Contig-U15836-1 |
Contig ID |
Contig-U15836-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
gap included |
Contig length |
2269 |
Chromosome number (1..6, M) |
5 |
Chromosome length |
5062330 |
Start point |
3634050 |
End point |
3635313 |
Strand (PLUS/MINUS) |
PLUS |
Number of clones |
2 |
Number of EST |
5 |
Link to clone list |
U15836 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 2.20 |
Homology vs DNA |
Query= Contig-U15836-1 (Contig-U15836-1Q) /CSM_Contig/Contig-U15836-1Q.Seq.d (2279 letters)
Database: ddbj_B 98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ431386) Dictyostelium discoideum cDNA clone:ddv14b05, 3' ... 712 0.0 2 (BJ374643) Dictyostelium discoideum cDNA clone:ddc9g13, 3' e... 652 0.0 3 (BJ361047) Dictyostelium discoideum cDNA clone:ddc9g13, 5' e... 609 0.0 2 (BJ413049) Dictyostelium discoideum cDNA clone:ddv14b05, 5' ... 511 0.0 3 (EX841475) CBNC10796.fwd CBNC Phycomyces blakesleeanus NRRL1... 60 4e-04 1 (EX818223) CBNA5979.fwd CBNA Phycomyces blakesleeanus NRRL15... 60 4e-04 1 (FF752801) XABT60806.rev Gateway compatible cien cDNA librar... 42 0.001 3 (AZ374244) 1M0126B20R Mouse 10kb plasmid UUGC1M library Mus ... 40 0.001 2 (DE229722) Trifolium pratense DNA, clone:RCG22917. 40 0.005 2 (AM999887) Wolbachia endosymbiont of Culex quinquefasciatus ... 46 0.005 2 (BZ244396) CH230-261E2.TJ CHORI-230 Segment 2 Rattus norvegi... 44 0.010 2 (DH504812) Monosiga ovata DNA, fosmid clone: MOF-075I13, gen... 40 0.043 2 (FF687530) XABT101339.rev Gateway compatible cien cDNA libra... 44 0.047 3 (I52155) Sequence 65 from patent US 5646029. 42 0.072 2 (AR051981) Sequence 65 from patent US 5830747. 42 0.072 2 (AL254753) Tetraodon nigroviridis genome survey sequence PUC... 38 0.084 2 (CT565186) Rainbow trout brain SSH library from warm, cold a... 38 0.085 2 (CT564653) Rainbow trout brain SSH library from warm, cold a... 38 0.085 2 (CP001056) Clostridium botulinum B str. Eklund 17B, complete... 38 0.15 26 (CT566322) Rainbow trout liver SSH library from warm, cold a... 38 0.20 2 (FK899482) EST_crog_evm_808359 crog_evm Caligus rogercressey... 48 0.22 2 (CT568424) Rainbow trout liver SSH library from warm, cold a... 38 0.27 2 (CT568436) Rainbow trout liver SSH library from warm, cold a... 38 0.29 2 (EK037479) 1092959477987 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.32 3 (FK435656) 454GmaGlobSeed170288 Soybean Seeds Containing Glo... 50 0.37 1 (AM926765) Carassius auratus EST, clone cdn15P0009B23, 5'-en... 44 0.40 2 (EE001618) ROE00012490 Rhizopus oryzae Company Rhizopus oryz... 38 0.48 2 (DX801057) 3648259 VV10 Chlamydomonas reinhardtii genomic cl... 46 0.50 2 (EE002425) ROE00012886 Rhizopus oryzae Company Rhizopus oryz... 38 0.52 2 (CF611828) laf05h12.y1 Gastric Epithelial Progenitor Mus mus... 44 0.56 2 (FG078020) UI-FF-IF0-abt-n-19-0-UI.r1 Ceratitis capitata emb... 40 0.63 2 (BW408568) Ciona intestinalis cDNA, clone:cima803m04, 3'end,... 44 0.64 2 (EE008462) ROE00004420 Rhizopus oryzae Company Rhizopus oryz... 38 0.66 2 (BZ033107) oek66h07.g1 B.oleracea002 Brassica oleracea genom... 38 0.66 3 (EE009624) ROE00004013 Rhizopus oryzae Company Rhizopus oryz... 38 0.71 2 (DQ120981) Hucho taimen clone ZB-36 microsatellite sequence. 40 0.72 2 (AC164304) Mus musculus BAC clone RP23-261B24 from chromosom... 40 0.74 6 (EA690339) Sequence 69218 from patent US 7365185. 40 0.75 2 (EJ155669) 1092344028731 Global-Ocean-Sampling_GS-27-01-01-1... 46 0.76 2 (EK281251) 1095462296365 Global-Ocean-Sampling_GS-31-01-01-1... 34 0.95 3 (DX547322) GH_MBb0052O20r GH_MBb Gossypium hirsutum genomic ... 42 1.1 2 (ET678567) CHO_OF325xf01r1.ab1 CHO_OF Nicotiana tabacum geno... 40 1.3 2 (AC143806) Macaca mulatta clone CH250-268L12, *** SEQUENCING... 40 1.5 2 (AL732581) Mouse DNA sequence from clone RP24-262H17 on chro... 48 1.5 1 (AC099486) Homo sapiens chromosome 5 clone CTD-2011G10, comp... 48 1.5 1 (AC099070) Rattus norvegicus clone CH230-31A13, WORKING DRAF... 48 1.5 1 (AC095980) Rattus norvegicus clone CH230-11L5, WORKING DRAFT... 48 1.5 1 (AC020725) Homo sapiens chromosome 5 clone RP11-495N17, WORK... 48 1.5 1 (AZ025070) RPCI-23-386J7.TJ RPCI-23 Mus musculus genomic clo... 48 1.5 1 (BZ177916) CH230-506F7.TJ CHORI-230 Segment 2 Rattus norvegi... 48 1.5 1 (BB980159) Plasmodium berghei str. ANKA cDNA clone: OK010322... 48 1.5 1 (FE853976) CAFS792.fwd CAFS Pichia stipitis oxygen limited d... 48 1.5 1 (FE848570) CAFO1591.fwd CAFO Pichia stipitis aerobic xylose ... 48 1.5 1 (CP000413) Lactobacillus gasseri ATCC 33323, complete genome. 48 1.5 1 (CP000312) Clostridium perfringens SM101, complete genome. 48 1.5 1 (CP000254) Methanospirillum hungatei JF-1, complete genome. 48 1.5 1 (CP000246) Clostridium perfringens ATCC 13124, complete genome. 48 1.5 1 (EY371927) CAXA13727.fwd CAXA Helobdella robusta Subtracted ... 44 1.5 2 (BM321931) EtESTee19c06.y1 Eimeria tenella M5-6 cDNA Neg Sel... 40 1.6 2 (AC116960) Dictyostelium discoideum chromosome 2 map complem... 32 1.6 14 (AC132111) Mus musculus BAC clone RP24-200H19 from 14, compl... 42 1.7 4 (AL663108) Mouse DNA sequence from clone RP23-19H23 on chrom... 34 1.7 8 (EA024479) Sequence 1498 from patent US 7135558. 34 1.8 4 (CQ614555) Sequence 42313 from Patent WO0171042. 34 1.8 4 (CE250058) tigr-gss-dog-17000335862386 Dog Library Canis lup... 40 1.8 2 (BE195101) HVSMEh0088E19f Hordeum vulgare 5-45 DAP spike EST... 40 2.2 2 (BW317378) Ciona intestinalis cDNA, clone:ciht035e03, 5' end... 42 2.3 2 (DW253519) UI-S-GB1-aae-b-14-0-UI.s1 UI-S-GB1 Euprymna scolo... 36 2.3 2 (FF723089) XABT39495.rev Gateway compatible cien cDNA librar... 42 2.4 2 (BW232699) Ciona intestinalis cDNA, clone:ciad103d23, 5' end... 42 2.4 2 (FF997247) CBWU113743.g1 Yutaka Satou unpublished cDNA libra... 42 2.4 2 (BW317882) Ciona intestinalis cDNA, clone:ciht036o23, 5' end... 42 2.4 2 (FF705348) XABT113054.rev Gateway compatible cien cDNA libra... 42 2.5 2 (BW300742) Ciona intestinalis cDNA, clone:cinc019i05, 5' end... 42 2.5 2 (FF715812) XABT34693.rev Gateway compatible cien cDNA librar... 42 2.5 2 (BW130798) Ciona intestinalis cDNA, clone:rcign025g15, 3' en... 42 2.5 2 (FF777366) XABT77823.rev Gateway compatible cien cDNA librar... 42 2.5 2 (FF950208) CBWU80650.g1 Yutaka Satou unpublished cDNA librar... 42 2.6 2 (FF866239) CBWU11916.g1 Yutaka Satou unpublished cDNA librar... 42 2.6 2 (CQ597797) Sequence 25555 from Patent WO0171042. 34 2.6 4 (FF887406) CBWU24898.g1 Yutaka Satou unpublished cDNA librar... 42 2.6 2 (BW408567) Ciona intestinalis cDNA, clone:cima803m03, 3'end,... 42 2.6 2 (BW489707) Ciona intestinalis cDNA, clone:cima022g11, 3'end,... 42 2.6 2 (BW092210) Ciona intestinalis cDNA, clone:rciad103d23, 3' en... 42 2.7 2 (BW022741) Ciona intestinalis cDNA, clone:rcibd073m15, 3' en... 42 2.7 2 (FH000332) CHO_OF001xh22f1.ab1 CHO_OF Nicotiana tabacum geno... 40 2.7 2 (BW007253) Ciona intestinalis cDNA, clone:rcibd002m13, 3' en... 42 2.7 2 (FF950207) CBWU80650.b1 Yutaka Satou unpublished cDNA librar... 42 2.7 2 (BW186161) Ciona intestinalis cDNA, clone:rciht035e03, 3' en... 42 2.7 2 (BW186659) Ciona intestinalis cDNA, clone:rciht036o23, 3' en... 42 2.7 2 (BW171627) Ciona intestinalis cDNA, clone:rcinc019i05, 3' en... 42 2.7 2 (DU078390) 52822 Tomato HindIII BAC Library Solanum lycopers... 36 2.8 2 (DU986393) KBrH078P13R KBrH (HindIII) BAC library Brassica r... 34 2.9 3 (EJ880172) 1093018392201 Global-Ocean-Sampling_GS-30-02-01-1... 42 3.1 2 (FH136304) CHO_OF3663xb10r1.ab1 CHO_OF3 Nicotiana tabacum ge... 40 3.1 3 (FI138173) MUGQ_CH252P528H24T7_CH0235_090 CHORI-252 Vervet M... 36 3.1 2 (EJ875419) 1093018366857 Global-Ocean-Sampling_GS-30-02-01-1... 42 3.1 2 (DT551666) EST1062306 GH_TMO Gossypium hirsutum cDNA, mRNA s... 38 3.1 2 (BF276054) GA__Eb0025P14f Gossypium arboreum 7-10 dpa fiber ... 38 3.2 2 (EK074820) 1092961023427 Global-Ocean-Sampling_GS-31-01-01-1... 36 3.3 2 (DT572431) EST1083071 GH_TMO Gossypium hirsutum cDNA, mRNA s... 38 3.4 2 (ED533874) KBrB125O17R KBrB, Brassica rapa BamHI BAC library... 32 3.9 3 (CW867024) she3f2-28.g_054.ab1 Whole-genome shotgun library ... 32 4.0 3 (ES848985) UFL_662_03 Cotton fiber 0-10 day post anthesis Go... 38 4.0 2 (ES815871) UFL_263_94 Cotton fiber 0-10 day post anthesis Go... 38 4.4 2 (ED529957) KBrB120I19R KBrB, Brassica rapa BamHI BAC library... 32 4.5 3 (U42402) Drosophila melanogaster stripe b protein mRNA, comp... 38 4.7 3 (CU019628) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 5.0 11 (CT022475) KBrH133E02 genomic clone, KBrH (HindIII) BAC libr... 32 5.1 3 (AC176175) Strongylocentrotus purpuratus clone R3-3066I4, WO... 40 5.2 5 (CQ589581) Sequence 17339 from Patent WO0171042. 38 5.4 3 (AK115138) Ciona intestinalis cDNA, clone:cieg034e16, full i... 42 5.4 2 (BJ704005) Ptyochromis sp. 'redtail sheller' cDNA clone:no57... 40 5.6 2 (BV069017) S212P6858FC7.T0 CZECHII/Ei Mus musculus STS genom... 46 5.8 1 (AC158926) Mus musculus chromosome 3, clone RP24-93J4, compl... 46 5.8 1 (AC102119) Mus musculus chromosome 19, clone RP23-173J6, com... 46 5.8 1 (AC101979) Mus musculus chromosome 3, clone RP24-338A7, comp... 46 5.8 1 (AB161975) Bacteriophage WOcauB1 genomic DNA, partial sequence. 46 5.8 1 (CS623720) Sequence 271 from Patent WO2006071466. 46 5.8 1 (AC150146) Gallus gallus clone WAG-70E18, WORKING DRAFT SEQU... 46 5.8 1 (AC150053) Gallus gallus clone CH261-175K22, WORKING DRAFT S... 46 5.8 1 (AC150048) Gallus gallus clone CH261-155G24, WORKING DRAFT S... 46 5.8 1 (CU582913) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 5.8 1 (CU467593) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 5.8 1 (AC196731) Gallus gallus chromosome UNKNOWN clone CH261-73E1... 46 5.8 1 (AC167877) Bos taurus clone CH240-207N6, WORKING DRAFT SEQUE... 46 5.8 1 (AZ054765) RPCI-23-413I7.TV RPCI-23 Mus musculus genomic clo... 46 5.8 1 (ER937099) AF__Bb0007N24f AF__Bb Aquilegia formosa genomic, ... 46 5.8 1 (EK455745) 1095468220828 Global-Ocean-Sampling_GS-32-01-01-1... 46 5.8 1 (EJ913773) 1093018549586 Global-Ocean-Sampling_GS-30-02-01-1... 46 5.8 1 (EJ822204) 1093017542646 Global-Ocean-Sampling_GS-30-02-01-1... 46 5.8 1 (EJ734575) 1092961082353 Global-Ocean-Sampling_GS-30-02-01-1... 46 5.8 1 (EJ724646) 1092959487345 Global-Ocean-Sampling_GS-30-02-01-1... 46 5.8 1 (EJ503250) 1095403663589 Global-Ocean-Sampling_GS-28-01-01-1... 46 5.8 1 (CR270177) Reverse strand read from insert in 5'HPRT inserti... 46 5.8 1 (CR229233) Reverse strand read from insert in 5'HPRT inserti... 46 5.8 1 (CR222517) Reverse strand read from insert in 5'HPRT inserti... 46 5.8 1 (AG419368) Mus musculus molossinus DNA, clone:MSMg01-289P07.... 46 5.8 1 (EC192613) SSE00003531 Streblomastix strix Non-normalized St... 46 5.8 1 (AM563170) Paracentrotus lividus EST, clone MPMGp1173M0210Q,... 46 5.8 1 (AM561872) Paracentrotus lividus EST, clone MPMGp1172D1899Q,... 46 5.8 1 (AM547466) Paracentrotus lividus EST, clone MPMGp1171D01103Q... 46 5.8 1 (AM223799) Paracentrotus lividus EST, clone MPMGp1174K1952Q,... 46 5.8 1 (AM223692) Paracentrotus lividus EST, clone MPMGp1174G0652Q,... 46 5.8 1 (CP000033) Lactobacillus acidophilus NCFM, complete genome. 46 5.8 1 (CT030242) Mouse DNA sequence from clone RP24-66D20 on chrom... 40 5.9 3 (ET919816) CHO_OF210xm02f1.ab1 CHO_OF Nicotiana tabacum geno... 40 5.9 3 (CU949894) Brassica napus GSS, clone JBnB139J12, end read, p... 32 6.3 3 (EB493654) 1099341565944 12-DrosW-norm-1P5Kb Drosophila will... 36 6.4 3 (DU123745) KBrH092B23F Brassica rapa BAC library KBrH Brassi... 32 6.5 3 (AC172600) Bos taurus clone CH240-260L13, WORKING DRAFT SEQU... 38 6.6 4 (BE822765) GM700018B20C10 Gm-r1070 Glycine max cDNA clone Gm... 38 6.6 2 (DX068751) KBrB077J07F KBrB, Brassica rapa BamHI BAC library... 32 7.1 3 (CU950048) Brassica napus GSS, clone JBnB139N16, end read, p... 32 7.2 3 (FP017317) Brassica napus GSS, clone JBnB002A15, end read, p... 32 7.2 3 (CU949585) Brassica napus GSS, clone JBnB139B13, end read, p... 32 7.2 3 (FP023453) Brassica napus GSS, clone JBnB090M15, end read, p... 32 7.3 3 (CU971094) Brassica napus GSS, clone JBnB072K14, end read, p... 32 7.3 3 (AC115592) Dictyostelium discoideum chromosome 2 map 1-12595... 34 7.3 8 (U42403) Drosophila melanogaster stripe a protein mRNA, comp... 38 7.3 3 (DX033446) KBrB030O07R KBrB, Brassica rapa BamHI BAC library... 32 7.5 3 (AC120994) Rattus norvegicus clone CH230-261E2, WORKING DRAF... 44 7.5 3 (AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 34 7.6 12 (FP018819) Brassica napus GSS, clone JBnB021J03, end read, p... 32 7.8 3 (FH309319) CHO_OF4423xo04r1.ab1 CHO_OF4 Nicotiana tabacum ge... 40 8.1 2 (DX046076) KBrB047J14R KBrB, Brassica rapa BamHI BAC library... 32 8.2 3 (DX023609) KBrB018A14R KBrB, Brassica rapa BamHI BAC library... 32 8.2 3 (CU940111) Brassica napus GSS, clone JBnB079H13, end read, p... 32 8.2 3 (BJ694501) Ptyochromis sp. 'redtail sheller' cDNA clone:no55... 40 8.2 2 (CU965211) Brassica napus GSS, clone JBnB126L03, end read, p... 32 8.2 3 (CU965233) Brassica napus GSS, clone JBnB126L22, end read, p... 32 8.2 3 (DX016873) KBrB009C18R KBrB, Brassica rapa BamHI BAC library... 32 8.2 3 (BJ702654) Ptyochromis sp. 'redtail sheller' cDNA clone:no56... 40 8.4 2 (BJ703172) Ptyochromis sp. 'redtail sheller' cDNA clone:no56... 40 8.4 2 (CU946548) Brassica napus GSS, clone JBnB140E10, end read, p... 32 8.4 3 (CF588136) USDA-FP_121000-054 Acyrthosiphon pisum, Pea Aphid... 38 8.5 2 (CU971153) Brassica napus GSS, clone JBnB074A10, end read, p... 32 8.5 3 (BJ690954) Ptyochromis sp. 'redtail sheller' cDNA clone:no59... 40 8.6 2 (CU971333) Brassica napus GSS, clone JBnB078A18, end read, p... 32 9.0 3 (DR467630) WS00941.B21.1_P04 IS-B-N-A-10 Picea engelmannii x... 44 9.0 2 (AC113853) Rattus norvegicus clone CH230-139I7, WORKING DRAF... 42 9.1 4 (AC217642) Populus trichocarpa clone POP033-C07, complete se... 34 9.1 5 (DX074652) KBrB085G06R KBrB, Brassica rapa BamHI BAC library... 32 9.2 3 (DX909377) KBrH045I08F KBrH, Brassica rapa HindIII BAC libra... 32 9.3 3 (DY630677) hh_Ab_Pinky2003_000017384 Cichlid Pinky cDNA libr... 40 9.3 2 (AC124896) Rattus norvegicus clone CH230-4P23, WORKING DRAFT... 44 9.3 3 (CW979678) KBrH003I12R KBrH, Brassica rapa HindIII BAC libra... 32 9.3 3 (CT023180) KBrH134P10 genomic clone, KBrH (HindIII) BAC libr... 32 9.4 3 (DX076919) KBrB088F17R KBrB, Brassica rapa BamHI BAC library... 32 9.5 3 (AJ508881) Puccinia triticina microsatellite DNA, clone RB8. 36 9.5 2 (DX077743) KBrB089G23F KBrB, Brassica rapa BamHI BAC library... 32 9.6 3 (DX078570) KBrB090I07R KBrB, Brassica rapa BamHI BAC library... 32 9.8 3 (AC110371) Rattus norvegicus clone CH230-205M11, WORKING DRA... 42 9.8 4 (CU941721) Brassica napus GSS, clone JBnB122A19, end read, p... 32 9.8 3 (DX010665) KBrB001A03F KBrB, Brassica rapa BamHI BAC library... 32 9.9 3 (DX013348) KBrB004I11F KBrB, Brassica rapa BamHI BAC library... 32 9.9 3 (DX036078) KBrB034G12F KBrB, Brassica rapa BamHI BAC library... 32 9.9 3
>(BJ431386) Dictyostelium discoideum cDNA clone:ddv14b05, 3' end, single read. Length = 747
Score = 712 bits (359), Expect(2) = 0.0 Identities = 359/359 (100%) Strand = Plus / Minus
Query: 1502 ccatccaatgttgcaatttcatctggtttcgatcaattgtgtcatgcattagaatcgttt 1561 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 747 ccatccaatgttgcaatttcatctggtttcgatcaattgtgtcatgcattagaatcgttt 688
Query: 1562 actgcaattccattcaatcaaagatcaccacgtcctcttgctccaaatcaaagaccatcg 1621 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 687 actgcaattccattcaatcaaagatcaccacgtcctcttgctccaaatcaaagaccatcg 628
Query: 1622 tatcaaggcgcaaatccagtttctgatgtatggtcattaagatctttggaaatgctttgt 1681 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 627 tatcaaggcgcaaatccagtttctgatgtatggtcattaagatctttggaaatgctttgt 568
Query: 1682 aagaatattcatagatttgtattgaatccaaatgatgactatgctcgttctcaaatgatg 1741 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 567 aagaatattcatagatttgtattgaatccaaatgatgactatgctcgttctcaaatgatg 508
Query: 1742 ttggctgcttcatatgccggacttggctttggaaattcaggagttcatgcttgccatggt 1801 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 507 ttggctgcttcatatgccggacttggctttggaaattcaggagttcatgcttgccatggt 448
Query: 1802 atgagttatagtataagttcaatggttaaagattataaacctgaaggttattatggttt 1860 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 447 atgagttatagtataagttcaatggttaaagattataaacctgaaggttattatggttt 389
Score = 658 bits (332), Expect(2) = 0.0 Identities = 332/332 (100%) Strand = Plus / Minus
Query: 1870 tttaatccctcatggacaatctgttattctttcagcacctgcagtctttaaatttacagc 1929 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 379 tttaatccctcatggacaatctgttattctttcagcacctgcagtctttaaatttacagc 320
Query: 1930 tccttctaatcctgaacgtcatttactattagcaaagataatgggtgctgatatctcaaa 1989 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 319 tccttctaatcctgaacgtcatttactattagcaaagataatgggtgctgatatctcaaa 260
Query: 1990 tgcttctgaatcggatgcaggtgtattattatccaatcaaatagtaaaactcatgaagtt 2049 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 259 tgcttctgaatcggatgcaggtgtattattatccaatcaaatagtaaaactcatgaagtt 200
Query: 2050 attaaacgtcccaaatggtttacaagcattgggttataaagaatctgacattgatagtct 2109 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 199 attaaacgtcccaaatggtttacaagcattgggttataaagaatctgacattgatagtct 140
Query: 2110 tgtaaaaggaacacttcctcaacatagagttacaaaattaatgccaaagcaagctacata 2169 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 139 tgtaaaaggaacacttcctcaacatagagttacaaaattaatgccaaagcaagctacata 80
Query: 2170 tgatgatctttataaattatttaaagattcta 2201 |||||||||||||||||||||||||||||||| Sbjct: 79 tgatgatctttataaattatttaaagattcta 48
Score = 151 bits (76), Expect = 1e-31 Identities = 76/76 (100%) Strand = Plus / Minus
Query: 1002 ccatccaatgttgcaatttcatctggtttcgatcaattgtgtcatgcattagaatcgttt 1061 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 747 ccatccaatgttgcaatttcatctggtttcgatcaattgtgtcatgcattagaatcgttt 688
Query: 1062 actgcaattccattca 1077 |||||||||||||||| Sbjct: 687 actgcaattccattca 672
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number of Hits to DB: 2,511,893,833 Number of extensions: 145796650 Number of successful extensions: 11623091 Number of sequences better than 10.0: 197 Length of query: 2279 Length of database: 98,766,808,389 Length adjustment: 24 Effective length of query: 2255 Effective length of database: 96,409,374,237 Effective search space: 217403138904435 Effective search space used: 217403138904435 X1: 11 (21.8 bits) S2: 23 (46.1 bits)
|
protein update |
2009. 7.19 |
Homology vs Protein |
Query= Contig-U15836-1 (Contig-U15836-1Q) /CSM_Contig/Contig-U15836-1Q.Seq.d (2279 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q8R0N6) RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mit... 407 e-112 (Q4QQW3) RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mit... 403 e-110 (Q6P371) RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mit... 398 e-109 BC066529_1(BC066529|pid:none) Danio rerio alcohol dehydrogenase,... 397 e-109 AK056992_1(AK056992|pid:none) Homo sapiens cDNA FLJ32430 fis, cl... 394 e-107 CR859187_1(CR859187|pid:none) Pongo abelii mRNA; cDNA DKFZp469B2... 393 e-107 (Q5RF11) RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mit... 392 e-107 (Q8IWW8) RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mit... 392 e-107 AK293530_1(AK293530|pid:none) Homo sapiens cDNA FLJ59475 complet... 391 e-107 (Q17EN4) RecName: Full=Probable hydroxyacid-oxoacid transhydroge... 386 e-105 (Q7Q547) RecName: Full=Probable hydroxyacid-oxoacid transhydroge... 375 e-102 (Q28XT3) RecName: Full=Probable hydroxyacid-oxoacid transhydroge... 371 e-101 AM270229_7(AM270229|pid:none) Aspergillus niger contig An11c0120... 369 e-100 (Q9W265) RecName: Full=Probable hydroxyacid-oxoacid transhydroge... 369 e-100 AY060914_1(AY060914|pid:none) Drosophila melanogaster GM05887 fu... 369 e-100 BT072927_1(BT072927|pid:none) Drosophila melanogaster FI02885 fu... 369 e-100 AP007155_211(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 360 2e-97 CP000511_5725(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 321 8e-86 AE017341_193(AE017341|pid:none) Cryptococcus neoformans var. neo... 319 3e-85 CP000656_1012(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 315 6e-84 E88343(E88343)protein Y38F1A.6 [imported] - Caenorhabditis elegans 305 5e-81 CP000386_2328(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 300 2e-79 AP011115_3348(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 289 3e-76 CP001404_1891(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 278 8e-73 BA000011_1307(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 267 1e-69 U66411_2(U66411|pid:none) Drosophila melanogaster gp150 protein ... 256 3e-66 BC064634_1(BC064634|pid:none) Homo sapiens alcohol dehydrogenase... 220 2e-55 AK300243_1(AK300243|pid:none) Homo sapiens cDNA FLJ55174 complet... 220 2e-55 BC047492_1(BC047492|pid:none) Homo sapiens alcohol dehydrogenase... 140 5e-42 CP001365_2685(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 161 1e-37 CP000141_900(CP000141|pid:none) Carboxydothermus hydrogenoforman... 161 1e-37 CP000891_1341(CP000891|pid:none) Shewanella baltica OS195, compl... 152 5e-35 CP000469_2919(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 151 9e-35 CP000444_2818(CP000444|pid:none) Shewanella sp. MR-7, complete g... 151 1e-34 AP009389_851(AP009389|pid:none) Pelotomaculum thermopropionicum ... 150 1e-34 CP000563_1302(CP000563|pid:none) Shewanella baltica OS155, compl... 149 6e-34 BA000043_1952(BA000043|pid:none) Geobacillus kaustophilus HTA426... 149 6e-34 CP000679_381(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 147 1e-33 CP000673_2353(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 146 3e-33 AP009049_2121(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 146 3e-33 CP000076_5540(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 146 3e-33 CP000724_1591(CP000724|pid:none) Alkaliphilus metalliredigens QY... 146 4e-33 AE014299_1464(AE014299|pid:none) Shewanella oneidensis MR-1, com... 145 5e-33 CP000112_1164(CP000112|pid:none) Desulfovibrio desulfuricans G20... 145 6e-33 CP000961_1350(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 145 8e-33 AE017340_1406(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 144 1e-32 BA000032_566(BA000032|pid:none) Vibrio parahaemolyticus RIMD 221... 144 1e-32 CP000390_2625(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 144 1e-32 CP000943_745(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 143 2e-32 FM178379_1788(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 143 3e-32 CP000606_1163(CP000606|pid:none) Shewanella loihica PV-4, comple... 142 5e-32 AP009389_510(AP009389|pid:none) Pelotomaculum thermopropionicum ... 142 7e-32 AE017340_792(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 141 9e-32 CP000749_2269(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 141 9e-32 CP001349_1356(CP001349|pid:none) Methylobacterium nodulans ORS 2... 141 1e-31 AY386314_12(AY386314|pid:none) Bacillus methanolicus strain MGA3... 140 2e-31 CR522870_542(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 140 2e-31 CP000851_1150(CP000851|pid:none) Shewanella pealeana ATCC 700345... 140 2e-31 (P31005) RecName: Full=NAD-dependent methanol dehydrogenase; ... 140 2e-31 CP001139_1215(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 139 3e-31 AP009049_1809(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 139 3e-31 CP000923_1889(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 139 3e-31 CP000020_1187(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 139 5e-31 CP000482_544(CP000482|pid:none) Pelobacter propionicus DSM 2379,... 139 6e-31 CP000482_875(CP000482|pid:none) Pelobacter propionicus DSM 2379,... 139 6e-31 CP000391_11(CP000391|pid:none) Mesorhizobium sp. BNC1 plasmid 2,... 138 8e-31 CP000076_5542(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 138 8e-31 CP000511_5394(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 137 2e-30 AE016796_18(AE016796|pid:none) Vibrio vulnificus CMCP6 chromosom... 137 2e-30 CP000655_1634(CP000655|pid:none) Polynucleobacter necessarius su... 136 3e-30 AM420293_2324(AM420293|pid:none) Saccharopolyspora erythraea NRR... 136 3e-30 AY458641_47(AY458641|pid:none) Uncultured marine bacterium 463 c... 136 4e-30 AE015927_414(AE015927|pid:none) Clostridium tetani E88, complete... 135 5e-30 CP000749_3996(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 135 5e-30 AP006841_254(AP006841|pid:none) Bacteroides fragilis YCH46 DNA, ... 135 7e-30 BA000043_1871(BA000043|pid:none) Geobacillus kaustophilus HTA426... 134 1e-29 CP000388_1471(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 134 1e-29 CP001034_1806(CP001034|pid:none) Natranaerobius thermophilus JW/... 134 1e-29 AM942759_649(AM942759|pid:none) Proteus mirabilis strain HI4320,... 134 2e-29 BA000016_449(BA000016|pid:none) Clostridium perfringens str. 13 ... 133 2e-29 CP000804_1939(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 133 2e-29 CP001107_1042(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 133 3e-29 CP001103_2243(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 133 3e-29 CP000909_2612(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 133 3e-29 CP000903_2004(CP000903|pid:none) Bacillus weihenstephanensis KBA... 132 4e-29 CP000698_2381(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 132 6e-29 FM209186_5580(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 132 6e-29 AE016853_4182(AE016853|pid:none) Pseudomonas syringae pv. tomato... 132 7e-29 CP001251_307(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 131 9e-29 CP000764_1561(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 131 1e-28 CP001337_711(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 131 1e-28 CP000713_1061(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 131 1e-28 CR378671_108(CR378671|pid:none) Photobacterium profundum SS9; se... 131 1e-28 CP000927_3770(CP000927|pid:none) Caulobacter sp. K31, complete g... 131 1e-28 CP000304_491(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 130 2e-28 CP000388_3719(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 130 2e-28 CP000302_2560(CP000302|pid:none) Shewanella denitrificans OS217,... 130 2e-28 AE016827_69(AE016827|pid:none) Mannheimia succiniciproducens MBE... 130 2e-28 AE016877_2032(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 130 2e-28 CP000462_1419(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 130 3e-28 AM286690_1175(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 130 3e-28 AB073151_5(AB073151|pid:none) Comamonas sp. NCIMB 9872 cyclopent... 130 3e-28 CP000449_2515(CP000449|pid:none) Maricaulis maris MCS10, complet... 130 3e-28 CP000943_792(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 130 3e-28 CP000740_206(CP000740|pid:none) Sinorhizobium medicae WSM419 pla... 130 3e-28 CP000749_3310(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 130 3e-28 CP001016_172(CP001016|pid:none) Beijerinckia indica subsp. indic... 130 3e-28 CP000058_3814(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 129 4e-28 AY525770_1(AY525770|pid:none) Clostridium pasteurianum 1,3-propa... 129 4e-28 (P45513) RecName: Full=1,3-propanediol dehydrogenase; E... 129 5e-28 AP008957_1783(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 129 5e-28 CP001157_775(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 129 5e-28 CP000826_3644(CP000826|pid:none) Serratia proteamaculans 568, co... 129 6e-28 BA000028_2738(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 129 6e-28 CP000746_1921(CP000746|pid:none) Actinobacillus succinogenes 130... 129 6e-28 CP001157_1339(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 129 6e-28 CP000744_5850(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 129 6e-28 AE015451_2777(AE015451|pid:none) Pseudomonas putida KT2440 compl... 128 8e-28 CP001124_1339(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 128 8e-28 CP000880_3807(CP000880|pid:none) Salmonella enterica subsp. ariz... 128 8e-28 AF052750_2(AF052750|pid:none) Pseudomonas putida plasmid pPGH1 i... 128 8e-28 CP000438_5503(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 128 1e-27 CP000686_2021(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 128 1e-27 CP001127_3608(CP001127|pid:none) Salmonella enterica subsp. ente... 128 1e-27 CP000698_1182(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 128 1e-27 CR555306_2619(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 127 1e-27 AE010299_2554(AE010299|pid:none) Methanosarcina acetivorans str.... 127 1e-27 AP010904_2096(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 127 1e-27 CP001176_2066(CP001176|pid:none) Bacillus cereus B4264, complete... 127 1e-27 CU928158_3462(CU928158|pid:none) Escherichia fergusonii ATCC 354... 127 2e-27 CP000943_1169(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 127 2e-27 CP000822_4909(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 127 2e-27 CP000612_2235(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 127 2e-27 AF257214_4(AF257214|pid:none) Brevibacterium sp. HCU cyclohexano... 127 2e-27 AF241171_18(AF241171|pid:none) Pseudomonas aeruginosa pathogenic... 127 2e-27 FM209186_3092(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 127 2e-27 CP000441_192(CP000441|pid:none) Burkholderia ambifaria AMMD chro... 127 2e-27 CP001616_1169(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 126 3e-27 CP000557_1731(CP000557|pid:none) Geobacillus thermodenitrificans... 126 3e-27 CP000316_3269(CP000316|pid:none) Polaromonas sp. JS666, complete... 126 3e-27 CP000254_166(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 126 3e-27 CP000142_2673(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 126 3e-27 A98210(A98210) probable iron-containing alcohol dehydrogenase PA... 126 4e-27 EU313774_1(EU313774|pid:none) Thermoanaerobacterium saccharolyti... 126 4e-27 CP001078_1851(CP001078|pid:none) Clostridium botulinum E3 str. A... 125 5e-27 CP001026_808(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 125 5e-27 CU651637_593(CU651637|pid:none) Escherichia coli LF82 chromosome... 125 5e-27 CP001390_261(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 125 7e-27 (Q59477) RecName: Full=1,3-propanediol dehydrogenase; E... 125 7e-27 BX571864_115(BX571864|pid:none) Photorhabdus luminescens subsp. ... 125 7e-27 CP000152_2071(CP000152|pid:none) Burkholderia sp. 383 chromosome... 125 7e-27 AE014075_735(AE014075|pid:none) Escherichia coli CFT073, complet... 125 7e-27 AP009386_740(AP009386|pid:none) Burkholderia multivorans ATCC 17... 125 7e-27 EF424558_1(EF424558|pid:none) Klebsiella pneumoniae strain TUAC0... 125 7e-27 CP000138_365(CP000138|pid:none) Rhizobium etli CFN 42 plasmid p4... 125 9e-27 CP000800_3897(CP000800|pid:none) Escherichia coli E24377A, compl... 125 9e-27 CP001124_1966(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 125 9e-27 AP009240_3866(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 125 9e-27 FM180568_3839(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 125 9e-27 CP000653_142(CP000653|pid:none) Enterobacter sp. 638, complete g... 125 9e-27 AJ567471_2(AJ567471|pid:none) Klebsiella pneumoniae ORFY, dhaT g... 125 9e-27 AM747721_1113(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 125 9e-27 CP000266_3663(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 125 9e-27 CP000480_2901(CP000480|pid:none) Mycobacterium smegmatis str. MC... 124 1e-26 CP000243_663(CP000243|pid:none) Escherichia coli UTI89, complete... 124 1e-26 CP000411_1200(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 124 1e-26 CP000247_3661(CP000247|pid:none) Escherichia coli 536, complete ... 124 1e-26 CP000312_983(CP000312|pid:none) Clostridium perfringens SM101, c... 124 2e-26 BA000016_936(BA000016|pid:none) Clostridium perfringens str. 13 ... 124 2e-26 BX950851_3737(BX950851|pid:none) Erwinia carotovora subsp. atros... 124 2e-26 CP001056_2022(CP001056|pid:none) Clostridium botulinum B str. Ek... 124 2e-26 CP000247_688(CP000247|pid:none) Escherichia coli 536, complete g... 124 2e-26 CP000679_665(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 124 2e-26 CP000521_2968(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 124 2e-26 EU276021_1(EU276021|pid:none) Klebsiella pneumoniae 1,3-propaned... 124 2e-26 CP000851_4141(CP000851|pid:none) Shewanella pealeana ATCC 700345... 124 2e-26 CP000301_1943(CP000301|pid:none) Rhodopseudomonas palustris BisB... 123 3e-26 (P38945) RecName: Full=NAD-dependent 4-hydroxybutyrate dehydroge... 123 3e-26 CP000083_1392(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 123 3e-26 CP000746_399(CP000746|pid:none) Actinobacillus succinogenes 130Z... 123 3e-26 CP000304_310(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 123 3e-26 CP000680_4566(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 123 3e-26 CP000673_3363(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 123 3e-26 CP000076_1376(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 123 3e-26 AP009049_3030(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 123 3e-26 CP000783_3750(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 122 4e-26 CP000248_2782(CP000248|pid:none) Novosphingobium aromaticivorans... 122 4e-26 S47810(S47810;A57259;G65158) probable alcohol dehydrogenase (EC ... 122 4e-26 AY112989_5(AY112989|pid:none) Clostridium butyricum two-componen... 122 4e-26 CP001001_3735(CP001001|pid:none) Methylobacterium radiotolerans ... 122 4e-26 DQ416747_1(DQ416747|pid:none) Citrobacter freundii 1,3-propanedi... 122 4e-26 CP001393_2150(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 122 6e-26 CP001053_70(CP001053|pid:none) Burkholderia phytofirmans PsJN ch... 122 7e-26 CP000142_279(CP000142|pid:none) Pelobacter carbinolicus DSM 2380... 121 1e-25 CR543861_1851(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 121 1e-25 CP000960_917(CP000960|pid:none) Burkholderia cenocepacia MC0-3 c... 121 1e-25 CP000742_139(CP000742|pid:none) Methanococcus vannielii SB, comp... 121 1e-25 AP009389_495(AP009389|pid:none) Pelotomaculum thermopropionicum ... 121 1e-25 AP009049_970(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 121 1e-25 CP000572_2075(CP000572|pid:none) Burkholderia pseudomallei 1106a... 121 1e-25 AP009049_3041(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 121 1e-25 CP000570_2023(CP000570|pid:none) Burkholderia pseudomallei 668 c... 121 1e-25 CP000124_2209(CP000124|pid:none) Burkholderia pseudomallei 1710b... 121 1e-25 CP000555_3648(CP000555|pid:none) Methylibium petroleiphilum PM1,... 120 2e-25 CP001616_1042(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 120 2e-25 CR543861_2643(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 120 2e-25 AL935261_7(AL935261|pid:none) Lactobacillus plantarum strain WCF... 120 2e-25 CP001096_1375(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 120 2e-25 BX572596_257(BX572596|pid:none) Rhodopseudomonas palustris CGA00... 120 2e-25 CU928164_4075(CU928164|pid:none) Escherichia coli IAI39 chromoso... 120 3e-25 CP001322_1471(CP001322|pid:none) Desulfatibacillum alkenivorans ... 120 3e-25 CU207211_85(CU207211|pid:none) Herminiimonas arsenicoxydans chro... 120 3e-25 AY968605_3(AY968605|pid:none) Clostridium sp. IBUN 22A 1,3-propa... 119 4e-25 AM181176_1377(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 119 4e-25 CP001053_2372(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 119 4e-25 CP000312_900(CP000312|pid:none) Clostridium perfringens SM101, c... 119 4e-25 CP000749_4374(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 119 4e-25 (Q09669) RecName: Full=Alcohol dehydrogenase 4; EC=1.1.... 119 4e-25 X17065_1(X17065|pid:none) Zymomonas mobilis adhB gene for alcoho... 119 4e-25 CP000821_4222(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 119 4e-25 CP001600_835(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 119 5e-25 CP000923_611(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 119 5e-25 AE017355_1975(AE017355|pid:none) Bacillus thuringiensis serovar ... 119 5e-25 CP001338_2147(CP001338|pid:none) Candidatus Methanosphaerula pal... 119 5e-25 AP009389_2641(AP009389|pid:none) Pelotomaculum thermopropionicum... 119 5e-25 CP001389_596(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 119 6e-25 AP006725_58(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044 ... 119 6e-25 BA000043_727(BA000043|pid:none) Geobacillus kaustophilus HTA426 ... 119 6e-25 CP000647_4161(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 119 6e-25 CP000749_171(CP000749|pid:none) Marinomonas sp. MWYL1, complete ... 119 6e-25 CP001407_2145(CP001407|pid:none) Bacillus cereus 03BB102, comple... 118 8e-25 CP001056_1233(CP001056|pid:none) Clostridium botulinum B str. Ek... 118 8e-25 CP000480_6035(CP000480|pid:none) Mycobacterium smegmatis str. MC... 118 8e-25 CU633749_1437(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 118 8e-25 CR522870_951(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 118 8e-25 CP000485_1875(CP000485|pid:none) Bacillus thuringiensis str. Al ... 118 8e-25 CP000246_1017(CP000246|pid:none) Clostridium perfringens ATCC 13... 118 1e-24 CP000922_2783(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 118 1e-24 CP001034_2022(CP001034|pid:none) Natranaerobius thermophilus JW/... 117 1e-24 CP000480_1355(CP000480|pid:none) Mycobacterium smegmatis str. MC... 117 1e-24 AP011115_4462(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 117 1e-24 CP000142_3026(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 117 1e-24 AE016827_1802(AE016827|pid:none) Mannheimia succiniciproducens M... 117 1e-24 CU695238_424(CU695238|pid:none) Ralstonia solanacearum strain Mo... 117 2e-24 AE014300_141(AE014300|pid:none) Shewanella oneidensis MR-1 megap... 117 2e-24 CU928158_3711(CU928158|pid:none) Escherichia fergusonii ATCC 354... 117 2e-24 CU695240_723(CU695240|pid:none) Ralstonia solanacearum strain Mo... 117 2e-24 CP000615_1264(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 117 2e-24 AE004091_1993(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 116 3e-24 CP000438_3093(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 116 3e-24 CP000034_2800(CP000034|pid:none) Shigella dysenteriae Sd197, com... 116 3e-24 CP000721_4471(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 116 3e-24 CP000086_2296(CP000086|pid:none) Burkholderia thailandensis E264... 116 3e-24 CP000926_3097(CP000926|pid:none) Pseudomonas putida GB-1, comple... 116 3e-24 CP001068_550(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 116 4e-24 CP000269_93(CP000269|pid:none) Janthinobacterium sp. Marseille, ... 116 4e-24 CR522870_952(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 116 4e-24 AM260479_856(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 116 4e-24 CP001068_1409(CP001068|pid:none) Ralstonia pickettii 12J chromos... 116 4e-24 AC116314_8(AC116314|pid:none) Trypanosoma cruzi strain CL Brener... 116 4e-24 CU914168_1323(CU914168|pid:none) Ralstonia solanacearum strain I... 116 4e-24 CP001177_2164(CP001177|pid:none) Bacillus cereus AH187, complete... 116 4e-24 CP000247_2757(CP000247|pid:none) Escherichia coli 536, complete ... 116 4e-24 AY561824_1(AY561824|pid:none) Listeria monocytogenes strain F424... 115 5e-24 AE017262_1640(AE017262|pid:none) Listeria monocytogenes str. 4b ... 115 5e-24 AE015451_2656(AE015451|pid:none) Pseudomonas putida KT2440 compl... 115 5e-24 AM260479_1533(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 115 5e-24 AB1642(AB1642) Alcohol-acetaldehyde dehydrogenase homolog lin167... 115 5e-24 AM263198_565(AM263198|pid:none) Listeria welshimeri serovar 6b s... 115 5e-24 CP000946_894(CP000946|pid:none) Escherichia coli ATCC 8739, comp... 115 7e-24 BX640431_142(BX640431|pid:none) Bordetella parapertussis strain ... 115 7e-24 CP000964_5337(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 115 7e-24 CP000142_270(CP000142|pid:none) Pelobacter carbinolicus DSM 2380... 115 7e-24 AE014075_3287(AE014075|pid:none) Escherichia coli CFT073, comple... 115 7e-24 X15025_1(X15025|pid:none) Escherichia coli fucose operon. 115 9e-24 CP000970_2846(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 115 9e-24 CP000949_3131(CP000949|pid:none) Pseudomonas putida W619, comple... 115 9e-24 CU928162_3173(CU928162|pid:none) Escherichia coli ED1a chromosom... 115 9e-24 CR522870_950(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 115 9e-24 CR543861_1789(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 115 9e-24 AE000512_111(AE000512|pid:none) Thermotoga maritima MSB8, comple... 114 1e-23 CP001504_1344(CP001504|pid:none) Burkholderia glumae BGR1 chromo... 114 1e-23 CP001055_759(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 114 1e-23 CP000416_2064(CP000416|pid:none) Lactobacillus brevis ATCC 367, ... 114 1e-23 CP000304_2038(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 114 1e-23 AP008955_4652(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 114 2e-23 BX640445_153(BX640445|pid:none) Bordetella bronchiseptica strain... 114 2e-23 CP001098_209(CP001098|pid:none) Halothermothrix orenii H 168, co... 114 2e-23 CP000744_3267(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 114 2e-23 AP006627_975(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 114 2e-23 CP001091_1750(CP001091|pid:none) Actinobacillus pleuropneumoniae... 114 2e-23 AF148264_1(AF148264|pid:none) Uncultured bacterium AH5 4-hydroxy... 113 3e-23 CP000680_379(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 113 3e-23 CP001364_1765(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 113 3e-23 AP011115_7207(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 113 3e-23 AM180355_3086(AM180355|pid:none) Clostridium difficile 630 compl... 113 3e-23 AY561827_1(AY561827|pid:none) Listeria seeligeri alcohol acetald... 113 3e-23 CP000449_2821(CP000449|pid:none) Maricaulis maris MCS10, complet... 113 3e-23 CP000857_4017(CP000857|pid:none) Salmonella enterica subsp. ente... 112 5e-23 CP000090_1406(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 112 5e-23 CP001015_2025(CP001015|pid:none) Streptococcus pneumoniae G54, c... 112 5e-23 CP001144_4013(CP001144|pid:none) Salmonella enterica subsp. ente... 112 5e-23 CP000266_2666(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 112 6e-23 AE017194_2235(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 112 6e-23 CP001127_3956(CP001127|pid:none) Salmonella enterica subsp. ente... 112 6e-23 CP000716_134(CP000716|pid:none) Thermosipho melanesiensis BI429,... 112 8e-23 AM236084_133(AM236084|pid:none) Rhizobium leguminosarum bv. vici... 112 8e-23 CP000570_1632(CP000570|pid:none) Burkholderia pseudomallei 668 c... 112 8e-23 AB0945(AB0945) alcohol dehydrogenase [imported] - Salmonella ent... 112 8e-23 CP000920_1989(CP000920|pid:none) Streptococcus pneumoniae P1031,... 112 8e-23 CP000113_2806(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 112 8e-23 CP001120_4077(CP001120|pid:none) Salmonella enterica subsp. ente... 112 8e-23 CP000302_1986(CP000302|pid:none) Shewanella denitrificans OS217,... 112 8e-23 CP001251_157(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 112 8e-23 CP000859_1135(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 112 8e-23 CP000903_4108(CP000903|pid:none) Bacillus weihenstephanensis KBA... 112 8e-23 CP000822_3017(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 112 8e-23 CP001322_2819(CP001322|pid:none) Desulfatibacillum alkenivorans ... 112 8e-23 BX571965_2018(BX571965|pid:none) Burkholderia pseudomallei strai... 112 8e-23 CP001358_1351(CP001358|pid:none) Desulfovibrio desulfuricans sub... 112 8e-23 CP000653_4039(CP000653|pid:none) Enterobacter sp. 638, complete ... 112 8e-23 CP001138_3993(CP001138|pid:none) Salmonella enterica subsp. ente... 111 1e-22 CP000431_4497(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 111 1e-22 AM933172_3818(AM933172|pid:none) Salmonella enterica subsp. ente... 111 1e-22 AE006468_3921(AE006468|pid:none) Salmonella enterica subsp. ente... 111 1e-22 CP001186_4398(CP001186|pid:none) Bacillus cereus G9842, complete... 111 1e-22 CP000076_2180(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 111 1e-22 CP000886_4857(CP000886|pid:none) Salmonella enterica subsp. ente... 111 1e-22 AJ458323_2(AJ458323|pid:none) Geobacillus stearothermophilus par... 110 2e-22 CP000539_1645(CP000539|pid:none) Acidovorax sp. JS42, complete g... 110 2e-22 BX640449_238(BX640449|pid:none) Bordetella bronchiseptica strain... 110 2e-22 CP000921_1963(CP000921|pid:none) Streptococcus pneumoniae Taiwan... 110 2e-22 BX936398_382(BX936398|pid:none) Yersinia pseudotuberculosis IP32... 110 2e-22 EF591781_1(EF591781|pid:none) Bacillus sp. XJ1-05 alcohol dehydr... 110 2e-22 CP001392_1960(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 110 2e-22 CP001071_1878(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 110 2e-22 CP001322_3564(CP001322|pid:none) Desulfatibacillum alkenivorans ... 110 2e-22 CP000444_1745(CP000444|pid:none) Shewanella sp. MR-7, complete g... 110 2e-22 CP000555_1795(CP000555|pid:none) Methylibium petroleiphilum PM1,... 110 2e-22 AE007885_12(AE007885|pid:none) Agrobacterium tumefaciens str. C5... 110 2e-22 CP000474_624(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 110 2e-22 CP000086_2610(CP000086|pid:none) Burkholderia thailandensis E264... 110 3e-22 CP001407_4296(CP001407|pid:none) Bacillus cereus 03BB102, comple... 110 3e-22 CP000469_1776(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 110 3e-22 CP000485_3755(CP000485|pid:none) Bacillus thuringiensis str. Al ... 110 3e-22 CP000931_4000(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 110 3e-22 AP006627_42(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, com... 110 3e-22 AE017194_4418(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 109 4e-22 AP006520_30(AP006520|pid:none) Geobacillus kaustophilus HTA426 p... 109 4e-22 CP000891_1944(CP000891|pid:none) Shewanella baltica OS195, compl... 109 4e-22 CP000503_2186(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 109 4e-22 AE015451_2029(AE015451|pid:none) Pseudomonas putida KT2440 compl... 109 4e-22 CP000563_1891(CP000563|pid:none) Shewanella baltica OS155, compl... 109 4e-22 CP000681_1799(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 109 4e-22 AE016879_4246(AE016879|pid:none) Bacillus anthracis str. Ames, c... 109 4e-22 CP000880_3461(CP000880|pid:none) Salmonella enterica subsp. ariz... 109 5e-22 (P13604) RecName: Full=NADPH-dependent butanol dehydrogenase; ... 109 5e-22 CP000822_326(CP000822|pid:none) Citrobacter koseri ATCC BAA-895,... 109 5e-22 CP001177_4308(CP001177|pid:none) Bacillus cereus AH187, complete... 109 5e-22 CP000680_1957(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 109 5e-22 CP000112_3515(CP000112|pid:none) Desulfovibrio desulfuricans G20... 108 7e-22 BA000004_534(BA000004|pid:none) Bacillus halodurans C-125 DNA, c... 108 7e-22 CP000813_2316(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 108 7e-22 CP001283_4360(CP001283|pid:none) Bacillus cereus AH820, complete... 108 7e-22 CP000312_484(CP000312|pid:none) Clostridium perfringens SM101, c... 108 7e-22 AP009049_2650(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 108 7e-22 AE017355_4062(AE017355|pid:none) Bacillus thuringiensis serovar ... 108 9e-22 CP000512_3357(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 108 9e-22 CP000155_4817(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 108 1e-21 (P71017) RecName: Full=Alcohol dehydrogenase; EC=1.1.1.... 108 1e-21 FJ823258_1(FJ823258|pid:none) Bacillus subtilis strain 2 alcohol... 108 1e-21 B69629(B69629) alcohol dehydrogenase gbsB - Bacillus subtilis &... 108 1e-21 AE014299_2096(AE014299|pid:none) Shewanella oneidensis MR-1, com... 108 1e-21 CP000092_499(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 108 1e-21 AP006627_326(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 107 1e-21 CP000813_2690(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 107 1e-21 AP006725_4017(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 107 1e-21 AP006878_1570(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 107 1e-21 BA000037_2175(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 107 1e-21 CP000896_159(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 107 2e-21 CP001252_2321(CP001252|pid:none) Shewanella baltica OS223, compl... 107 2e-21 CP000884_3374(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 107 2e-21 AM180355_2411(AM180355|pid:none) Clostridium difficile 630 compl... 107 2e-21 CP000239_455(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp... 107 2e-21 CP000505_996(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 107 2e-21 BA000016_539(BA000016|pid:none) Clostridium perfringens str. 13 ... 107 2e-21 CP000150_246(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 107 2e-21 CP000702_555(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 107 2e-21 CP000964_2696(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 107 2e-21 CP000728_1611(CP000728|pid:none) Clostridium botulinum F str. La... 107 2e-21 AP010904_1670(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 107 2e-21 CP000647_3090(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 106 3e-21 CR522870_1034(CR522870|pid:none) Desulfotalea psychrophila LSv54... 106 3e-21 CP000644_2656(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 106 3e-21 CP000606_1903(CP000606|pid:none) Shewanella loihica PV-4, comple... 106 3e-21 AE016830_823(AE016830|pid:none) Enterococcus faecalis V583, comp... 106 4e-21 AE017220_2457(AE017220|pid:none) Salmonella enterica subsp. ente... 106 4e-21 CP001615_154(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 106 4e-21 CP001172_1383(CP001172|pid:none) Acinetobacter baumannii AB307-0... 106 4e-21 CT005267_227(CT005267|pid:none) Leishmania major strain Friedlin... 106 4e-21 CP000828_407(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 106 4e-21 CP001194_94(CP001194|pid:none) Rhizobium leguminosarum bv. trifo... 105 6e-21 CP001083_1664(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 105 6e-21 CP000943_3262(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 105 6e-21 AB0814(AB0814) probable alchohol dehydrogenase eutG [imported] -... 105 6e-21 AE015927_1957(AE015927|pid:none) Clostridium tetani E88, complet... 105 6e-21 AE017285_2384(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 105 7e-21 CP001144_2576(CP001144|pid:none) Salmonella enterica subsp. ente... 105 9e-21 CP000817_1759(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 105 9e-21 AJ544863_4(AJ544863|pid:none) Thermotoga sp. RQ2 ORF19 (partial)... 105 9e-21 (P41795) RecName: Full=Ethanolamine utilization protein eutG; ... 105 9e-21 CP001336_2144(CP001336|pid:none) Desulfitobacterium hafniense DC... 104 1e-20 CP000939_1650(CP000939|pid:none) Clostridium botulinum B1 str. O... 104 1e-20 CP001358_1919(CP001358|pid:none) Desulfovibrio desulfuricans sub... 104 1e-20 AP008230_1101(AP008230|pid:none) Desulfitobacterium hafniense Y5... 104 1e-20 D65020(D65020)ethanolamine utilization protein EutG - Escherichi... 104 2e-20 AP007281_29(AP007281|pid:none) Lactobacillus reuteri JCM 1112 DN... 104 2e-20 CP000634_904(CP000634|pid:none) Agrobacterium vitis S4 chromosom... 104 2e-20 AY282576_1(AY282576|pid:none) Piromyces sp. E2 aldehyde/alcohol ... 104 2e-20 CP000822_4043(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 103 2e-20 AE006468_2888(AE006468|pid:none) Salmonella enterica subsp. ente... 103 2e-20 CP000926_3131(CP000926|pid:none) Pseudomonas putida GB-1, comple... 103 2e-20 CP000886_3593(CP000886|pid:none) Salmonella enterica subsp. ente... 103 2e-20 CP001146_1816(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 103 2e-20 AE014295_1591(AE014295|pid:none) Bifidobacterium longum NCC2705,... 103 2e-20 CP000931_1873(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 103 2e-20 CP000026_2646(CP000026|pid:none) Salmonella enterica subsp. ente... 103 2e-20 BA000031_1425(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 103 2e-20 CP000247_2440(CP000247|pid:none) Escherichia coli 536, complete ... 103 2e-20 CP000360_379(CP000360|pid:none) Acidobacteria bacterium Ellin345... 103 2e-20 CU651637_2341(CU651637|pid:none) Escherichia coli LF82 chromosom... 103 2e-20 AM998794_7(AM998794|pid:none) Clostridium saccharobutylicum ORF1... 103 2e-20 CR378666_161(CR378666|pid:none) Photobacterium profundum SS9; se... 103 2e-20 AM933172_2806(AM933172|pid:none) Salmonella enterica subsp. ente... 103 2e-20 BA000011_398(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 103 2e-20 CP000542_3790(CP000542|pid:none) Verminephrobacter eiseniae EF01... 103 2e-20 AE015451_2624(AE015451|pid:none) Pseudomonas putida KT2440 compl... 103 3e-20 CP001164_3313(CP001164|pid:none) Escherichia coli O157:H7 str. E... 103 3e-20 CU928158_681(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 103 3e-20 CU928160_2440(CU928160|pid:none) Escherichia coli IAI1 chromosom... 103 3e-20 CP000802_2445(CP000802|pid:none) Escherichia coli HS, complete g... 103 3e-20 CU928161_2530(CU928161|pid:none) Escherichia coli S88 chromosome... 103 3e-20 E72498(E72498)probable alcohol dehydrogenase APE1963 - Aeropyrum... 103 3e-20 BA000002_1283(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple... 103 3e-20 CU928145_2683(CU928145|pid:none) Escherichia coli 55989 chromoso... 103 3e-20 AE005174_3328(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 103 3e-20 CP000038_2365(CP000038|pid:none) Shigella sonnei Ss046, complete... 103 3e-20 CP000605_1838(CP000605|pid:none) Bifidobacterium longum DJO10A, ... 103 4e-20 AL646053_987(AL646053|pid:none) Ralstonia solanacearum GMI1000 m... 103 4e-20 CP000800_2604(CP000800|pid:none) Escherichia coli E24377A, compl... 103 4e-20 CU928162_2825(CU928162|pid:none) Escherichia coli ED1a chromosom... 103 4e-20 CP001349_61(CP001349|pid:none) Methylobacterium nodulans ORS 206... 102 5e-20 CP000082_1042(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 102 5e-20 AP009256_403(AP009256|pid:none) Bifidobacterium adolescentis ATC... 102 5e-20 CP000880_4499(CP000880|pid:none) Salmonella enterica subsp. ariz... 102 5e-20 CP000407_274(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 102 6e-20 CP000158_174(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 102 6e-20 AM236083_96(AM236083|pid:none) Rhizobium leguminosarum bv. vicia... 102 6e-20 AM502248_245(AM502248|pid:none) Leishmania infantum chromosome 30. 102 6e-20 CP001322_4447(CP001322|pid:none) Desulfatibacillum alkenivorans ... 102 6e-20 CP000408_273(CP000408|pid:none) Streptococcus suis 98HAH33, comp... 102 6e-20 CP000472_405(CP000472|pid:none) Shewanella piezotolerans WP3, co... 102 8e-20 CP000854_4046(CP000854|pid:none) Mycobacterium marinum M, comple... 102 8e-20 CP000970_2518(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 102 8e-20 FM954972_868(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 102 8e-20 AM180355_3183(AM180355|pid:none) Clostridium difficile 630 compl... 101 1e-19 CP001089_455(CP001089|pid:none) Geobacter lovleyi SZ, complete g... 101 1e-19 CP000857_2923(CP000857|pid:none) Salmonella enterica subsp. ente... 101 1e-19 CP000112_3260(CP000112|pid:none) Desulfovibrio desulfuricans G20... 101 1e-19 CP001055_742(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 101 1e-19 AE009950_75(AE009950|pid:none) Pyrococcus furiosus DSM 3638, com... 101 1e-19 CP000507_1687(CP000507|pid:none) Shewanella amazonensis SB2B, co... 101 1e-19 AE001438_58(AE001438|pid:none) Clostridium acetobutylicum ATCC 8... 101 1e-19 CP000301_1143(CP000301|pid:none) Rhodopseudomonas palustris BisB... 101 1e-19 CP001022_1223(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 100 2e-19 CP000851_2035(CP000851|pid:none) Shewanella pealeana ATCC 700345... 100 2e-19 AP009049_1499(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 100 2e-19 AE015927_2173(AE015927|pid:none) Clostridium tetani E88, complet... 100 2e-19 CP001348_1054(CP001348|pid:none) Clostridium cellulolyticum H10,... 100 2e-19 CP000612_3227(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 100 2e-19 FM178379_1855(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 100 2e-19 AP009389_484(AP009389|pid:none) Pelotomaculum thermopropionicum ... 100 2e-19 CP001635_2821(CP001635|pid:none) Variovorax paradoxus S110 chrom... 100 2e-19 CP000139_734(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 100 3e-19 CP000725_113(CP000725|pid:none) Streptococcus gordonii str. Chal... 100 3e-19 CP000422_262(CP000422|pid:none) Pediococcus pentosaceus ATCC 257... 100 3e-19 CP000325_3260(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 100 3e-19 DQ151451_5(DQ151451|pid:none) Anaerostipes caccae strain L1-92 p... 100 3e-19 AM942759_1469(AM942759|pid:none) Proteus mirabilis strain HI4320... 100 4e-19 CP000746_583(CP000746|pid:none) Actinobacillus succinogenes 130Z... 100 4e-19 BX640441_180(BX640441|pid:none) Bordetella bronchiseptica strain... 100 4e-19 BA000037_1175(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 100 4e-19 AE016795_2889(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 100 4e-19 CP001351_301(CP001351|pid:none) Methylobacterium nodulans ORS 20... 100 4e-19 AP009510_595(AP009510|pid:none) Uncultured Termite group 1 bacte... 100 4e-19 CP000416_113(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 100 4e-19 CP001056_3136(CP001056|pid:none) Clostridium botulinum B str. Ek... 99 5e-19 CP000323_1423(CP000323|pid:none) Psychrobacter cryohalolentis K5... 99 5e-19 CU914166_306(CU914166|pid:none) Ralstonia solanacearum strain IP... 99 5e-19 CP001083_345(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 99 5e-19
>(Q8R0N6) RecName: Full=Hydroxyacid-oxoacid transhydrogenase, mitochondrial; Short=HOT; EC=1.1.99.24; AltName: Full=Alcohol dehydrogenase iron-containing protein 1; Flags: Precursor; &AK038853_1(AK038853|pid:none) &BC026584_1(BC026584|pid:none) Length = 465
Score = 407 bits (1047), Expect = e-112 Identities = 215/378 (56%), Positives = 271/378 (71%) Frame = +2
Query: 1079 LEKCGIKYTIYSDVSIEPTDPSFKDAISVMGKGRYDGVVAVGGGSVMDTAKAANLYNSYP 1258 L K GI + +Y DV +EPTD SF DAI KG +D VAVGGGS MDT KAANLY S P Sbjct: 95 LSKNGISFQVYDDVRVEPTDGSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSP 154
Query: 1259 PADNDFLAYINPPIGKGLLVPGPLKRPLIAIPTTCGTASETTGVCILDIKLGDGLSAKTG 1438 ++FL Y+N PIGKG V PLK PLIA+PTT GT SETTGV I D + L KTG Sbjct: 155 --HSEFLDYVNAPIGKGKPVTVPLK-PLIAVPTTSGTGSETTGVAIFDY---EHLKVKTG 208
Query: 1439 IASRHLKPILGLVDPDNLLTLPSNVAISSGFDQLCHALESFTAIPFNQRSPRPLAPNQRP 1618 IASR +KP LGLVDP + L +P V +SGFD LCHALES+TAIP++ RSP P P QRP Sbjct: 209 IASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRP 268
Query: 1619 SYQGANPVSDVWSLRSLEMLCKNIHRFVLNPNDDYARSQMMLAASYAGLGFGNSGVHACH 1798 +YQG+NP+SD+W++ +L+++ K + R V NP+D ARS+M LA+++AG+GFGN+GVH CH Sbjct: 269 AYQGSNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCH 328
Query: 1799 GMSYSISSMVKDYKPEGYYGLKKNLIPHGQSVILSAPAVFKFTAPSNPERHLLLAKIMGA 1978 GMSY IS +VK YK + Y + L+PHG SV+L++PAVF FTA PERHL A I+GA Sbjct: 329 GMSYPISGLVKTYKAK-EYNVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAGILGA 387
Query: 1979 DISNASESDAGVLLSNQIVKLMKLLNVPNGLQALGYKESDIDSLVKGTLPQHRVTKLMPK 2158 +I A DAG++L++ + K + LNV +GL ALGY + DI SLVKGTLPQ RVTKL P+ Sbjct: 388 NIRTARIQDAGLVLADALRKFLFDLNVDDGLAALGYSKDDIPSLVKGTLPQERVTKLAPR 447
Query: 2159 QATYDDLYKLFKDSMTIY 2212 + +DL LF+ SM +Y Sbjct: 448 AQSEEDLSALFEASMKLY 465
Score = 185 bits (470), Expect(2) = 5e-55 Identities = 101/166 (60%), Positives = 116/166 (69%) Frame = +3
Query: 579 LEKCGIKYTIYSDVSIEPTDPSFKDAISVMGKGRYDGVVAVGGGSVMDTAKAANLYNSYP 758 L K GI + +Y DV +EPTD SF DAI KG +D VAVGGGS MDT KAANLY S P Sbjct: 95 LSKNGISFQVYDDVRVEPTDGSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSP 154
Query: 759 PADNDFLAYINPPIGKGLLVPGPLKRPLIAIPTTCGTASETTGVCILDIKLGDGLSAKTG 938 ++FL Y+N PIGKG V PLK PLIA+PTT GT SETTGV I D + L KTG Sbjct: 155 --HSEFLDYVNAPIGKGKPVTVPLK-PLIAVPTTSGTGSETTGVAIFDY---EHLKVKTG 208
Query: 939 IASRHLKPILGLVDPDNLLTLPSNVAISSGFDQLCHALESFTAIPF 1076 IASR +KP LGLVDP + L +P V +SGFD LCHALES+TAIP+ Sbjct: 209 IASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALESYTAIPY 254
Score = 55.1 bits (131), Expect(2) = 5e-55 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2
Query: 395 DYAFEASANNIRFGSGVTYEVGYDLLDMNCRNVIVFTDNNLLKL 526 DYAFE + +NIR+G+GVT EVG DL +M +NV + TD NL +L Sbjct: 42 DYAFEMAVSNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQL 85
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 3,684,157,495 Number of extensions: 77784393 Number of successful extensions: 212049 Number of sequences better than 10.0: 1077 Number of HSP's gapped: 207963 Number of HSP's successfully gapped: 2172 Length of query: 759 Length of database: 1,051,180,864 Length adjustment: 136 Effective length of query: 623 Effective length of database: 611,008,840 Effective search space: 380658507320 Effective search space used: 380658507320 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
1 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
1 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |