococcus suis 98HAH33, com... 75 8e-12 AP009552_5645(AP009552|pid:none) Microcystis aeruginosa NIES-843... 75 8e-12 CP000576_300(CP000576|pid:none) Prochlorococcus marinus str. MIT... 75 1e-11 AP009380_1140(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 75 1e-11 (A2RLC0) RecName: Full=Orotate phosphoribosyltransferase; ... 75 1e-11 CP000854_639(CP000854|pid:none) Mycobacterium marinum M, complet... 75 1e-11 CP001150_241(CP001150|pid:none) Rhodobacter sphaeroides KD131 ch... 75 1e-11 (Q04LJ2) RecName: Full=Orotate phosphoribosyltransferase; ... 75 1e-11 CP000325_102(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 74 2e-11 AE016822_1882(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 74 2e-11 (Q3J555) RecName: Full=Orotate phosphoribosyltransferase; ... 74 2e-11 (P46534) RecName: Full=Orotate phosphoribosyltransferase; ... 74 2e-11 CP001620_286(CP001620|pid:none) Corynebacterium kroppenstedtii D... 74 2e-11 CP000485_3325(CP000485|pid:none) Bacillus thuringiensis str. Al ... 74 2e-11 (B7H6L8) RecName: Full=Orotate phosphoribosyltransferase; ... 74 2e-11 (A7GRK7) RecName: Full=Orotate phosphoribosyltransferase; ... 74 2e-11 CP001052_3613(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 74 2e-11 (Q8NM11) RecName: Full=Orotate phosphoribosyltransferase; ... 74 3e-11 DQ366744_15(DQ366744|pid:none) Uncultured Prochlorococcus marinu... 74 3e-11 CP001291_1098(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 74 3e-11 (B2FJX2) RecName: Full=Orotate phosphoribosyltransferase; ... 73 4e-11 AP008231_1518(AP008231|pid:none) Synechococcus elongatus PCC 630... 73 4e-11 CP000111_286(CP000111|pid:none) Prochlorococcus marinus str. MIT... 73 5e-11 CR931997_213(CR931997|pid:none) Corynebacterium jeikeium K411 co... 73 5e-11 (Q65JU3) RecName: Full=Orotate phosphoribosyltransferase; ... 73 5e-11 CP000875_2874(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 73 5e-11 U24682_1(U24682|pid:none) Enterococcus faecalis plasmid pKV48 py... 73 5e-11 AM398681_648(AM398681|pid:none) Flavobacterium psychrophilum JIP... 73 5e-11 CP001131_3603(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 73 5e-11 AP009384_4639(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 73 5e-11 (A8FD21) RecName: Full=Orotate phosphoribosyltransferase; ... 73 5e-11 AM942444_1788(AM942444|pid:none) Corynebacterium urealyticum DSM... 72 7e-11 (Q8UI98) RecName: Full=Orotate phosphoribosyltransferase; ... 72 7e-11 AE008688_390(AE008688|pid:none) Agrobacterium tumefaciens str. C... 72 7e-11 (Q81WF6) RecName: Full=Orotate phosphoribosyltransferase; ... 72 7e-11 BX248360_60(BX248360|pid:none) Corynebacterium diphtheriae gravi... 72 9e-11 CP001472_2350(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 72 9e-11 (B0RXL2) RecName: Full=Orotate phosphoribosyltransferase; ... 72 9e-11 (Q6N0N8) RecName: Full=Orotate phosphoribosyltransferase; ... 72 1e-10 BA000035_2600(BA000035|pid:none) Corynebacterium efficiens YS-31... 72 1e-10 CP000115_153(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,... 72 1e-10 (Q1JC80) RecName: Full=Orotate phosphoribosyltransferase; ... 71 1e-10 (Q28RK4) RecName: Full=Orotate phosphoribosyltransferase; ... 71 1e-10 CP000910_3356(CP000910|pid:none) Renibacterium salmoninarum ATCC... 71 1e-10 (Q5LQ42) RecName: Full=Orotate phosphoribosyltransferase; ... 71 1e-10 (P57622) RecName: Full=Orotate phosphoribosyltransferase; ... 71 2e-10 AM889285_1828(AM889285|pid:none) Gluconacetobacter diazotrophicu... 70 3e-10 (Q3BNB6) RecName: Full=Orotate phosphoribosyltransferase; ... 70 3e-10 (A4WPB6) RecName: Full=Orotate phosphoribosyltransferase; ... 70 3e-10 CP000685_2593(CP000685|pid:none) Flavobacterium johnsoniae UW101... 70 3e-10 CP000009_1935(CP000009|pid:none) Gluconobacter oxydans 621H, com... 70 3e-10 AP010656_489(AP010656|pid:none) Candidatus Azobacteroides pseudo... 70 3e-10 (Q2J1V2) RecName: Full=Orotate phosphoribosyltransferase; ... 70 3e-10 AE010300_2986(AE010300|pid:none) Leptospira interrogans serovar ... 70 3e-10 CP001600_48(CP001600|pid:none) Edwardsiella ictaluri 93-146, com... 70 3e-10 (A8AXM7) RecName: Full=Orotate phosphoribosyltransferase; ... 70 3e-10 CP000088_3001(CP000088|pid:none) Thermobifida fusca YX, complete... 70 3e-10 (Q7V4S7) RecName: Full=Orotate phosphoribosyltransferase; ... 70 3e-10 (Q1JHA9) RecName: Full=Orotate phosphoribosyltransferase; ... 70 3e-10 AP006725_4841(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 70 3e-10 (A2CCL7) RecName: Full=Orotate phosphoribosyltransferase; ... 70 4e-10 (Q9A076) RecName: Full=Orotate phosphoribosyltransferase; ... 70 4e-10 (B5XTG0) RecName: Full=Orotate phosphoribosyltransferase; ... 70 4e-10 (A2BUQ6) RecName: Full=Orotate phosphoribosyltransferase; ... 70 4e-10 (A2RF04) RecName: Full=Orotate phosphoribosyltransferase; ... 70 4e-10 (P65919) RecName: Full=Orotate phosphoribosyltransferase; ... 70 4e-10 CP000233_818(CP000233|pid:none) Lactobacillus salivarius UCC118,... 70 4e-10 AY388209_1(AY388209|pid:none) Bacillus weihenstephanensis strain... 70 4e-10 AY388210_1(AY388210|pid:none) Bacillus sp. AH 1247 orotate phosp... 69 6e-10 (P65916) RecName: Full=Orotate phosphoribosyltransferase; ... 69 6e-10 CP000633_887(CP000633|pid:none) Agrobacterium vitis S4 chromosom... 69 6e-10 CP000860_6(CP000860|pid:none) Candidatus Desulforudis audaxviato... 69 6e-10 (A3CN88) RecName: Full=Orotate phosphoribosyltransferase; ... 69 6e-10 (Q97N11) RecName: Full=Orotate phosphoribosyltransferase; ... 69 6e-10 (A4YL97) RecName: Full=Orotate phosphoribosyltransferase; ... 69 7e-10 AM295250_816(AM295250|pid:none) Staphylococcus carnosus subsp. c... 69 7e-10 CP000967_4615(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 69 7e-10 (A5CVN5) RecName: Full=Orotate phosphoribosyltransferase; ... 69 7e-10 (Q8VR31) RecName: Full=Orotate phosphoribosyltransferase; ... 69 7e-10 AE013598_497(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA... 69 7e-10 AY388222_1(AY388222|pid:none) Bacillus sp. AH 547 orotate phosph... 69 1e-09 AP006627_2321(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 69 1e-09 AM942759_3122(AM942759|pid:none) Proteus mirabilis strain HI4320... 69 1e-09 CP001618_3622(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 69 1e-09 BX640450_282(BX640450|pid:none) Bordetella bronchiseptica strain... 69 1e-09 (A9I0G7) RecName: Full=Orotate phosphoribosyltransferase; ... 69 1e-09 CR936503_958(CR936503|pid:none) Lactobacillus sakei strain 23K c... 69 1e-09 (Q5HGM7) RecName: Full=Orotate phosphoribosyltransferase; ... 69 1e-09 (Q7W3H5) RecName: Full=Orotate phosphoribosyltransferase; ... 69 1e-09 AY388182_1(AY388182|pid:none) Bacillus sp. AH 641 orotate phosph... 69 1e-09 BX640435_209(BX640435|pid:none) Bordetella parapertussis strain ... 69 1e-09 (Q7WEU9) RecName: Full=Orotate phosphoribosyltransferase; ... 69 1e-09 CP000859_3170(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 69 1e-09 CP001087_1134(CP001087|pid:none) Desulfobacterium autotrophicum ... 68 1e-09 (P77889) RecName: Full=Orotate phosphoribosyltransferase; ... 68 1e-09 AP006618_5418(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 68 1e-09 CP000109_1892(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 68 1e-09 (A9MVN7) RecName: Full=Orotate phosphoribosyltransferase; ... 68 1e-09 DQ460575_1(DQ460575|pid:none) Streptococcus vestibularis isolate... 68 2e-09 CP001341_647(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 68 2e-09 DQ460568_1(DQ460568|pid:none) Streptococcus salivarius isolate 2... 68 2e-09 DQ460563_1(DQ460563|pid:none) Streptococcus salivarius isolate 1... 68 2e-09 DQ460586_1(DQ460586|pid:none) Streptococcus salivarius isolate 2... 68 2e-09 DQ460567_1(DQ460567|pid:none) Streptococcus salivarius isolate 2... 68 2e-09 AY388208_1(AY388208|pid:none) Bacillus sp. AH 1132 orotate phosp... 68 2e-09 DQ460574_1(DQ460574|pid:none) Streptococcus vestibularis isolate... 68 2e-09 CP000803_430(CP000803|pid:none) Francisella tularensis subsp. ho... 68 2e-09 (Q7MY25) RecName: Full=Orotate phosphoribosyltransferase; ... 68 2e-09 AM233362_507(AM233362|pid:none) Francisella tularensis subsp. ho... 68 2e-09 (A6TFN4) RecName: Full=Orotate phosphoribosyltransferase; ... 68 2e-09 CP000822_4964(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 67 2e-09 DQ460587_1(DQ460587|pid:none) Streptococcus salivarius isolate 2... 67 2e-09 FJ200335_1(FJ200335|pid:none) Streptococcus thermophilus orotate... 67 2e-09 (A5EST0) RecName: Full=Orotate phosphoribosyltransferase; ... 67 2e-09 (A4W507) RecName: Full=Orotate phosphoribosyltransferase; ... 67 2e-09 AY388184_1(AY388184|pid:none) Bacillus sp. AH 676 orotate phosph... 67 2e-09 (Q20WV6) RecName: Full=Orotate phosphoribosyltransferase; ... 67 2e-09 BX569689_238(BX569689|pid:none) Synechococcus sp. WH8102 complet... 67 3e-09 AY388221_1(AY388221|pid:none) Bacillus sp. AH 546 orotate phosph... 67 3e-09 CP000608_1316(CP000608|pid:none) Francisella tularensis subsp. t... 67 3e-09 BA000040_8134(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 67 3e-09 AY939844_44(AY939844|pid:none) Cyanophage P-SSM2, complete genome. 67 3e-09 FJ200338_1(FJ200338|pid:none) Streptococcus thermophilus orotate... 67 3e-09 (Q89BL4) RecName: Full=Orotate phosphoribosyltransferase; ... 67 3e-09 (A1JHW8) RecName: Full=Orotate phosphoribosyltransferase; ... 67 3e-09 (Q7VSN4) RecName: Full=Orotate phosphoribosyltransferase; ... 67 3e-09 (A8GLE9) RecName: Full=Orotate phosphoribosyltransferase; ... 67 3e-09 AY388212_1(AY388212|pid:none) Bacillus sp. AH 1271 orotate phosp... 67 3e-09 AY388188_1(AY388188|pid:none) Bacillus sp. AH 812 orotate phosph... 67 3e-09 CP000937_300(CP000937|pid:none) Francisella philomiragia subsp. ... 67 3e-09 CU458896_4230(CU458896|pid:none) Mycobacterium abscessus chromos... 67 3e-09 CP001196_3518(CP001196|pid:none) Oligotropha carboxidovorans OM5... 67 4e-09 FM209186_5726(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 67 4e-09 (Q48AN2) RecName: Full=Orotate phosphoribosyltransferase; ... 66 5e-09 (A9MKN3) RecName: Full=Orotate phosphoribosyltransferase; ... 66 5e-09 CP000319_439(CP000319|pid:none) Nitrobacter hamburgensis X14, co... 66 5e-09 AX078058_1(AX078058|pid:none) Sequence 2 from Patent WO0107620. 66 5e-09 AB109468_1(AB109468|pid:none) Mortierella alpina ura5 gene for o... 66 5e-09 M12926_1(M12926|pid:none) Yeast (S.cerevisiae) URA3 gene encodin... 66 6e-09 CP001280_1297(CP001280|pid:none) Methylocella silvestris BL2, co... 66 6e-09 CP000089_122(CP000089|pid:none) Dechloromonas aromatica RCB, com... 66 6e-09 AY388204_1(AY388204|pid:none) Bacillus anthracis strain Ames oro... 66 6e-09 CP000474_510(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 66 6e-09 (Q87T92) RecName: Full=Orotate phosphoribosyltransferase; ... 65 8e-09 AP008957_1395(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 65 8e-09 (A6LS60) RecName: Full=Orotate phosphoribosyltransferase; ... 65 8e-09 CP000471_3688(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 65 8e-09 CP000431_5462(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 65 8e-09 U38241_1(U38241|pid:none) Pseudomonas aeruginosa orotate phophor... 65 8e-09 (A1AXP4) RecName: Full=Orotate phosphoribosyltransferase; ... 65 8e-09 (A4TSE1) RecName: Full=Orotate phosphoribosyltransferase; ... 65 1e-08 FJ200336_1(FJ200336|pid:none) Streptococcus thermophilus orotate... 65 1e-08 (Q8Z2H5) RecName: Full=Orotate phosphoribosyltransferase; ... 65 1e-08 AY657552_1(AY657552|pid:none) Synthetic construct Peudomonas aer... 65 1e-08 (P50587) RecName: Full=Orotate phosphoribosyltransferase; ... 65 1e-08 CP000284_2479(CP000284|pid:none) Methylobacillus flagellatus KT,... 65 1e-08 (Q5PC26) RecName: Full=Orotate phosphoribosyltransferase; ... 65 1e-08 CP000970_3825(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 65 1e-08 CP000472_2098(CP000472|pid:none) Shewanella piezotolerans WP3, c... 65 1e-08 AF070928_1(AF070928|pid:none) Ajellomyces capsulatus orotidine-5... 65 1e-08 AP011115_5592(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 65 1e-08 CP000821_379(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 65 1e-08 AE014075_4371(AE014075|pid:none) Escherichia coli CFT073, comple... 64 2e-08 (Q83J15) RecName: Full=Orotate phosphoribosyltransferase; ... 64 2e-08 (Q0SYG9) RecName: Full=Orotate phosphoribosyltransferase; ... 64 2e-08 (B5YWE0) RecName: Full=Orotate phosphoribosyltransferase; ... 64 2e-08 (A7ZTJ3) RecName: Full=Orotate phosphoribosyltransferase; ... 64 2e-08 (A8A6A4) RecName: Full=Orotate phosphoribosyltransferase; ... 64 2e-08 CP000961_4516(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 64 2e-08 (B7MFK3) RecName: Full=Orotate phosphoribosyltransferase; ... 64 2e-08 CP000140_3588(CP000140|pid:none) Parabacteroides distasonis ATCC... 64 2e-08 CP000020_110(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 64 2e-08 CP000789_590(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 64 2e-08 AM286690_207(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 64 2e-08 X65783_3(X65783|pid:none) S. cerevisiae SEC65, URA5 and MDM1 gen... 64 2e-08 X54230_1(X54230|pid:none) D.melanogaster 5' rl1, rl2, UMP clone ... 64 2e-08 (P13298) RecName: Full=Orotate phosphoribosyltransferase 1; ... 64 2e-08 CP000243_4104(CP000243|pid:none) Escherichia coli UTI89, complet... 64 2e-08 CP000750_4157(CP000750|pid:none) Kineococcus radiotolerans SRS30... 64 2e-08 CP001139_109(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 64 2e-08 (Q3SM42) RecName: Full=Orotate phosphoribosyltransferase; ... 64 3e-08 CP001013_4025(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 64 3e-08 (Q329L4) RecName: Full=Orotate phosphoribosyltransferase; ... 64 3e-08 (Q2S8N8) RecName: Full=Orotate phosphoribosyltransferase; ... 63 4e-08 CP001078_2257(CP001078|pid:none) Clostridium botulinum E3 str. A... 63 4e-08 (A1WZE3) RecName: Full=Orotate phosphoribosyltransferase; ... 63 4e-08 (P41923) RecName: Full=Orotate phosphoribosyltransferase; ... 63 4e-08 (Q4ZZY3) RecName: Full=Orotate phosphoribosyltransferase; ... 63 4e-08 (A5EY64) RecName: Full=Orotate phosphoribosyltransferase; ... 63 5e-08 CP001056_2499(CP001056|pid:none) Clostridium botulinum B str. Ek... 63 5e-08 (Q87F16) RecName: Full=Orotate phosphoribosyltransferase; ... 63 5e-08 (Q4K3R9) RecName: Full=Orotate phosphoribosyltransferase; ... 63 5e-08 (Q7VKV3) RecName: Full=Orotate phosphoribosyltransferase; ... 63 5e-08 CR380956_277(CR380956|pid:none) Candida glabrata strain CBS138 c... 63 5e-08 AM181176_5861(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 63 5e-08 FM954972_153(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 63 5e-08 CP000267_3865(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 62 7e-08 CU861906_167(CU861906|pid:none) Ralstonia solanacearum strain Mo... 62 7e-08
>CP000583_115(CP000583|pid:none) Ostreococcus lucimarinus CCE9901 chromosome 3, complete sequence. Length = 474
Score = 263 bits (673), Expect(2) = e-122 Identities = 143/282 (50%), Positives = 191/282 (67%), Gaps = 4/282 (1%) Frame = +2
Query: 71 LVLKLNEIDAIKLGEFKLKSGIISPIYIDLRVTVSSPPLLAAIAEMMYQKVYKSGNAQET 250 LV++L+EI+A+K GEFKLKSGI+SPIY+DLRV VS P +L A+AE M++ + +G + Sbjct: 8 LVMRLHEIEAVKFGEFKLKSGIMSPIYVDLRVIVSYPDVLTAVAECMWETLKANGATFDN 67
Query: 251 PALVCGVPYTALPIATGMSIANNIPMVVRRKEAKAYGTKQLIEGRFKEGDNVLVVEDLVT 430 +CGVPYTALPIAT MS+A++ PM++RRKE KAYGTK+ IEG F+ G L VEDLVT Sbjct: 68 ---MCGVPYTALPIATCMSLAHDCPMLMRRKEVKAYGTKKQIEGAFEAGQTCLCVEDLVT 124
Query: 431 SGASVLETVRDLNSVGLKVTDVVVLLDRQQGARQALEKQGYRLHSVFTMEELINTLIEAG 610 SGASV+ETV L SVGLKV DVVVL+DR+QG L G RLHSV + ++ TL AG Sbjct: 125 SGASVMETVEPLESVGLKVKDVVVLIDREQGGEARLASHGLRLHSVLPLSRVLKTLEAAG 184
Query: 611 KLTGRTLELVQSFLDANRNXXXXXXXXXXXXXXXXIVINKP----FEERAKLASNPMASK 778 K++ ++ V+ F+ AN+ + KP + R++L N A + Sbjct: 185 KMSSELVQNVKDFIAANQTMPVAGAE-----------VKKPTRMSYTARSELTDNACAKQ 233
Query: 779 LFTLMSSKKTNLAVAADLTDKQQLLDLAESIGSEICVLKTPC 904 LF LM +KKTNL VAAD+ ++LL++AE +G EIC+LKT C Sbjct: 234 LFKLMETKKTNLCVAADVDTAKELLEMAEILGPEICMLKTHC 275
Score = 200 bits (508), Expect(2) = e-122 Identities = 103/200 (51%), Positives = 132/200 (66%), Gaps = 3/200 (1%) Frame = +3
Query: 894 RPHVDIIDNYDEEFIKSLKCIAAKHNFLIFEDRKFADIGNTVKYQFENGVYKISKWADMV 1073 + H D+ ++ E F L IA KHNF+IFEDRKFADIGNTV Q+ +GV+KI+ W+ + Sbjct: 272 KTHCDLYPDFTESFGAQLMAIAEKHNFMIFEDRKFADIGNTVVGQYSSGVHKIADWSHIT 331
Query: 1074 TVHGVAGSSIVDGFKSGLKEYGSGLLLLAQMSSKGSLCVGDYTTQMIEMANNNKEEVMGL 1253 H V GS I+DG KS G GLLLLA+MSSKG++ G+YT I MA + + VMG Sbjct: 332 NAHIVPGSGIIDGLKSVGLSKGRGLLLLAEMSSKGTMAKGEYTEAAIGMAAQHPDFVMGF 391
Query: 1254 IC---QERLPSMTDGLVLMTPGVQFNSTGDAMGQQYNTPEYIIKEKNTDVIIVGRGIYQS 1424 I + + GL+ MTPGVQ GDAMGQQYNTP +I E +DVIIVGRGIY++ Sbjct: 392 ISTNPKAWKAEWSKGLINMTPGVQLQVGGDAMGQQYNTPHNVIVENGSDVIIVGRGIYKA 451
Query: 1425 NDPKSVANKYRTAAWETYQS 1484 +DP + A +YR A WE YQ+ Sbjct: 452 SDPAAAAKEYRAAGWEAYQT 471
Score = 141 bits (355), Expect = 1e-31 Identities = 68/129 (52%), Positives = 91/129 (70%) Frame = +3
Query: 1671 FEERAKLASNPMASKLFTLMSSKKTNLAVAADLTDKQQLLDLAESIGSEICVLKTHVDII 1850 + R++L N A +LF LM +KKTNL VAAD+ ++LL++AE +G EIC+LKTH D+ Sbjct: 219 YTARSELTDNACAKQLFKLMETKKTNLCVAADVDTAKELLEMAEILGPEICMLKTHCDLY 278
Query: 1851 DNYDEEFIKPLKCIAAKHNFLIFEDRKFADIGNTVKYQFENGVYKISKWADMVTVHGVAG 2030 ++ E F L IA KHNF+IFEDRKFADIGNTV Q+ +GV+KI+ W+ + H V G Sbjct: 279 PDFTESFGAQLMAIAEKHNFMIFEDRKFADIGNTVVGQYSSGVHKIADWSHITNAHIVPG 338
Query: 2031 SSIVDGFKS 2057 S I+DG KS Sbjct: 339 SGIIDGLKS 347
Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +3
Query: 2064 KEYNTPEYIIKEKNTDVIIVGRGIYQSNDPKSVANKYRTAAWETYQS 2204 ++YNTP +I E +DVIIVGRGIY+++DP + A +YR A WE YQ+ Sbjct: 425 QQYNTPHNVIVENGSDVIIVGRGIYKASDPAAAAKEYRAAGWEAYQT 471
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 3,051,588,941 Number of extensions: 57201781 Number of successful extensions: 194871 Number of sequences better than 10.0: 980 Number of HSP's gapped: 193706 Number of HSP's successfully gapped: 1375 Length of query: 752 Length of database: 1,051,180,864 Length adjustment: 136 Effective length of query: 616 Effective length of database: 611,008,840 Effective search space: 376381445440 Effective search space used: 376381445440 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
2 |
VH (FL, L) |
0 |
VF (FL, S) |
4 |
AH (FL, L) |
0 |
AF (FL, S) |
1 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
2 |
CH (FL, L) |
0 |
CF (FL, S) |
6 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |