Contig-U15789-1 |
Contig ID |
Contig-U15789-1 |
Contig update |
2004. 6.11 |
Contig sequence |
|
Gap |
gap included |
Contig length |
2925 |
Chromosome number (1..6, M) |
- |
Chromosome length |
- |
Start point |
- |
End point |
- |
Strand (PLUS/MINUS) |
- |
Number of clones |
13 |
Number of EST |
23 |
Link to clone list |
U15789 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.23 |
Homology vs CSM-cDNA |
|
dna update |
2009. 2.15 |
Homology vs DNA |
Query= Contig-U15789-1 (Contig-U15789-1Q) /CSM_Contig/Contig-U15789-1Q.Seq.d (2935 letters)
Database: ddbj_B 98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AF019985) Dictyostelium discoideum Spalten (spnA) mRNA, com... 1661 0.0 2 (AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 1661 0.0 2 (BJ400804) Dictyostelium discoideum cDNA clone:dds14k23, 3' ... 1509 0.0 1 (BJ385982) Dictyostelium discoideum cDNA clone:ddc56d22, 3' ... 1348 0.0 1 (BJ364335) Dictyostelium discoideum cDNA clone:ddc31i09, 5' ... 1326 0.0 1 (BJ339772) Dictyostelium discoideum cDNA clone:dda10g07, 3' ... 1310 0.0 1 (BJ368832) Dictyostelium discoideum cDNA clone:ddc48c07, 5' ... 1263 0.0 1 (BJ384098) Dictyostelium discoideum cDNA clone:ddc48c07, 3' ... 1221 0.0 1 (BJ378266) Dictyostelium discoideum cDNA clone:ddc31i09, 3' ... 1219 0.0 2 (BJ353739) Dictyostelium discoideum cDNA clone:dda51d08, 3' ... 1195 0.0 2 (BJ342769) Dictyostelium discoideum cDNA clone:dda1c15, 3' e... 1068 0.0 2 (BJ346854) Dictyostelium discoideum cDNA clone:dda25e08, 3' ... 1015 0.0 2 (BJ335715) Dictyostelium discoideum cDNA clone:dda51d08, 5' ... 926 0.0 2 (BJ393171) Dictyostelium discoideum cDNA clone:dds30j12, 5' ... 1045 0.0 2 (AU034717) Dictyostelium discoideum slug cDNA, clone SLE231. 961 0.0 2 (BJ396878) Dictyostelium discoideum cDNA clone:dds44d11, 5' ... 908 0.0 2 (AU271044) Dictyostelium discoideum vegetative cDNA clone:VS... 450 0.0 3 (BJ405028) Dictyostelium discoideum cDNA clone:dds30j12, 3' ... 765 0.0 2 (BJ371127) Dictyostelium discoideum cDNA clone:ddc56d22, 5' ... 755 0.0 2 (BJ391061) Dictyostelium discoideum cDNA clone:dds14k23, 5' ... 369 e-176 3 (BJ325587) Dictyostelium discoideum cDNA clone:dda1c15, 5' e... 254 e-138 3 (BJ329519) Dictyostelium discoideum cDNA clone:dda25e08, 5' ... 367 e-134 3 (BJ366443) Dictyostelium discoideum cDNA clone:ddc39b02, 5' ... 394 e-124 3 (AU061434) Dictyostelium discoideum slug cDNA, clone SLE231. 442 e-119 1 (BJ323383) Dictyostelium discoideum cDNA clone:dda10g07, 5' ... 246 4e-77 3 (C25740) Dictyostelium discoideum gamete cDNA, clone FC-AY03. 52 4e-09 3 (AC177023) Strongylocentrotus purpuratus clone R3-37K20, WOR... 52 0.12 1 (AZ208903) SP_0152_A1_F03_SP6E Strongylocentrotus purpuratus... 52 0.12 1 (AZ175210) SP_0131_B2_C04_SP6E Strongylocentrotus purpuratus... 52 0.12 1 (AZ175087) SP_0131_B1_C04_SP6E Strongylocentrotus purpuratus... 52 0.12 1 (AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 38 0.13 13 (AC126490) Rattus norvegicus clone CH230-267C13, WORKING DRA... 36 0.99 2 (AC103422) Rattus norvegicus clone CH230-148D5, WORKING DRAF... 36 0.99 2 (BJ347679) Dictyostelium discoideum cDNA clone:dda27g23, 3' ... 34 1.00 3 (BJ341211) Dictyostelium discoideum cDNA clone:dda5n14, 3' e... 34 1.0 3 (AU033644) Dictyostelium discoideum slug cDNA, clone SLB263. 34 1.1 3 (BJ372592) Dictyostelium discoideum cDNA clone:ddc13c12, 3' ... 34 1.4 3 (AL439327) T7 end of clone BD0AA003H04 of library BD0AA from... 42 1.4 2 (AC115581) Dictyostelium discoideum chromosome 2 map complem... 36 1.7 8 (AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 34 1.8 12 (AC125725) Rattus norvegicus clone CH230-5A21, WORKING DRAFT... 48 1.9 1 (AC106660) Rattus norvegicus clone CH230-74G5, WORKING DRAFT... 48 1.9 1 (CU633569) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 1.9 1 (AC173780) Bos taurus clone CH240-107G13, WORKING DRAFT SEQU... 48 1.9 1 (CT282100) Sus scrofa genomic clone CH242-186F11, genomic su... 48 1.9 1 (AM781744) Nicotiana tabacum EST, clone nt005074081. 48 1.9 1 (BJ407980) Dictyostelium discoideum cDNA clone:dds44d11, 3' ... 48 1.9 1 (FG642978) TT-37_K23 K326 early senescent leaf library Nicot... 48 1.9 1 (EV525885) RR1AH02TF RR1(CS) Raphanus raphanistrum subsp. ma... 48 1.9 1 (EJ370668) 1092963723293 Global-Ocean-Sampling_GS-28-01-01-1... 40 2.2 3 (AC216672) Populus trichocarpa clone POP018-I12, complete se... 36 3.7 2 (GE563961) CCHT21886.b1_L24.ab1 CCHT Niger Seed Guizotia aby... 42 4.4 2 (GE506692) CCFT5380.b1_G01.ab1 CCF(STU) sunflower Helianthus... 42 4.6 2 (DW016099) EST1225060 MTY Medicago truncatula cDNA clone MTY... 44 4.8 2 (AJ812734) Dictyostelium discoideum mRNA for diaphanous-rela... 46 4.9 2 (EG677440) RCRDM43TO Castor bean cDNA library from roots, 1.... 44 5.3 2 (EJ547883) 1092959415725 Global-Ocean-Sampling_GS-29-01-01-1... 32 5.8 3 (AF085352) Archegozetes longisetosus Hox 3 gene, partial cds. 38 6.0 2 (EX452833) Testis26_D5 Bat star testis Patiria miniata cDNA,... 34 6.7 3 (EJ519641) 1092955129782 Global-Ocean-Sampling_GS-29-01-01-1... 32 6.8 3 (CR381118) Arabidopsis thaliana transposon insertion STS GT_... 46 7.5 1 (AF483216) Mus musculus minor histocompatibility antigen H13... 46 7.5 1 (BT004824) Arabidopsis thaliana At3g12620 gene, complete cds. 46 7.5 1 (AP002044) Arabidopsis thaliana genomic DNA, chromosome 3, P... 46 7.5 1 (AK227879) Arabidopsis thaliana mRNA for hypothetical protei... 46 7.5 1 (AC069474) Arabidopsis thaliana chromosome 3 BAC T2E22 genom... 46 7.5 1 (AC084610) Caenorhabditis briggsae cosmid G44C02, complete s... 46 7.5 1 (AC108052) Homo sapiens BAC clone RP11-335K21 from 4, comple... 46 7.5 1 (AC004830) Homo sapiens PAC clone RP4-537J23 from 7, complet... 46 7.5 1 (AC166026) Oryctolagus cuniculus clone LB1-60J1, WORKING DRA... 46 7.5 1 (AC165385) Oryctolagus cuniculus clone LB1-139B11, WORKING D... 46 7.5 1 (BX823848) Arabidopsis thaliana Full-length cDNA Complete se... 46 7.5 1 (FI188140) CMHD-GT_516C3-5S GTL_R1_UPA Mus musculus genomic ... 46 7.5 1 (FH364303) CHO_OF4476xe06r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 7.5 1 (EI395926) MUGQ_CH252P210K20T7_CN330_070 CHORI-252 Vervet Mo... 46 7.5 1 (ED197606) AUAC-aax23d08.g1 Ascaris suum whole genome shotgu... 46 7.5 1 (DH297574) Oryzias latipes Fosmid clone:GOLWFno643_k19, forw... 46 7.5 1 (CR505249) mth4-39O1FM1 BAC end, cultivar Jemalong A17 of Me... 46 7.5 1 (BZ020256) oei58a07.b1 B.oleracea002 Brassica oleracea genom... 46 7.5 1 (BH695638) BOMMY16TR BO_2_3_KB Brassica oleracea genomic clo... 46 7.5 1 (EG666992) RCRBY47TP Castor bean cDNA library from roots, 1.... 46 7.5 1 (EG521034) AYBKQ85TR pooled cDNA populations Arabidopsis tha... 46 7.5 1 (EG521029) AYBKQ85TF pooled cDNA populations Arabidopsis tha... 46 7.5 1 (DT739676) EST1173525 Aquilegia cDNA library Aquilegia formo... 46 7.5 1 (DR919625) EST1111164 Aquilegia cDNA library Aquilegia formo... 46 7.5 1 (DR445189) AR1017D05 A. gomesiana hemocytes normalized libra... 46 7.5 1 (DN672396) CFW68-C09.x1d-t SHGC-CFW Gasterosteus aculeatus c... 46 7.5 1 (DN500294) UK115TG06.5pR Populus apical shoot cDNA library P... 46 7.5 1 (AU039274) Dictyostelium discoideum slug cDNA, clone SLH325. 46 7.5 1 (AU035000) Dictyostelium discoideum slug cDNA, clone SLE469. 46 7.5 1 (AU034469) Dictyostelium discoideum slug cDNA, clone SLC184. 46 7.5 1 (AU034463) Dictyostelium discoideum slug cDNA, clone SLC171. 46 7.5 1 (AU034349) Dictyostelium discoideum slug cDNA, clone SLC729. 46 7.5 1 (AU033806) Dictyostelium discoideum slug cDNA, clone SLB463. 46 7.5 1 (CX191441) 54-E022767-021-014-L13-frev ADIS-MPIZ 021 Brassic... 46 7.5 1 (CV245643) WS0257.B21_P22 PT-MB-N-A-15 Populus trichocarpa c... 46 7.5 1 (CA823674) R29F09 two-month-old roots from clone 'Beaupre' P... 46 7.5 1 (CA195209) SCEZSB1090H08.g SB1 Saccharum officinarum cDNA cl... 46 7.5 1 (C23767) Dictyostelium discoideum gamete cDNA, clone FC-AH17. 46 7.5 1 (BU826021) UK115TG06 Populus apical shoot cDNA library Popul... 46 7.5 1 (BQ438498) AGENCOURT_7908255 NIH_MGC_82 Homo sapiens cDNA cl... 46 7.5 1 (BJ432273) Dictyostelium discoideum cDNA clone:ddv18p03, 3' ... 46 7.5 1 (BJ408555) Dictyostelium discoideum cDNA clone:dds46o05, 3' ... 46 7.5 1 (BJ407419) Dictyostelium discoideum cDNA clone:dds38b15, 3' ... 46 7.5 1 (BJ401114) Dictyostelium discoideum cDNA clone:dds22n02, 3' ... 46 7.5 1 (BJ400330) Dictyostelium discoideum cDNA clone:dds9d21, 3' e... 46 7.5 1 (BJ398167) Dictyostelium discoideum cDNA clone:dds11e12, 3' ... 46 7.5 1 (BJ386245) Dictyostelium discoideum cDNA clone:ddc57i13, 3' ... 46 7.5 1 (BJ383568) Dictyostelium discoideum cDNA clone:ddc53a13, 3' ... 46 7.5 1 (BJ378696) Dictyostelium discoideum cDNA clone:ddc32e16, 3' ... 46 7.5 1 (BJ378352) Dictyostelium discoideum cDNA clone:ddc31l15, 3' ... 46 7.5 1 (BJ377535) Dictyostelium discoideum cDNA clone:ddc24p22, 3' ... 46 7.5 1 (BJ373195) Dictyostelium discoideum cDNA clone:ddc1k21, 3' e... 46 7.5 1 (BJ372237) Dictyostelium discoideum cDNA clone:ddc11e24, 3' ... 46 7.5 1 (BJ351740) Dictyostelium discoideum cDNA clone:dda44o09, 3' ... 46 7.5 1 (BJ350084) Dictyostelium discoideum cDNA clone:dda38k15, 3' ... 46 7.5 1 (BJ342009) Dictyostelium discoideum cDNA clone:dda9k02, 3' e... 46 7.5 1 (BJ340331) Dictyostelium discoideum cDNA clone:dda12j18, 3' ... 46 7.5 1 (GE534550) CCHS21167.b1_M11.ab1 CCHS Espina Barnadesia spino... 46 7.5 1 (FD974216) RR2HA63TF RR2(MS) Raphanus raphanistrum subsp. ra... 46 7.5 1 (FD749850) Afi04_53_G04_C014.b1 Aristolochia fimbriata flowe... 46 7.5 1 (FD541676) RR2F001TF RR2(MS) Raphanus raphanistrum subsp. ra... 46 7.5 1 (EY474903) METAA49TF JCVI-MT3 Medicago truncatula cDNA 5', m... 46 7.5 1 (CP000285) Chromohalobacter salexigens DSM 3043, complete ge... 46 7.5 1
>(AF019985) Dictyostelium discoideum Spalten (spnA) mRNA, complete cds. Length = 3150
Score = 1661 bits (838), Expect(2) = 0.0 Identities = 838/838 (100%) Strand = Plus / Plus
Query: 1961 tcgatggtgcagctgaatctaaaaagaatggtgctgatagttgcggtaatggtggtgttg 2020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2189 tcgatggtgcagctgaatctaaaaagaatggtgctgatagttgcggtaatggtggtgttg 2248
Query: 2021 gtagtaaaattaaacttgaatctggtttcggttcactacaaggtagaagaaagaatatgg 2080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2249 gtagtaaaattaaacttgaatctggtttcggttcactacaaggtagaagaaagaatatgg 2308
Query: 2081 aggatactcatgtgattttgaataatctaatgggggcagtaacctacaatggtccaccaa 2140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2309 aggatactcatgtgattttgaataatctaatgggggcagtaacctacaatggtccaccaa 2368
Query: 2141 aggatataccaatctcatactatgcagtttatgatggtcatggtggtactgaaacctcaa 2200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2369 aggatataccaatctcatactatgcagtttatgatggtcatggtggtactgaaacctcaa 2428
Query: 2201 cactcttggagccaacagttcataattgtttggtcaattctcaaagtttccgagatggtg 2260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2429 cactcttggagccaacagttcataattgtttggtcaattctcaaagtttccgagatggtg 2488
Query: 2261 actatgaacaagctttccgtgatgcatacgctgaagctgatgatattgtaattgaaaaat 2320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2489 actatgaacaagctttccgtgatgcatacgctgaagctgatgatattgtaattgaaaaat 2548
Query: 2321 gtgaaaagagtggtagcacaggtgtatcggctctattggttggaaataaactctacactg 2380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2549 gtgaaaagagtggtagcacaggtgtatcggctctattggttggaaataaactctacactg 2608
Query: 2381 caaatgtaggcgattcagagatagttttagcacgtgctcaaccaaatgcaaatcctaaag 2440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2609 caaatgtaggcgattcagagatagttttagcacgtgctcaaccaaatgcaaatcctaaag 2668
Query: 2441 gacccgtcacctatgaaccggttttactctcctacaaacatttggcaagtgatgaccaag 2500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2669 gacccgtcacctatgaaccggttttactctcctacaaacatttggcaagtgatgaccaag 2728
Query: 2501 aaaagaagagagtcaccgatttgggtggtatgatcattttcaatcgtttgtttggttcat 2560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2729 aaaagaagagagtcaccgatttgggtggtatgatcattttcaatcgtttgtttggttcat 2788
Query: 2561 tggctgttagtagatcgtttggtgataaggagtacaaagagggtgaaaagaagttttgtg 2620 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2789 tggctgttagtagatcgtttggtgataaggagtacaaagagggtgaaaagaagttttgtg 2848
Query: 2621 tctctgatccttatcaaacaacaaccgatctcactgctcgtgatcatttcttcattttgg 2680 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2849 tctctgatccttatcaaacaacaaccgatctcactgctcgtgatcatttcttcattttgg 2908
Query: 2681 cttgtgatggtctttgggataaggtcgaatatgatgaagccgttcaatttgttcaaagaa 2740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2909 cttgtgatggtctttgggataaggtcgaatatgatgaagccgttcaatttgttcaaagaa 2968
Query: 2741 atataaaattgggaaaaagtgcaactgaaatttcagaattattagctcaagattctta 2798 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2969 atataaaattgggaaaaagtgcaactgaaatttcagaattattagctcaagattctta 3026
Score = 1526 bits (770), Expect = 0.0 Identities = 770/770 (100%) Strand = Plus / Plus
Query: 443 agcggtaccaatattaaaagcacatgatttttgtggaactattatgatattaggacatac 502 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 468 agcggtaccaatattaaaagcacatgatttttgtggaactattatgatattaggacatac 527
Query: 503 agagagtggtaaaactacattacaaagacagttggaatttatatatggcgttacagatcc 562 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 528 agagagtggtaaaactacattacaaagacagttggaatttatatatggcgttacagatcc 587
Query: 563 aaccgatgcaaagcattatcaacgtttgatttatggtaatacattggcaacgttaattcg 622 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 588 aaccgatgcaaagcattatcaacgtttgatttatggtaatacattggcaacgttaattcg 647
Query: 623 tttcattgagaatagtgaaagattaaatataaccttatcacctgataatttagctcgagt 682 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 648 tttcattgagaatagtgaaagattaaatataaccttatcacctgataatttagctcgagt 707
Query: 683 taaaagaatacaaagtcaaccagttgaattggctagaaatagattaccaagattccccct 742 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 708 taaaagaatacaaagtcaaccagttgaattggctagaaatagattaccaagattccccct 767
Query: 743 aaaattaggttgggattgtaaatgtatttgggaagataaagtaattcaatcagtttataa 802 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 768 aaaattaggttgggattgtaaatgtatttgggaagataaagtaattcaatcagtttataa 827
Query: 803 tcattcaaaaatttgttcagaaattagaactcctggtagaccaaaatattatatggatag 862 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 828 tcattcaaaaatttgttcagaaattagaactcctggtagaccaaaatattatatggatag 887
Query: 863 aatgtttaaagtatttgatccaagttatacacccacagagatggatattattagtgcata 922 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 888 aatgtttaaagtatttgatccaagttatacacccacagagatggatattattagtgcata 947
Query: 923 tgatcaaaaggatactattcaatcatcagcaatcattcataaaagatttaaagtggattt 982 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 948 tgatcaaaaggatactattcaatcatcagcaatcattcataaaagatttaaagtggattt 1007
Query: 983 atttggatgttcaggtaaacaatcttcaccaaagaattgggttggtttacatcaaaatta 1042 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1008 atttggatgttcaggtaaacaatcttcaccaaagaattgggttggtttacatcaaaatta 1067
Query: 1043 taaaccaaattatatattttatgttgtagctttaaaagattatttttcagatcatttagt 1102 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1068 taaaccaaattatatattttatgttgtagctttaaaagattatttttcagatcatttagt 1127
Query: 1103 tgcaacacaaaatacagatccaacaattgttgaaatgtgtaataatcatattcatagaaa 1162 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1128 tgcaacacaaaatacagatccaacaattgttgaaatgtgtaataatcatattcatagaaa 1187
Query: 1163 tttattattagaatcattaaattcatttgaaactttaacaaaatctgaat 1212 |||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1188 tttattattagaatcattaaattcatttgaaactttaacaaaatctgaat 1237
Score = 109 bits (55), Expect(2) = 0.0 Identities = 55/55 (100%) Strand = Plus / Plus
Query: 2799 gatagaggttcaggtgataatatcactgttttagttgtaattttgaattggaatt 2853 ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3028 gatagaggttcaggtgataatatcactgttttagttgtaattttgaattggaatt 3082
Score = 367 bits (185), Expect(5) = 0.0 Identities = 185/185 (100%) Strand = Plus / Plus
Query: 1224 aaataatgttagagaagagtttgaaggtatttttgatagtttaaaaattgatgcagagaa 1283 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1452 aaataatgttagagaagagtttgaaggtatttttgatagtttaaaaattgatgcagagaa 1511
Query: 1284 aagaggttttacaacaccttataatcaatcaaattcatcaccagtttcatcaattggttc 1343 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1512 aagaggttttacaacaccttataatcaatcaaattcatcaccagtttcatcaattggttc 1571
Query: 1344 aaattcatctaggaatagtcgtttaccaaatacttcagtttcaatacctggattatatag 1403 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1572 aaattcatctaggaatagtcgtttaccaaatacttcagtttcaatacctggattatatag 1631
Query: 1404 tagtg 1408 ||||| Sbjct: 1632 tagtg 1636
Score = 254 bits (128), Expect(5) = 0.0 Identities = 128/128 (100%) Strand = Plus / Plus
Query: 1476 tggatcatcaacattcccaagttcagttatatcaacaactggtagtataagtaattcaat 1535 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1704 tggatcatcaacattcccaagttcagttatatcaacaactggtagtataagtaattcaat 1763
Query: 1536 tgcaagtgcaatggataatgatagtagttatagtaatgaatcatcaccaacttcttcaat 1595 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1764 tgcaagtgcaatggataatgatagtagttatagtaatgaatcatcaccaacttcttcaat 1823
Query: 1596 gacattat 1603 |||||||| Sbjct: 1824 gacattat 1831
Score = 71.9 bits (36), Expect(5) = 0.0 Identities = 36/36 (100%) Strand = Plus / Plus
Query: 341 ttcgacatcatcaaatagtagtgttaataatactac 376 |||||||||||||||||||||||||||||||||||| Sbjct: 366 ttcgacatcatcaaatagtagtgttaataatactac 401
Score = 65.9 bits (33), Expect(5) = 0.0 Identities = 33/33 (100%) Strand = Plus / Plus
Query: 1667 ataataataacaataatgcaacggtagtaattg 1699 ||||||||||||||||||||||||||||||||| Sbjct: 1895 ataataataacaataatgcaacggtagtaattg 1927
Score = 52.0 bits (26), Expect(5) = 0.0 Identities = 26/26 (100%) Strand = Plus / Plus
Query: 177 cagtcaccagctcatagtagtttagc 202 |||||||||||||||||||||||||| Sbjct: 202 cagtcaccagctcatagtagtttagc 227
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 98226423 Number of Hits to DB: 2,485,510,382 Number of extensions: 145933164 Number of successful extensions: 11621954 Number of sequences better than 10.0: 124 Length of query: 2935 Length of database: 98,766,808,389 Length adjustment: 25 Effective length of query: 2910 Effective length of database: 96,311,147,814 Effective search space: 280265440138740 Effective search space used: 280265440138740 X1: 11 (21.8 bits) S2: 23 (46.1 bits)
|
protein update |
2009. 7.17 |
Homology vs Protein |
Query= Contig-U15789-1 (Contig-U15789-1Q) /CSM_Contig/Contig-U15789-1Q.Seq.d (2935 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AY328084_1(AY328084|pid:none) Hypocrea jecorina putative serine/... 143 4e-32 (Q09173) RecName: Full=Protein phosphatase 2C homolog 3; ... 143 4e-32 CU640366_29(CU640366|pid:none) Podospora anserina genomic DNA ch... 142 9e-32 L34882_1(L34882|pid:none) Schizosaccharomyces pombe protein phos... 140 2e-31 BX294012_38(BX294012|pid:none) Neurospora crassa DNA linkage gro... 140 4e-31 (Q09172) RecName: Full=Protein phosphatase 2C homolog 2; ... 139 6e-31 AM920431_242(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 138 1e-30 CR382131_607(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 134 3e-29 CP000079_240(CP000079|pid:none) Leishmania major strain Friedlin... 134 3e-29 AM502245_192(AM502245|pid:none) Leishmania infantum chromosome 27. 134 3e-29 AM494964_251(AM494964|pid:none) Leishmania braziliensis chromoso... 130 2e-28 BT036081_1(BT036081|pid:none) Zea mays full-length cDNA clone ZM... 127 3e-27 EU966941_1(EU966941|pid:none) Zea mays clone 298286 catalytic/ p... 126 5e-27 CT005271_264(CT005271|pid:none) Leishmania major strain Friedlin... 122 8e-26 AM502252_211(AM502252|pid:none) Leishmania infantum chromosome 34. 122 1e-25 (P49596) RecName: Full=Probable protein phosphatase 2C T23F11.1;... 121 2e-25 (Q0IIF0) RecName: Full=Integrin-linked kinase-associated serine/... 116 2e-25 AB022216_8(AB022216|pid:none) Arabidopsis thaliana genomic DNA, ... 119 5e-25 (A0CUB5) RecName: Full=Probable protein phosphatase 2C 5; ... 119 5e-25 BC062010_1(BC062010|pid:none) Rattus norvegicus integrin-linked ... 115 5e-25 (Q8R0F6) RecName: Full=Integrin-linked kinase-associated serine/... 115 5e-25 (Q9Z1Z6) RecName: Full=Integrin-linked kinase-associated serine/... 115 5e-25 (O81716) RecName: Full=Probable protein phosphatase 2C 21; ... 119 8e-25 AK001043_1(AK001043|pid:none) Homo sapiens cDNA FLJ10181 fis, cl... 114 9e-25 CR380949_181(CR380949|pid:none) Candida glabrata strain CBS138 c... 112 3e-24 FN357414_6(FN357414|pid:none) Schistosoma mansoni genome sequenc... 117 3e-24 (A0DSB3) RecName: Full=Probable protein phosphatase 2C 6; ... 117 3e-24 FN392322_762(FN392322|pid:none) Pichia pastoris GS115 chromosome... 116 5e-24 (P39966) RecName: Full=Protein phosphatase 2C homolog 2; ... 115 7e-24 (Q80TL0) RecName: Full=Protein phosphatase 1E; EC=3.1.3... 111 7e-24 (Q80Z30) RecName: Full=Protein phosphatase 1E; EC=3.1.3... 111 7e-24 AK122434_1(AK122434|pid:none) Mus musculus mRNA for mKIAA1072 pr... 111 7e-24 AK036583_1(AK036583|pid:none) Mus musculus adult male bone cDNA,... 111 7e-24 AM294176_1(AM294176|pid:none) Drosophila melanogaster CG6036 gen... 115 7e-24 (P40371) RecName: Full=Protein phosphatase 2C homolog 1; ... 115 9e-24 AC073166_14(AC073166|pid:none) Oryza sativa chromosome 10 BAC OS... 115 1e-23 AC051633_2(AC051633|pid:none) Oryza sativa chromosome 10 BAC OSJ... 115 1e-23 CP000502_293(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 115 1e-23 (Q8WY54) RecName: Full=Protein phosphatase 1E; EC=3.1.3... 110 1e-23 FM245282_1(FM245282|pid:none) Drosophila melanogaster CG6036 gen... 114 1e-23 CU928173_173(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 114 2e-23 AB028995_1(AB028995|pid:none) Homo sapiens mRNA for KIAA1072 pro... 110 2e-23 AB384101_1(AB384101|pid:none) Synthetic construct DNA, clone: pF... 110 2e-23 (Q6L5C4) RecName: Full=Probable protein phosphatase 2C 52; ... 110 2e-23 AF309503_1(AF309503|pid:none) Sterkiella histriomuscorum phospha... 114 2e-23 AF428352_1(AF428352|pid:none) Arabidopsis thaliana At1g18030/T10... 114 3e-23 (Q9LMT1) RecName: Full=Probable protein phosphatase 2C 8; ... 114 3e-23 AM494957_204(AM494957|pid:none) Leishmania braziliensis chromoso... 110 3e-23 BC077612_1(BC077612|pid:none) Xenopus laevis MGC84595 protein, m... 112 3e-23 BC162507_1(BC162507|pid:none) Danio rerio protein phosphatase 1E... 108 4e-23 AB113302_1(AB113302|pid:none) Danio rerio mRNA for Ca/calmodulin... 108 4e-23 BT050499_1(BT050499|pid:none) Drosophila melanogaster FI06504 fu... 112 4e-23 FM245283_1(FM245283|pid:none) Drosophila melanogaster CG6036 gen... 112 4e-23 AM294173_1(AM294173|pid:none) Drosophila melanogaster CG6036 gen... 112 4e-23 AM294168_1(AM294168|pid:none) Drosophila melanogaster CG6036 gen... 112 4e-23 CP001141_55(CP001141|pid:none) Phaeodactylum tricornutum CCAP 10... 113 5e-23 AM294174_1(AM294174|pid:none) Drosophila melanogaster CG6036 gen... 112 5e-23 BT033458_1(BT033458|pid:none) Zea mays full-length cDNA clone ZM... 112 6e-23 AB083482_1(AB083482|pid:none) Mesembryanthemum crystallinum MPC9... 112 6e-23 AC023673_27(AC023673|pid:none) Genomic sequence for Arabidopsis ... 112 8e-23 (P35182) RecName: Full=Protein phosphatase 2C homolog 1; ... 112 8e-23 AK111778_1(AK111778|pid:none) Oryza sativa Japonica Group cDNA c... 111 1e-22 (Q653S3) RecName: Full=Probable protein phosphatase 2C 70; ... 111 1e-22 BX005237_2(BX005237|pid:none) Zebrafish DNA sequence from clone ... 108 2e-22 FB916629_1(FB916629|pid:none) Sequence 135902 from Patent WO2008... 110 2e-22 BT041216_1(BT041216|pid:none) Zea mays full-length cDNA clone ZM... 111 2e-22 EF087817_1(EF087817|pid:none) Picea sitchensis clone WS02815_K22... 111 2e-22 FM992688_855(FM992688|pid:none) Candida dubliniensis CD36 chromo... 111 2e-22 AK176676_1(AK176676|pid:none) Arabidopsis thaliana mRNA for puta... 111 2e-22 FB916639_1(FB916639|pid:none) Sequence 135912 from Patent WO2008... 110 2e-22 CR382126_637(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 110 3e-22 BT053004_1(BT053004|pid:none) Medicago truncatula clone MTYFL_FM... 110 3e-22 (P49444) RecName: Full=Protein phosphatase 2C 1; Short=... 110 4e-22 BC072171_1(BC072171|pid:none) Xenopus laevis hypothetical protei... 110 4e-22 AM436463_1(AM436463|pid:none) Vitis vinifera contig VV78X032613.... 108 5e-22 EF672269_1(EF672269|pid:none) Triticum aestivum cultivar Kharchi... 108 5e-22 (Q94AT1) RecName: Full=Probable protein phosphatase 2C 76; ... 107 6e-22 EU827608_1(EU827608|pid:none) Hevea brasiliensis protein phospha... 108 6e-22 AM502252_210(AM502252|pid:none) Leishmania infantum chromosome 34. 109 7e-22 (Q652Z7) RecName: Full=Probable protein phosphatase 2C 55; ... 109 7e-22 FB819527_1(FB819527|pid:none) Sequence 38800 from Patent WO20080... 107 8e-22 (Q67UX7) RecName: Full=Probable protein phosphatase 2C 10; ... 106 8e-22 BC027439_1(BC027439|pid:none) Mus musculus integrin-linked kinas... 108 9e-22 (Q8VZN9) RecName: Full=Probable protein phosphatase 2C 11; ... 108 1e-21 (Q0J2R1) RecName: Full=Probable protein phosphatase 2C 67; ... 108 1e-21 AE017343_35(AE017343|pid:none) Cryptococcus neoformans var. neof... 108 1e-21 AP008212_1939(AP008212|pid:none) Oryza sativa (japonica cultivar... 106 1e-21 CR380947_178(CR380947|pid:none) Candida glabrata strain CBS138 c... 108 1e-21 BT080530_1(BT080530|pid:none) Caligus clemensi clone ccle-evs-50... 108 1e-21 (Q6EN45) RecName: Full=Probable protein phosphatase 2C 13; ... 106 2e-21 (Q6ETK3) RecName: Full=Probable protein phosphatase 2C 11; ... 107 2e-21 BC071108_1(BC071108|pid:none) Xenopus laevis MGC81273 protein, m... 107 2e-21 FB916529_1(FB916529|pid:none) Sequence 135802 from Patent WO2008... 107 2e-21 (A0BQL0) RecName: Full=Probable protein phosphatase 2C 3; ... 107 2e-21 AF369981_1(AF369981|pid:none) Mus musculus PP alpha 2 mRNA, comp... 107 2e-21 AE014297_4571(AE014297|pid:none) Drosophila melanogaster chromos... 107 3e-21 (Q7XR06) RecName: Full=Probable protein phosphatase 2C 45; ... 107 3e-21 (Q9SLA1) RecName: Full=Probable protein phosphatase 2C 22; ... 107 3e-21 AJ851753_1(AJ851753|pid:none) Gallus gallus mRNA for hypothetica... 107 3e-21 AE014297_4567(AE014297|pid:none) Drosophila melanogaster chromos... 107 3e-21 AE014297_4568(AE014297|pid:none) Drosophila melanogaster chromos... 107 3e-21 D13640_1(D13640|pid:none) Homo sapiens KIAA0015 mRNA, partial cds. 102 3e-21 (P49593) RecName: Full=Protein phosphatase 1F; EC=3.1.3... 102 3e-21 AM460550_1(AM460550|pid:none) Vitis vinifera contig VV78X210042.... 107 3e-21 (P49443) RecName: Full=Protein phosphatase 1A; EC=3.1.3... 107 3e-21 AM690405_1(AM690405|pid:none) Populus tremula abi1B gene for abs... 99 4e-21 AM690409_1(AM690409|pid:none) Populus tremula abi1B gene for abs... 99 4e-21 EF677847_1(EF677847|pid:none) Picea sitchensis clone WS02776_C07... 105 4e-21 CR380955_209(CR380955|pid:none) Candida glabrata strain CBS138 c... 106 4e-21 (Q9FYN7) RecName: Full=Probable protein phosphatase 2C 2; ... 106 4e-21 (O62829) RecName: Full=Protein phosphatase 1A; EC=3.1.3... 106 4e-21 AM690399_1(AM690399|pid:none) Populus tremula abi1B gene for abs... 98 5e-21 AM690422_1(AM690422|pid:none) Populus tremula abi1B gene for abs... 98 5e-21 AM690397_1(AM690397|pid:none) Populus tremula abi1B gene for abs... 98 5e-21 AM690396_1(AM690396|pid:none) Populus tremula abi1B gene for abs... 98 5e-21 AM690393_1(AM690393|pid:none) Populus tremula abi1B gene for abs... 98 5e-21 BT085682_1(BT085682|pid:none) Zea mays full-length cDNA clone ZM... 105 5e-21 EF083289_1(EF083289|pid:none) Picea sitchensis clone WS0282_P11 ... 105 5e-21 (A0DTY1) RecName: Full=Probable protein phosphatase 2C 4; ... 106 6e-21 CR860442_1(CR860442|pid:none) Pongo abelii mRNA; cDNA DKFZp459L2... 106 6e-21 AC136840_3(AC136840|pid:none) Medicago truncatula clone mth2-33n... 106 6e-21 CR382135_121(CR382135|pid:none) Debaryomyces hansenii strain CBS... 106 6e-21 AM690411_1(AM690411|pid:none) Populus tremula abi1B gene for abs... 98 7e-21 AM690407_1(AM690407|pid:none) Populus tremula abi1B gene for abs... 98 7e-21 EF082874_1(EF082874|pid:none) Picea sitchensis clone WS02725_C02... 105 7e-21 (P20650) RecName: Full=Protein phosphatase 1A; EC=3.1.3... 105 7e-21 FB916621_1(FB916621|pid:none) Sequence 135894 from Patent WO2008... 105 7e-21 AM690427_1(AM690427|pid:none) Populus tremula abi1B gene for abs... 97 9e-21 AM690423_1(AM690423|pid:none) Populus tremula abi1B gene for abs... 97 9e-21 AM690418_1(AM690418|pid:none) Populus tremula abi1B gene for abs... 97 9e-21 EU965062_1(EU965062|pid:none) Zea mays clone 283527 catalytic/ p... 104 9e-21 AE017341_470(AE017341|pid:none) Cryptococcus neoformans var. neo... 105 1e-20 AM262978_1(AM262978|pid:none) Cocos nucifera partial mRNA for ph... 105 1e-20 JC2524(JC2524) phosphoprotein phosphatase (EC 3.1.3.16) 1A-beta ... 105 1e-20 AF070670_1(AF070670|pid:none) Homo sapiens protein phosphatase 2... 105 1e-20 BC081762_1(BC081762|pid:none) Rattus norvegicus protein phosphat... 105 1e-20 CR861214_1(CR861214|pid:none) Pongo abelii mRNA; cDNA DKFZp459D0... 105 1e-20 (P35815) RecName: Full=Protein phosphatase 1B; EC=3.1.3... 105 1e-20 AK313337_1(AK313337|pid:none) Homo sapiens cDNA, FLJ93859, highl... 105 1e-20 AP004745_2(AP004745|pid:none) Oryza sativa Japonica Group genomi... 105 1e-20 AE016818_337(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 105 1e-20 AJ271834_1(AJ271834|pid:none) Rattus norvegicus mRNA for protein... 105 1e-20 DQ056688_1(DQ056688|pid:none) Arabidopsis thaliana putative prot... 103 2e-20 FN392320_1101(FN392320|pid:none) Pichia pastoris GS115 chromosom... 104 2e-20 CR382130_886(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 104 2e-20 (Q9SZ53) RecName: Full=Probable protein phosphatase 2C 60; ... 104 2e-20 (Q8LAY8) RecName: Full=Probable protein phosphatase 2C 69; ... 103 2e-20 (A0BLX0) RecName: Full=Probable protein phosphatase 2C 2; ... 104 2e-20 AK318917_1(AK318917|pid:none) Arabidopsis thaliana AT4G31860 mRN... 104 2e-20 (Q8CGA0) RecName: Full=Protein phosphatase 1F; EC=3.1.3... 98 3e-20 BC135714_1(BC135714|pid:none) Xenopus tropicalis protein phospha... 103 3e-20 (O04719) RecName: Full=Protein phosphatase 2C 77; Short... 100 3e-20 BT067193_1(BT067193|pid:none) Zea mays full-length cDNA clone ZM... 103 4e-20 BT035220_1(BT035220|pid:none) Zea mays full-length cDNA clone ZM... 103 4e-20 AF543426_1(AF543426|pid:none) Leymus cinereus putative serine/th... 103 4e-20 AF136972_1(AF136972|pid:none) Homo sapiens protein phosphatase 2... 103 5e-20 BT034542_1(BT034542|pid:none) Zea mays full-length cDNA clone ZM... 103 5e-20 BT063767_1(BT063767|pid:none) Zea mays full-length cDNA clone ZM... 103 5e-20 DQ023511_1(DQ023511|pid:none) Homo sapiens PPM1B beta isoform va... 103 5e-20 BC042302_1(BC042302|pid:none) Xenopus laevis protein phosphatase... 103 5e-20 (O75688) RecName: Full=Protein phosphatase 1B; EC=3.1.3... 103 5e-20 AK291214_1(AK291214|pid:none) Homo sapiens cDNA FLJ77281 complet... 103 5e-20 DQ023510_1(DQ023510|pid:none) Homo sapiens PPM1B beta isoform va... 103 5e-20 DQ023509_1(DQ023509|pid:none) Homo sapiens PPM1B beta isoform va... 103 5e-20 AM690416_1(AM690416|pid:none) Populus tremula abi1B gene for abs... 95 6e-20 AM690417_1(AM690417|pid:none) Populus tremula abi1B gene for abs... 95 6e-20 FN357329_19(FN357329|pid:none) Schistosoma mansoni genome sequen... 102 6e-20 I49016(I49016;S65671;S39780;S39781) phosphoprotein phosphatase (... 102 6e-20 AJ271833_1(AJ271833|pid:none) Mus musculus mRNA for protein phos... 102 6e-20 (P36993) RecName: Full=Protein phosphatase 1B; EC=3.1.3... 102 6e-20 D17412_1(D17412|pid:none) Mus musculus mRNA for magnesium depend... 102 6e-20 (Q9WVR7) RecName: Full=Protein phosphatase 1F; EC=3.1.3... 96 7e-20 AY815711_1(AY815711|pid:none) Schistosoma japonicum SJCHGC09402 ... 101 7e-20 FM992695_139(FM992695|pid:none) Candida dubliniensis CD36 chromo... 102 8e-20 AJ438209_1(AJ438209|pid:none) Xenopus laevis mRNA for protein ph... 102 8e-20 BT066927_1(BT066927|pid:none) Zea mays full-length cDNA clone ZM... 102 8e-20 (P93006) RecName: Full=Probable protein phosphatase 2C 27; ... 102 8e-20 AJ242803_1(AJ242803|pid:none) Sporobolus stapfianus partial mRNA... 102 8e-20 EF676303_1(EF676303|pid:none) Picea sitchensis clone WS02730_I12... 102 1e-19 BT034543_1(BT034543|pid:none) Zea mays full-length cDNA clone ZM... 99 1e-19 AM502250_210(AM502250|pid:none) Leishmania infantum chromosome 32. 101 1e-19 BT069657_1(BT069657|pid:none) Zea mays full-length cDNA clone ZM... 97 2e-19 BC108055_1(BC108055|pid:none) Danio rerio protein phosphatase 1,... 101 2e-19 BC066510_1(BC066510|pid:none) Danio rerio protein phosphatase ty... 101 2e-19 BC125894_1(BC125894|pid:none) Danio rerio protein phosphatase 1,... 101 2e-19 FB819295_1(FB819295|pid:none) Sequence 38568 from Patent WO20080... 100 2e-19 BT034407_1(BT034407|pid:none) Zea mays full-length cDNA clone ZM... 99 2e-19 (Q69VD9) RecName: Full=Probable protein phosphatase 2C 57; ... 100 2e-19 FB819331_1(FB819331|pid:none) Sequence 38604 from Patent WO20080... 100 2e-19 AC002409_6(AC002409|pid:none) Arabidopsis thaliana chromosome 2 ... 93 4e-19 AB025622_8(AB025622|pid:none) Arabidopsis thaliana genomic DNA, ... 98 4e-19 AK056009_1(AK056009|pid:none) Homo sapiens cDNA FLJ31447 fis, cl... 100 4e-19 BT041319_1(BT041319|pid:none) Zea mays full-length cDNA clone ZM... 97 5e-19 (P34221) RecName: Full=Protein phosphatase 2C homolog 3; ... 100 5e-19 AB238931_1(AB238931|pid:none) Triticum monococcum TmABI1 gene fo... 94 6e-19 AB238930_1(AB238930|pid:none) Triticum aestivum TaABI1 mRNA for ... 94 6e-19 AY621066_1(AY621066|pid:none) Zea mays protein phosphatase 2C (P... 97 6e-19 EF082346_1(EF082346|pid:none) Picea sitchensis clone WS0278_B10 ... 99 9e-19 BC124948_1(BC124948|pid:none) Xenopus laevis hypothetical LOC494... 99 1e-18 EF678039_1(EF678039|pid:none) Picea sitchensis clone WS02821_B21... 99 1e-18 FN357404_20(FN357404|pid:none) Schistosoma mansoni genome sequen... 98 2e-18 T21331(T21331) hypothetical protein F25D1.1 - Caenorhabditis ele... 98 2e-18 Z73973_4(Z73973|pid:none) Caenorhabditis elegans Cosmid F25D1, c... 98 2e-18 BT033252_1(BT033252|pid:none) Zea mays full-length cDNA clone ZM... 98 2e-18 BT054219_1(BT054219|pid:none) Zea mays full-length cDNA clone ZM... 98 2e-18 AF480497_16(AF480497|pid:none) Oryza sativa clone BAC 24K23, com... 98 2e-18 AC159450_37(AC159450|pid:none) Trypanosoma brucei chromosome 7 c... 97 3e-18 AF268069_1(AF268069|pid:none) Caenorhabditis sp. CB5161 putative... 97 3e-18 AF213455_1(AF213455|pid:none) Zea mays protein phosphatase type-... 97 3e-18 Z73973_5(Z73973|pid:none) Caenorhabditis elegans Cosmid F25D1, c... 97 3e-18 FB916543_1(FB916543|pid:none) Sequence 135816 from Patent WO2008... 92 3e-18 (Q6L4R7) RecName: Full=Probable protein phosphatase 2C 53; ... 92 3e-18 FN319379_1(FN319379|pid:none) Schistosoma japonicum isolate Anhu... 97 3e-18 BT087808_1(BT087808|pid:none) Zea mays full-length cDNA clone ZM... 97 3e-18 FN319380_1(FN319380|pid:none) Schistosoma japonicum isolate Anhu... 97 3e-18 FN314679_1(FN314679|pid:none) Schistosoma japonicum isolate Anhu... 97 4e-18 FB819537_1(FB819537|pid:none) Sequence 38810 from Patent WO20080... 97 4e-18 BT061924_1(BT061924|pid:none) Zea mays full-length cDNA clone ZM... 94 5e-18 (Q5SGD2) RecName: Full=Protein phosphatase 1L; EC=3.1.3... 96 8e-18 CT005272_54(CT005272|pid:none) Leishmania major strain Friedlin,... 96 8e-18 (Q8BHN0) RecName: Full=Protein phosphatase 1L; EC=3.1.3... 96 8e-18 AK032529_1(AK032529|pid:none) Mus musculus adult male olfactory ... 96 8e-18 AK147876_1(AK147876|pid:none) Mus musculus melanocyte cDNA, RIKE... 96 8e-18 X78886_1(X78886|pid:none) A.thaliana (Landsberg erecta) ABI1 gene. 92 1e-17 (P49597) RecName: Full=Protein phosphatase 2C 56; Short... 92 1e-17 AF543425_1(AF543425|pid:none) Leymus triticoides putative serine... 95 1e-17 CP001334_247(CP001334|pid:none) Micromonas sp. RCC299 chromosome... 95 1e-17 CP001323_403(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 95 2e-17 BT041229_1(BT041229|pid:none) Zea mays full-length cDNA clone ZM... 90 2e-17 AE016816_443(AE016816|pid:none) Ashbya gossypii (= Eremothecium ... 94 2e-17 CR382122_355(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 94 3e-17 AC174468_16(AC174468|pid:none) Medicago truncatula chromosome 2 ... 94 3e-17 AM427863_1(AM427863|pid:none) Vitis vinifera contig VV78X216827.... 94 3e-17 EU971336_1(EU971336|pid:none) Zea mays clone 362394 protein phos... 94 3e-17 BC079530_1(BC079530|pid:none) Danio rerio protein phosphatase ty... 94 4e-17 CU633900_497(CU633900|pid:none) Podospora anserina genomic DNA c... 94 4e-17 AF075579_1(AF075579|pid:none) Mesembryanthemum crystallinum clon... 93 5e-17 FB819535_1(FB819535|pid:none) Sequence 38808 from Patent WO20080... 93 5e-17 AF428395_1(AF428395|pid:none) Arabidopsis thaliana AT5g59220/mnc... 93 5e-17 AB016890_12(AB016890|pid:none) Arabidopsis thaliana genomic DNA,... 93 5e-17 AP008212_1241(AP008212|pid:none) Oryza sativa (japonica cultivar... 93 6e-17 FB916525_1(FB916525|pid:none) Sequence 135798 from Patent WO2008... 93 6e-17 AC126786_21(AC126786|pid:none) Medicago truncatula clone mth2-8c... 93 6e-17 (Q9LNW3) RecName: Full=Protein phosphatase 2C 3; Short=... 92 8e-17 (Q9XEE8) RecName: Full=Probable protein phosphatase 2C 30; ... 92 8e-17 (Q5SN75) RecName: Full=Probable protein phosphatase 2C 8; ... 91 9e-17 CP000585_306(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 89 9e-17 EU162609_21(EU162609|pid:none) Cleome spinosa clone contig83 BAC... 92 1e-16 FB916517_1(FB916517|pid:none) Sequence 135790 from Patent WO2008... 92 1e-16 BT035533_1(BT035533|pid:none) Zea mays full-length cDNA clone ZM... 92 1e-16 FB819531_1(FB819531|pid:none) Sequence 38804 from Patent WO20080... 91 2e-16 FB916533_1(FB916533|pid:none) Sequence 135806 from Patent WO2008... 87 2e-16 AF075582_1(AF075582|pid:none) Mesembryanthemum crystallinum clon... 90 2e-16 AC022314_6(AC022314|pid:none) Genomic sequence for Arabidopsis t... 91 2e-16 CP000589_345(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 91 2e-16 FB916609_1(FB916609|pid:none) Sequence 135882 from Patent WO2008... 91 2e-16 CT005254_17(CT005254|pid:none) Leishmania major strain Friedlin,... 91 2e-16 AK059302_1(AK059302|pid:none) Oryza sativa Japonica Group cDNA c... 91 2e-16 AB026112_1(AB026112|pid:none) Entamoeba histolytica EhPP2C gene ... 91 2e-16 FB916523_1(FB916523|pid:none) Sequence 135796 from Patent WO2008... 91 3e-16 AP005593_18(AP005593|pid:none) Oryza sativa Japonica Group genom... 91 3e-16 AP008215_334(AP008215|pid:none) Oryza sativa (japonica cultivar-... 91 3e-16 (Q0J2L7) RecName: Full=Probable protein phosphatase 2C 68; ... 91 3e-16 BT084334_1(BT084334|pid:none) Zea mays full-length cDNA clone ZM... 90 4e-16 BT052839_1(BT052839|pid:none) Medicago truncatula clone MTYFH_FI... 90 4e-16 AM270324_15(AM270324|pid:none) Aspergillus niger contig An14c017... 90 4e-16 (Q7XQU7) RecName: Full=Probable protein phosphatase 2C 41; ... 90 4e-16 AK118656_1(AK118656|pid:none) Arabidopsis thaliana At1g17550 mRN... 90 4e-16 FB916605_1(FB916605|pid:none) Sequence 135878 from Patent WO2008... 90 5e-16 (Q5N9N2) RecName: Full=Probable protein phosphatase 2C 9; ... 87 6e-16 FB916515_1(FB916515|pid:none) Sequence 135788 from Patent WO2008... 86 6e-16 AP007166_406(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 89 7e-16 EU162611_15(EU162611|pid:none) Capsella rubella clone contig46 B... 89 7e-16 CR788247_3(CR788247|pid:none) Zebrafish DNA sequence from clone ... 89 7e-16 EU961793_1(EU961793|pid:none) Zea mays clone 238267 protein phos... 89 9e-16 CP000582_225(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 89 9e-16 AM502233_17(AM502233|pid:none) Leishmania infantum chromosome 15. 89 1e-15 EU162608_25(EU162608|pid:none) Arabidopsis lyrata subsp. lyrata ... 89 1e-15 (Q7K4Q5) RecName: Full=Probable protein phosphatase CG10417; ... 89 1e-15 AB206783_1(AB206783|pid:none) Solanum tuberosum StP2C mRNA for p... 89 1e-15 AF092431_1(AF092431|pid:none) Lotus japonicus nodule-enhanced pr... 89 1e-15 BT069438_1(BT069438|pid:none) Zea mays full-length cDNA clone ZM... 89 1e-15 (Q93YW5) RecName: Full=Probable protein phosphatase 2C 58; ... 88 2e-15 AB369255_1(AB369255|pid:none) Physcomitrella patens PpABI1B mRNA... 86 2e-15 FN392321_1194(FN392321|pid:none) Pichia pastoris GS115 chromosom... 88 2e-15 (Q7XU84) RecName: Full=Probable protein phosphatase 2C 42; ... 88 2e-15 AJ277743_1(AJ277743|pid:none) Fagus sylvatica mRNA for ABA induc... 86 3e-15 FB819403_1(FB819403|pid:none) Sequence 38676 from Patent WO20080... 87 3e-15 EU180848_14(EU180848|pid:none) Boechera divaricarpa clone BAC45b... 87 3e-15 CR954209_380(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 87 3e-15 AY497903_1(AY497903|pid:none) Zea mays putative protein phosphat... 87 3e-15 FB916521_1(FB916521|pid:none) Sequence 135794 from Patent WO2008... 87 3e-15 AM452139_1(AM452139|pid:none) Vitis vinifera contig VV78X031994.... 86 3e-15 AY220484_1(AY220484|pid:none) Nicotiana tabacum Avr9/Cf-9 rapidl... 87 5e-15 AC186755_14(AC186755|pid:none) Musa balbisiana clone MBP_91N22, ... 87 5e-15 (P38089) RecName: Full=Protein phosphatase 2C homolog 4; ... 86 6e-15 (Q65XG6) RecName: Full=Probable protein phosphatase 2C 49; ... 86 6e-15 AY084874_1(AY084874|pid:none) Arabidopsis thaliana clone 119977 ... 86 8e-15 (Q5JJY4) RecName: Full=Protein kinase and PP2C-like domain-conta... 81 1e-14 BT033191_1(BT033191|pid:none) Zea mays full-length cDNA clone ZM... 86 1e-14 AY830123_1(AY830123|pid:none) Zea mays putative protein phosphat... 86 1e-14 (Q9CAJ0) RecName: Full=Protein phosphatase 2C 16; Short... 84 1e-14 FB819561_1(FB819561|pid:none) Sequence 38834 from Patent WO20080... 85 1e-14 BT054489_1(BT054489|pid:none) Zea mays full-length cDNA clone ZM... 85 1e-14 BT038874_1(BT038874|pid:none) Zea mays full-length cDNA clone ZM... 85 1e-14 AB210224_1(AB210224|pid:none) Nicotiana benthamiana NbP2C mRNA f... 85 2e-14 (Q9LDA7) RecName: Full=Probable protein phosphatase 2C 39; ... 84 2e-14 AY120770_1(AY120770|pid:none) Arabidopsis thaliana putative prot... 84 2e-14 FB819521_1(FB819521|pid:none) Sequence 38794 from Patent WO20080... 84 2e-14 EU974604_1(EU974604|pid:none) Zea mays clone 454176 protein phos... 84 2e-14 AP008207_1857(AP008207|pid:none) Oryza sativa (japonica cultivar... 83 3e-14 DQ303437_1(DQ303437|pid:none) Gossypium hirsutum protein phospha... 84 3e-14 (Q9SIU8) RecName: Full=Probable protein phosphatase 2C 20; ... 84 3e-14 AF407334_1(AF407334|pid:none) Lentinula edodes guanine nucleotid... 84 4e-14 BT084381_1(BT084381|pid:none) Zea mays full-length cDNA clone ZM... 84 4e-14 FB819549_1(FB819549|pid:none) Sequence 38822 from Patent WO20080... 84 4e-14 CP001333_282(CP001333|pid:none) Micromonas sp. RCC299 chromosome... 78 5e-14 (Q9S9Z7) RecName: Full=Probable protein phosphatase 2C 10; ... 83 5e-14 FB819545_1(FB819545|pid:none) Sequence 38818 from Patent WO20080... 83 5e-14 AB079672_1(AB079672|pid:none) Arabidopsis thaliana AtPPC3;1.2 mR... 83 5e-14 AM270168_167(AM270168|pid:none) Aspergillus niger contig An08c01... 83 7e-14 AF329891_1(AF329891|pid:none) Pisolithus sp. 441 G protein alpha... 83 7e-14 AB369257_1(AB369257|pid:none) Physcomitrella patens pphn39k21 mR... 83 7e-14 FB916607_1(FB916607|pid:none) Sequence 135880 from Patent WO2008... 83 7e-14 FM992695_509(FM992695|pid:none) Candida dubliniensis CD36 chromo... 83 7e-14 AM424561_1(AM424561|pid:none) Vitis vinifera contig VV78X188716.... 82 9e-14 BT052285_1(BT052285|pid:none) Medicago truncatula clone MTYF9_FA... 82 9e-14 (O74259) RecName: Full=Guanine nucleotide-binding protein subuni... 82 1e-13 (Q501F9) RecName: Full=Probable protein phosphatase 2C 67; ... 82 1e-13 AL442105_9(AL442105|pid:none) Oryza sativa genomic DNA, chromoso... 82 1e-13 (P87032) RecName: Full=Guanine nucleotide-binding protein alpha-... 81 2e-13 CR382137_930(CR382137|pid:none) Debaryomyces hansenii strain CBS... 81 2e-13 CU928175_706(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 81 2e-13 (O42784) RecName: Full=Guanine nucleotide-binding protein subuni... 81 3e-13 AP007161_483(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 81 3e-13 AB051903_1(AB051903|pid:none) Schizophyllum commune ScGP-B gene ... 81 3e-13 FB819523_1(FB819523|pid:none) Sequence 38796 from Patent WO20080... 81 3e-13 DQ458049_1(DQ458049|pid:none) Mycosphaerella graminicola G-prote... 80 3e-13 FB819551_1(FB819551|pid:none) Sequence 38824 from Patent WO20080... 80 3e-13 FB916519_1(FB916519|pid:none) Sequence 135792 from Patent WO2008... 80 3e-13 EF676359_1(EF676359|pid:none) Picea sitchensis clone WS02733_E12... 80 3e-13 FM945398_1(FM945398|pid:none) Calliphora vicina partial mRNA for... 80 3e-13 (Q00743) RecName: Full=Guanine nucleotide-binding protein subuni... 80 4e-13 AF011341_1(AF011341|pid:none) Magnaporthe grisea G alpha subunit... 80 4e-13 DQ863321_1(DQ863321|pid:none) Penicillium marneffei GPA2-like pr... 80 4e-13 AM888285_1(AM888285|pid:none) Sordaria macrospora gsa1 gene for ... 80 4e-13 (Q05425) RecName: Full=Guanine nucleotide-binding protein alpha-... 80 4e-13 (O13315) RecName: Full=Guanine nucleotide-binding protein subuni... 80 4e-13 AF448796_1(AF448796|pid:none) Penicillium marneffei G-alpha subu... 80 4e-13 AK097444_1(AK097444|pid:none) Homo sapiens cDNA FLJ40125 fis, cl... 80 4e-13 (Q9FLI3) RecName: Full=Probable protein phosphatase 2C 75; ... 80 4e-13 BT084605_1(BT084605|pid:none) Zea mays full-length cDNA clone ZM... 80 4e-13 AK318665_1(AK318665|pid:none) Arabidopsis thaliana AT1G72770 mRN... 78 5e-13 AY036905_1(AY036905|pid:none) Trichoderma atroviride protein GTP... 80 6e-13 AY357297_1(AY357297|pid:none) Cryptococcus neoformans var. grubi... 79 7e-13 FB916537_1(FB916537|pid:none) Sequence 135810 from Patent WO2008... 79 7e-13 AL031264_1(AL031264|pid:none) Caenorhabditis elegans Plasmid VF4... 79 7e-13 AL606594_20(AL606594|pid:none) Oryza sativa genomic DNA, chromos... 79 7e-13 AL162973_7(AL162973|pid:none) Arabidopsis thaliana DNA chromosom... 79 7e-13 AM920418_4(AM920418|pid:none) Penicillium chrysogenum Wisconsin ... 79 7e-13 EU967698_1(EU967698|pid:none) Zea mays clone 305434 protein phos... 79 1e-12 FB916623_1(FB916623|pid:none) Sequence 135896 from Patent WO2008... 79 1e-12 AM910985_79(AM910985|pid:none) Plasmodium knowlesi strain H chro... 79 1e-12 AM494951_88(AM494951|pid:none) Leishmania braziliensis chromosom... 79 1e-12 AF370014_1(AF370014|pid:none) Leptosphaeria maculans G-protein a... 78 2e-12 (O74227) RecName: Full=Guanine nucleotide-binding protein subuni... 78 2e-12 AB239917_1(AB239917|pid:none) Alternaria alternata AGA1 gene for... 78 2e-12 AE017341_175(AE017341|pid:none) Cryptococcus neoformans var. neo... 78 2e-12 AM494967_42(AM494967|pid:none) Leishmania braziliensis chromosom... 78 2e-12 CP001328_387(CP001328|pid:none) Micromonas sp. RCC299 chromosome... 78 2e-12 BC091099_1(BC091099|pid:none) Xenopus tropicalis hypothetical pr... 78 2e-12 BC082933_1(BC082933|pid:none) Xenopus laevis hypothetical LOC494... 78 2e-12 AP008212_1240(AP008212|pid:none) Oryza sativa (japonica cultivar... 78 2e-12 AM502232_94(AM502232|pid:none) Leishmania infantum chromosome 14. 78 2e-12 FN357320_6(FN357320|pid:none) Schistosoma mansoni genome sequenc... 77 3e-12 AC144482_21(AC144482|pid:none) Medicago truncatula clone mth2-10... 77 3e-12 AC067971_13(AC067971|pid:none) Sequence of BAC F10K1 from Arabid... 77 3e-12 AK312455_1(AK312455|pid:none) Homo sapiens cDNA, FLJ92810, highl... 77 4e-12 AC012680_14(AC012680|pid:none) Arabidopsis thaliana chromosome 1... 77 4e-12 AK028275_1(AK028275|pid:none) Mus musculus 14, 17 days embryo he... 77 4e-12 (O15355) RecName: Full=Protein phosphatase 1G; EC=3.1.3... 77 4e-12 AC022492_26(AC022492|pid:none) Genomic sequence for Arabidopsis ... 77 4e-12 AB209197_1(AB209197|pid:none) Homo sapiens mRNA for protein phos... 77 4e-12 AL035475_38(AL035475|pid:none) Plasmodium falciparum MAL4P2. &A... 77 4e-12 (P16894) RecName: Full=Guanine nucleotide-binding protein alpha-... 77 5e-12 BC170086_1(BC170086|pid:none) Xenopus laevis G protein alpha sub... 76 6e-12 BC170080_1(BC170080|pid:none) Xenopus laevis G protein alpha sub... 76 6e-12 CP001574_264(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 76 6e-12 CT005267_38(CT005267|pid:none) Leishmania major strain Friedlin,... 76 6e-12 E84591(E84591)probable protein phosphatase 2C [imported] - Arabi... 76 6e-12 AY534757_1(AY534757|pid:none) Lycopersicon esculentum protein ph... 76 6e-12 AB066281_1(AB066281|pid:none) Ciona intestinalis CiGi1 for G pro... 76 8e-12 AJ294815_1(AJ294815|pid:none) Tapesia yallundae tyg1 gene for G ... 76 8e-12 NRL(1GIA) Gi alpha 1 (active form with bound gtp-gamma-s) - Rattus 75 1e-11 PDBN(1CIP)A MOL_ID: 1;MOL_ID: 1; MOLECULE: GUANINE NUCLEOTIDE-BI... 75 1e-11 (P10824) RecName: Full=Guanine nucleotide-binding protein G(i), ... 75 1e-11 AY891138_1(AY891138|pid:none) Synthetic construct Homo sapiens c... 75 1e-11 BT004027_1(BT004027|pid:none) Arabidopsis thaliana clone RAFL15-... 75 1e-11 AY254175_1(AY254175|pid:none) Mucor circinelloides G protein alp... 75 2e-11 (Q9N2V6) RecName: Full=Guanine nucleotide-binding protein alpha-... 75 2e-11 BT019775_1(BT019775|pid:none) Homo sapiens guanine nucleotide bi... 75 2e-11 (P63096) RecName: Full=Guanine nucleotide-binding protein G(i), ... 75 2e-11 (Q5RAD4) RecName: Full=Guanine nucleotide-binding protein G(i), ... 75 2e-11 BC026326_1(BC026326|pid:none) Homo sapiens guanine nucleotide bi... 75 2e-11 AK070388_1(AK070388|pid:none) Oryza sativa Japonica Group cDNA c... 69 2e-11 Z48008_1(Z48008|pid:none) S.cerevisiae chromosome IV cosmid 8119. 74 2e-11 AM502248_70(AM502248|pid:none) Leishmania infantum chromosome 30. 74 2e-11 AB168467_1(AB168467|pid:none) Macaca fascicularis testis cDNA cl... 74 2e-11 AY714376_1(AY714376|pid:none) Aegiceras corniculatum protein pho... 74 2e-11 (Q4R4V2) RecName: Full=Protein phosphatase 1G; EC=3.1.3... 74 2e-11 AF034540_1(AF034540|pid:none) Leishmania donovani protein phosph... 74 3e-11 X12924_1(X12924|pid:none) Bovine mRNA for GTP-binding protein G39. 74 3e-11 (P08239) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 3e-11 (O15976) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 3e-11 BC041734_1(BC041734|pid:none) Xenopus laevis protein phosphatase... 74 3e-11 DQ202701_1(DQ202701|pid:none) Cricetulus griseus guanine nucleot... 74 4e-11 AK056008_1(AK056008|pid:none) Homo sapiens cDNA FLJ31446 fis, cl... 74 4e-11 (P09471) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 4e-11 AY634286_1(AY634286|pid:none) Caenorhabditis briggsae strain AF1... 74 4e-11 (P59215) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 4e-11 (P10825) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 4e-11 CR859352_1(CR859352|pid:none) Pongo abelii mRNA; cDNA DKFZp469C1... 73 5e-11 AB066282_1(AB066282|pid:none) Ciona intestinalis CiGi1 for G pro... 73 5e-11 (P79126) RecName: Full=Protein phosphatase 1G; EC=3.1.3... 73 5e-11 AE014134_3059(AE014134|pid:none) Drosophila melanogaster chromos... 73 5e-11 EU976624_1(EU976624|pid:none) Zea mays clone 985461 unknown mRNA. 73 7e-11 (P10823) RecName: Full=Guanine nucleotide-binding protein alpha-... 72 9e-11 DQ327708_1(DQ327708|pid:none) Schistosoma japonicum GTP-binding ... 72 9e-11 AF525687_1(AF525687|pid:none) Rattus norvegicus protein phosphat... 72 9e-11 EF085320_1(EF085320|pid:none) Picea sitchensis clone WS02728_N15... 72 9e-11 EF145959_1(EF145959|pid:none) Populus trichocarpa clone WS0114_I... 72 9e-11 L24550_1(L24550|pid:none) Gallus gallus G protein alpha subunit ... 72 1e-10 (P27044) RecName: Full=Guanine nucleotide-binding protein G(i), ... 72 1e-10 M60162_1(M60162|pid:none) Human guanine nucleotide-binding regul... 72 1e-10 L24551_1(L24551|pid:none) Gallus gallus G protein (Galpa i3-o) m... 72 1e-10 RGRTO2(D40436;S12990)GTP-binding regulatory protein Go alpha cha... 72 1e-10 DQ656112_1(DQ656112|pid:none) Aplysia californica guanine nucleo... 72 1e-10 AF499718_1(AF499718|pid:none) Thellungiella halophila protein ph... 72 1e-10 CP000592_50(CP000592|pid:none) Ostreococcus lucimarinus CCE9901 ... 68 1e-10 CQ871846_1(CQ871846|pid:none) Sequence 19 from Patent WO20040790... 72 2e-10 AB022098_1(AB022098|pid:none) Halocynthia roretzi mRNA for G pro... 72 2e-10 (P38401) RecName: Full=Guanine nucleotide-binding protein G(i), ... 72 2e-10 M19182_1(M19182|pid:none) Homo sapiens guanine nucleotide-bindin... 72 2e-10 BC052132_1(BC052132|pid:none) Danio rerio protein phosphatase 1G... 71 2e-10 AE016817_24(AE016817|pid:none) Ashbya gossypii (= Eremothecium g... 71 2e-10 (P50146) RecName: Full=Guanine nucleotide-binding protein G(i), ... 71 3e-10 AE013599_1135(AE013599|pid:none) Drosophila melanogaster chromos... 71 3e-10 (P16378) RecName: Full=Guanine nucleotide-binding protein G(o) s... 71 3e-10 CP001334_238(CP001334|pid:none) Micromonas sp. RCC299 chromosome... 71 3e-10 (Q96NT4) RecName: Full=Protein phosphatase 1K, mitochondrial; ... 71 3e-10 EF085967_1(EF085967|pid:none) Picea sitchensis clone WS0276_A04 ... 71 3e-10 CP000581_203(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 71 3e-10 EU369353_1(EU369353|pid:none) Oncorhynchus mykiss G protein alph... 70 3e-10 (P38404) RecName: Full=Guanine nucleotide-binding protein G(o) s... 70 3e-10 AB047082_1(AB047082|pid:none) Halocynthia roretzi HrGi-1 mRNA fo... 70 3e-10 BC155288_1(BC155288|pid:none) Danio rerio guanine nucleotide bin... 70 3e-10 AC107067_1(AC107067|pid:none) Homo sapiens BAC clone RP11-10L7 f... 70 3e-10 AK054678_1(AK054678|pid:none) Homo sapiens cDNA FLJ30116 fis, cl... 70 3e-10 GN037443_1(GN037443|pid:none) Sequence 19 from Patent WO20090104... 70 3e-10 BT034371_1(BT034371|pid:none) Zea mays full-length cDNA clone ZM... 70 3e-10 RGXLOA(S02785)GTP-binding regulatory protein Go alpha chain - Af... 70 4e-10 T09152(T09152) GTP-binding regulatory protein alpha chain - spin... 70 4e-10 FN357685_8(FN357685|pid:none) Schistosoma mansoni genome sequenc... 70 4e-10 AY994097_1(AY994097|pid:none) Homo sapiens PP2C type mitochondri... 70 4e-10 EU969502_1(EU969502|pid:none) Zea mays clone 331112 unknown mRNA. 67 5e-10 BT060740_1(BT060740|pid:none) Zea mays full-length cDNA clone ZM... 70 6e-10 BC059637_1(BC059637|pid:none) Danio rerio guanine nucleotide bin... 70 6e-10 AF063866_81(AF063866|pid:none) Melanoplus sanguinipes entomopoxv... 70 6e-10 AJ277744_1(AJ277744|pid:none) Fagus sylvatica mRNA for ABA and c... 70 6e-10 (Q9SD12) RecName: Full=Probable protein phosphatase 2C 46; ... 70 6e-10 (P28052) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 8e-10 AF540394_1(AF540394|pid:none) Schistosoma mansoni trimeric G-pro... 69 8e-10 AB167957_1(AB167957|pid:none) Bombyx mori mRNA for G protein alp... 69 8e-10 BC053164_1(BC053164|pid:none) Danio rerio guanine nucleotide bin... 69 8e-10 AY327542_1(AY327542|pid:none) Phaeosphaeria nodorum G-alpha subu... 69 8e-10 (Q61B55) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 8e-10 BC162964_1(BC162964|pid:none) Danio rerio guanine nucleotide bin... 69 8e-10 AY603976_1(AY603976|pid:none) Sitobion avenae guanine nucleotide... 69 8e-10 (Q2PC20) RecName: Full=Protein phosphatase 1K, mitochondrial; ... 69 8e-10 BC118079_1(BC118079|pid:none) Bos taurus PPM1K protein, mRNA (cD... 69 8e-10 AM055942_42(AM055942|pid:none) Toxoplasma gondii RH, genomic DNA... 69 8e-10 A41106(A41106) GTP-binding protein alpha chain gpa1 - fission ye... 69 1e-09 BC080940_1(BC080940|pid:none) Xenopus tropicalis guanine nucleot... 69 1e-09 BC044123_1(BC044123|pid:none) Xenopus laevis alpha-subunit of G-... 69 1e-09 (P50149) RecName: Full=Guanine nucleotide-binding protein G(t) s... 69 1e-09 (P34046) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 1e-09 (P20353) RecName: Full=Guanine nucleotide-binding protein G(i) s... 69 1e-09 (P27584) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 1e-09 AL671854_10(AL671854|pid:none) Mouse DNA sequence from clone RP2... 69 1e-09 AC018907_20(AC018907|pid:none) Arabidopsis thaliana chromosome I... 69 1e-09 FB819445_1(FB819445|pid:none) Sequence 38718 from Patent WO20080... 69 1e-09 AY086281_1(AY086281|pid:none) Arabidopsis thaliana clone 23348 m... 69 1e-09 AM456371_3(AM456371|pid:none) Vitis vinifera contig VV78X247372.... 69 1e-09 S56670(S56670;S56669)GTP-binding regulatory protein alpha chain ... 69 1e-09 AK009388_1(AK009388|pid:none) Mus musculus adult male tongue cDN... 69 1e-09 AK147393_1(AK147393|pid:none) Mus musculus cDNA, RIKEN full-leng... 68 2e-09 (Q9DC51) RecName: Full=Guanine nucleotide-binding protein G(k) s... 68 2e-09 (P08753) RecName: Full=Guanine nucleotide-binding protein G(k) s... 68 2e-09 AY534108_1(AY534108|pid:none) Strongylocentrotus purpuratus guan... 68 2e-09 (P34042) RecName: Full=Guanine nucleotide-binding protein alpha-... 68 2e-09
>AY328084_1(AY328084|pid:none) Hypocrea jecorina putative serine/threonine phosphatase 2C ptc2 mRNA, complete cds. Length = 438
Score = 143 bits (360), Expect = 4e-32 Identities = 91/272 (33%), Positives = 131/272 (48%), Gaps = 19/272 (6%) Frame = +1
Query: 2020 GSKIKLESGFGSLQGRRKNMEDTHVILNNLMGAVTYNGPPKDIP-------ISYYAVYDG 2178 G +L G ++QG R +MED H NL PP D +S++ V+DG Sbjct: 17 GEDDRLIYGVSAMQGWRISMEDAHTAELNL--------PPPDNDTKTHPDRLSFFGVFDG 68
Query: 2179 HGGTETSTLLEPTVHNCLVNSQSFRDGDYEQAFRDAYAEADDIVIE----KCEKSGSTGV 2346 HGG + + +HN + +SF+ GDY Q +D + D ++ + E SG T Sbjct: 69 HGGDKVALFAGENIHNIVFKQESFKSGDYAQGLKDGFLATDRAILNDPKYEEEVSGCTAC 128
Query: 2347 SALLVGNKLYTANVGDSEIVL---ARAQPNANPKGPVTYEPVLLSYKHLASDDQEKKRVT 2517 L+ GNKLY AN GDS VL RA+P LS H + EK R+T Sbjct: 129 VTLIAGNKLYVANAGDSRSVLGIKGRAKP--------------LSNDHKPQLETEKNRIT 174
Query: 2518 DLGGMIIFNRLFGSLAVSRSFGDKEYKEG-----EKKFCVSDPYQTTTDLTARDHFFILA 2682 GG + F R+ G+LA+SR+ GD E+K+ E + + P +LT D F ++A Sbjct: 175 AAGGFVDFGRVNGNLALSRAIGDFEFKKSAELSPENQIVTAFPDVEVHELTEEDEFLVIA 234
Query: 2683 CDGLWDKVEYDEAVQFVQRNIKLGKSATEISE 2778 CDG+WD V+FV+R I + +I E Sbjct: 235 CDGIWDCQSSQAVVEFVRRGIAAKQDLDKICE 266
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 3,358,695,752 Number of extensions: 64185390 Number of successful extensions: 175139 Number of sequences better than 10.0: 1283 Number of HSP's gapped: 172606 Number of HSP's successfully gapped: 1463 Length of query: 978 Length of database: 1,051,180,864 Length adjustment: 139 Effective length of query: 839 Effective length of database: 601,299,163 Effective search space: 504489997757 Effective search space used: 504489997757 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
1 |
VH (FL, L) |
0 |
VF (FL, S) |
0 |
AH (FL, L) |
1 |
AF (FL, S) |
2 |
SL (DIR, L) |
1 |
SS (DIR, S) |
0 |
SH (FL, L) |
2 |
SF (FL, S) |
1 |
CH (FL, L) |
4 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
1 |
FC-IC (SUB) |
0 |