NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U15693-1
Contig ID Contig-U15693-1
Contig update 2004. 6.11
Contig sequence 
>Contig-U15693-1 (Contig-U15693-1Q) /CSM_Contig/Contig-U15693-1Q.Seq.d
AATTTATTTATTTATTTTTTTTTTTAAATATAGATATTTTGGAAGGAGAG
AGAAAATATAAAAGAAGAAAAAAAATGGATGTTAATCAAATTAGAAAAAC
TTTTATCGATTTTTTTAGAGAGAAATGTGAACATACATTTGTTCCATCAT
CAGCAGTAATTCCACATGATGATCCAACTTTATTATTTGCAAATGCAGGT
ATGAATCAATTTAAACCAATCTTTTTAGGACAAGTTAATCCAAAATCAGA
ACAAGCAAAATTGAAGAGAGCAGTCAATAGTCAAAAATGTATTCGTGCAG
GTGGTAAACATAATGATTTGGATGATGTAGGTAAGGATACTTATCATCAC
ACCTTCTTTGAGATGTTGGGTAATTGGTCATTTGGCAATTACTTTAAGAA
GGAGGCAATCACTTGGGCATGGGAATTATTGACAGAGGTATACAAATTAG
ATAAAGAACGTTTATATGTCACTTACTTTAGAGGTGACCCAGAGAAAGGA
TTGGAAGCAGATCTCGAAGCAAAGAACCTTTGGTTGCAATATTTACCAGA
GGAACGTGTGCTCCCATTCGGTATGAAAGAGAACTTTTGGGAGATGGGTG
ACCAAGGTCCATGTGGTCCATGTTCAGAGATCCACTATGACAAAGTGGAA
GGTCGTGATGGTGCCTCCTTTGTCAATGCTGATGACCCAACTTTGATTGA
AATTTGGAATTTGGTTTTCATTCAATATAATCGTGAGGCTGATAAATCCT
TACGTCCATTACCACAAAAACACGTCGACACTGGTATGGGTCTCGAACGT
TTAACTTCAATCATTCAAAAAGTACCAACCAATTATGATACCGATGTTTT
TATGCCAATCTTTGCCGCCATTCAAGAGGTAACTGGTTATCCAGAACCAT
ACGGTGGAAAAGTCGGTGCTGAAGATACACAACAAGTTGATATGGCCTAT
CGTGTCATTGCCGATCACATTCGTACACTCACATTCTCAATTGCTGATGG
TGCCGCCCCATCCGTCGATGGTAGAGGTCAAGTCCTCCGTAGAATCCTTC
GTCGTGCCGTCCGTTATGGTAAACAAAAATTAAATGCACCAGCTGGTTTC
TTCTCTAAATTGGTTGATGTTG----------TCCAGAATGGGCAAACTA
TTCCATCGAATTTTGTGGTGGTACACATTTGTCAAACACTAAACAAGCTG
AACTCTTCACCATTACCTCTGAAGAAACTTTGGGTGCTGGTGTACGTCGT
ATCGTCGCTGTCACTGGTTCTGAAGCTGCCTCTGCTATAGAACTCAATAA
AGAATTGGAAGTCAGATTCAATAATGCCCTCAAATTATCAGGTTCAGAAC
TTGCCAAGGAAATCGTTTCCTTATTAGATCTTCTCAAGGTTGTCACCATT
TCAGCAAGTGTTCGTATGAATTTGGTTGAAACTTTGAAGGAAGTTCAAGC
ACTCCAAAGAAAACAAGTCAAAGAACAAGAAACCATCTTGGCTCAACAAG
CTCAAACCTATTTAGAGAAAACCTCTGAAGAATTGGCTAAATCTCAACCA
AAGGTTTTCGTAGATTTAGTAAACTTCAATTCAAATACTCCTTTAATCAC
TGAAACCATTAAAAAAATTCAAACTAAATCACCAATGACTGCAATCATGT
TAATTAGTCCAGATGAAGAAAAAGGTAAAGTTACTTGCATTGGTATCGTT
CCAAAAGATTCTGAAATCTCAAAAACTTTAACTGCAAATGCTTGGGTTGT
AAAGGTTACCGAAGTTTTAGGTGGTAAAGGTGGTGGTAAAGTTGATGTTG
CTCAAGGTGTTGGTTCTAAATTAGATAAAATCGATGAAGCTATTCTCGTT
TCAAGAGAATTTGCAAATGCAAACTGATTCAAATTATCTTTATAAAAATA
AAATAAAATAAAAAAAATAATAAAAAAAAAAATTAAAAAATAAATAAATT
GTATTGTATTGTATTGTA
Gap gap included
Contig length 1958
Chromosome number (1..6, M) 3
Chromosome length 6358359
Start point 913152
End point 911195
Strand (PLUS/MINUS) MINUS
Number of clones 30
Number of EST 49
Link to clone list U15693
List of clone(s) 

est1=CHQ884F,1,485
est2=SHG234F,1,452
est3=VHK630F,1,452
est4=SHF226F,6,483
est5=SHA383F,10,451
est6=SHK406F,10,597
est7=AHI582F,26,616
est8=AHD666F,30,627
est9=SHK820F,30,661
est10=VHI681F,30,621
est11=AHC193F,32,592
est12=SHA174F,36,617
est13=FC-BC01F,41,602
est14=AHA407F,57,643
est15=CHP812F,66,484
est16=VHD392F,75,622
est17=SHA215F,129,484
est18=VHN750F,129,357
est19=VHN773F,129,484
est20=VHI815F,527,1122
est21=AHN845Z,1123,1876
est22=VHK630Z,1143,1908
est23=VHI681Z,1155,1889
est24=VHD392Z,1156,1876
est25=SHG234Z,1159,1891
est26=SHA215Z,1160,1849
est27=SHA383Z,1160,1889
est28=AHC193Z,1198,1875
est29=SHE769Z,1208,1879
est30=AHB873Z,1209,1876
est31=SHL816Z,1209,1909
est32=AHI582Z,1215,1906
est33=FC-BL18Z,1224,1932
est34=SHF226Z,1261,1918
est35=AHD666Z,1275,1922
est36=CHQ884Z,1276,1928
est37=SHK820Z,1276,1923
est38=VHI815Z,1276,1922
est39=AHA407Z,1277,1930
est40=SHH247Z,1285,1876
est41=AHH503Z,1286,1958
est42=SHK406Z,1286,1935
est43=VHN773Z,1297,1905
est44=VHN750Z,1311,1874
est45=AHP594Z,1372,1908
est46=FC-BC01Z,1401,1916
est47=VHH893Z,1500,1875
est48=CHP812Z,1541,1775
est49=SHA395Z,1624,1860
Translated Amino Acid sequence 
FIYLFFFLNIDILEGERKYKRRKKMDVNQIRKTFIDFFREKCEHTFVPSSAVIPHDDPTL
LFANAGMNQFKPIFLGQVNPKSEQAKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFE
MLGNWSFGNYFKKEAITWAWELLTEVYKLDKERLYVTYFRGDPEKGLEADLEAKNLWLQY
LPEERVLPFGMKENFWEMGDQGPCGPCSEIHYDKVEGRDGASFVNADDPTLIEIWNLVFI
QYNREADKSLRPLPQKHVDTGMGLERLTSIIQKVPTNYDTDVFMPIFAAIQEVTGYPEPY
GGKVGAEDTQQVDMAYRVIADHIRTLTFSIADGAAPSVDGRGQVLRRILRRAVRYGKQKL
NAPAGFFSKLVDV---

---PEWANYSIEFCGGTHLSNTKQAELFTITSEETLGAGVRRIVAVTGSEAASAIELNKE
LEVRFNNALKLSGSELAKEIVSLLDLLKVVTISASVRMNLVETLKEVQALQRKQVKEQET
ILAQQAQTYLEKTSEELAKSQPKVFVDLVNFNSNTPLITETIKKIQTKSPMTAIMLISPD
EEKGKVTCIGIVPKDSEISKTLTANAWVVKVTEVLGGKGGGKVDVAQGVGSKLDKIDEAI
LVSREFANAN*fklsl*k*nkikkiikkkikk*incivlyc
Translated Amino Acid sequence (All Frames) 
Frame A:
nlfiyfff*i*ifwkerenikeekkwmliklekllsiflernvnihlfhhqq*fhmmiql
yylqmqv*inlnqsf*dkliqnqnkqn*reqsivknvfvqvvnimiwmm*vriliitpsl
rcwvighlaitlrrrqslghgny*qrytn*iknvymsltlevtqrkdwkqiskqrtfgcn
iyqrnvcshsv*krtfgrwvtkvhvvhvqrstmtkwkvvmvpplsmlmtql*lkfgiwfs
fniivrlinpyvhyhkntstlvwvsnv*lqsfkkyqpimipmflcqslppfkr*lviqnh
tveksvlkihnkliwpivslpitfvhshsqllmvpphpsmvevkssvesfvvpsvmvnkn
*mhqlvsslnwlml---

---srmgklfhrilwwytfvkh*ts*tlhhyl*rnfgcwctsyrrchwf*sclcyrtq*r
igsqiq*cpqiirfrtcqgnrflirssqgchhfskcsyefg*nfegssstpkktsqrtrn
hlgstssnlfrenl*rig*istkgfrrfsklqfkysfnh*nh*knsn*itndcnhvn*sr
*rkr*sylhwyrskrf*nlknfnckclgckgyrsfrw*rww*s*ccsrcwf*ir*nr*sy
srfkrickckliqiifikik*nkknnkkkn*kinklycivl

Frame B:
iylfifffkyryfgrreki*kkkkngc*sn*knfyrff*rem*tyicsiissnst**snf
iickcryesi*tnlfrts*skirtskieessq*skmyscrw*t**fg*cr*gylsshll*
dvg*lviwqll*eggnhlgmgiidrgiqir*rtfichll*r*prerigsrsrskeplvai
ftrgtcapiryerellgdg*prsmwsmfrdpl*qsgrs*wcllcqc**pnfd*nlefgfh
si*s*g**iltsittktrrhwygsrtfnfnhskstnql*yrcfyanlcrhsrgnwlsrti
rwksrc*rytts*yglschcrshsythilnc*wcrpirrw*rsspp*npsscrplw*tki
kctswfll*ig*c---

---PEWANYSIEFCGGTHLSNTKQAELFTITSEETLGAGVRRIVAVTGSEAASAIELNKE
LEVRFNNALKLSGSELAKEIVSLLDLLKVVTISASVRMNLVETLKEVQALQRKQVKEQET
ILAQQAQTYLEKTSEELAKSQPKVFVDLVNFNSNTPLITETIKKIQTKSPMTAIMLISPD
EEKGKVTCIGIVPKDSEISKTLTANAWVVKVTEVLGGKGGGKVDVAQGVGSKLDKIDEAI
LVSREFANAN*fklsl*k*nkikkiikkkikk*incivlyc

Frame C:
FIYLFFFLNIDILEGERKYKRRKKMDVNQIRKTFIDFFREKCEHTFVPSSAVIPHDDPTL
LFANAGMNQFKPIFLGQVNPKSEQAKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFE
MLGNWSFGNYFKKEAITWAWELLTEVYKLDKERLYVTYFRGDPEKGLEADLEAKNLWLQY
LPEERVLPFGMKENFWEMGDQGPCGPCSEIHYDKVEGRDGASFVNADDPTLIEIWNLVFI
QYNREADKSLRPLPQKHVDTGMGLERLTSIIQKVPTNYDTDVFMPIFAAIQEVTGYPEPY
GGKVGAEDTQQVDMAYRVIADHIRTLTFSIADGAAPSVDGRGQVLRRILRRAVRYGKQKL
NAPAGFFSKLVDV---

---qngqtipsnfvvvhicqtlnklnssplplkklwvlvyvvsslslvlklpll*nsikn
wksdsimpsnyqvqnlprksfpy*ifsrlspfqqvfv*iwlkl*rkfkhskenksknkkp
swlnklkpi*rkplknwlnlnqrfs*i**tsiqill*slkplkkfklnhq*lqsc*lvqm
kkkvkllalvsfqkilksqkl*lqmlgl*rlpkf*vvkvvvklmllkvlvln*iksmklf
sfqenlqmqtdsnylyknkik*kk**kkklknk*ivlyciv
own update 2004. 6.23
Homology vs CSM-cDNA 
Query= Contig-U15693-1 (Contig-U15693-1Q)
/CSM_Contig/Contig-U15693-1Q.Seq.d
         (1968 letters)

Database: CSM
           8402 sequences; 8,075,542 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U15693-1 (Contig-U15693-1Q) /CSM_Contig/Conti...  3513  0.0
Contig-U12400-1 (Contig-U12400-1Q) /CSM_Contig/Conti...    54  8e-07
Contig-U11759-1 (Contig-U11759-1Q) /CSM_Contig/Conti...    44  8e-04
Contig-U09430-1 (Contig-U09430-1Q) /CSM_Contig/Conti...    44  8e-04
Contig-U13511-1 (Contig-U13511-1Q) /CSM_Contig/Conti...    40  0.013
Contig-U11535-1 (Contig-U11535-1Q) /CSM_Contig/Conti...    38  0.050
Contig-U16217-1 (Contig-U16217-1Q) /CSM_Contig/Conti...    36  0.20
Contig-U15724-1 (Contig-U15724-1Q) /CSM_Contig/Conti...    36  0.20
Contig-U15015-1 (Contig-U15015-1Q) /CSM_Contig/Conti...    36  0.20
Contig-U14996-1 (Contig-U14996-1Q) /CSM_Contig/Conti...    36  0.20

>Contig-U15693-1 (Contig-U15693-1Q) /CSM_Contig/Contig-U15693-1Q.Seq.d
          Length = 1968

 Score = 3513 bits (1772), Expect = 0.0
 Identities = 1846/1868 (98%)
 Strand = Plus / Plus

                                                                        
Query: 26   aaatatagatattttggaaggagagagaaaatataaaagaagnnnnnnnntggatgttaa 85
            ||||||||||||||||||||||||||||||||||||||||||        ||||||||||
Sbjct: 26   aaatatagatattttggaaggagagagaaaatataaaagaagaaaaaaaatggatgttaa 85

                                                                        
Query: 86   tcaaattagaaaaacttttatcgannnnnnnagagagaaatgtgaacatacatttgttcc 145
            ||||||||||||||||||||||||       |||||||||||||||||||||||||||||
Sbjct: 86   tcaaattagaaaaacttttatcgatttttttagagagaaatgtgaacatacatttgttcc 145

                                                                        
Query: 146  atcatcagcagtaattccacatgatgatccaactttattatttgcaaatgcaggtatgaa 205
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 146  atcatcagcagtaattccacatgatgatccaactttattatttgcaaatgcaggtatgaa 205

                                                                        
Query: 206  tcaatttaaaccaatctttttaggacaagttaatccaaaatcagaacaagcaaaattgaa 265
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 206  tcaatttaaaccaatctttttaggacaagttaatccaaaatcagaacaagcaaaattgaa 265

                                                                        
Query: 266  gagagcagtcaatagtcaaaaatgtattcgtgcaggtggtaaacataatgatttggatga 325
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 266  gagagcagtcaatagtcaaaaatgtattcgtgcaggtggtaaacataatgatttggatga 325

                                                                        
Query: 326  tgtaggtaaggatacttatcatcacaccttctttgagatgttgggtaattggtcatttgg 385
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 326  tgtaggtaaggatacttatcatcacaccttctttgagatgttgggtaattggtcatttgg 385

                                                                        
Query: 386  caattactttaagaaggaggcaatcacttgggcatgggaattattgacagaggtatacaa 445
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 386  caattactttaagaaggaggcaatcacttgggcatgggaattattgacagaggtatacaa 445

                                                                        
Query: 446  attagataaagaacgtttatatgtcacttactttagaggtgacccagagaaaggattgga 505
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 446  attagataaagaacgtttatatgtcacttactttagaggtgacccagagaaaggattgga 505

                                                                        
Query: 506  agcagatctcgaagcaaagaacctttggttgcaatatttaccagaggaacgtgtgctccc 565
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 506  agcagatctcgaagcaaagaacctttggttgcaatatttaccagaggaacgtgtgctccc 565

                                                                        
Query: 566  attcggtatgaaagagaacttttgggagatgggtgaccaaggtccatgtggtccatgttc 625
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 566  attcggtatgaaagagaacttttgggagatgggtgaccaaggtccatgtggtccatgttc 625

                                                                        
Query: 626  agagatccactatgacaaagtggaaggtcgtgatggtgcctcctttgtcaatgctgatga 685
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 626  agagatccactatgacaaagtggaaggtcgtgatggtgcctcctttgtcaatgctgatga 685

                                                                        
Query: 686  cccaactttgattgaaatttggaatttggttttcattcaatataatcgtgaggctgataa 745
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 686  cccaactttgattgaaatttggaatttggttttcattcaatataatcgtgaggctgataa 745

                                                                        
Query: 746  atccttacgtccattaccacaaaaacacgtcgacactggtatgggtctcgaacgtttaac 805
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 746  atccttacgtccattaccacaaaaacacgtcgacactggtatgggtctcgaacgtttaac 805

                                                                        
Query: 806  ttcaatcattcaaaaagtaccaaccaattatgataccgatgtttttatgccaatctttgc 865
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 806  ttcaatcattcaaaaagtaccaaccaattatgataccgatgtttttatgccaatctttgc 865

                                                                        
Query: 866  cgccattcaagaggtaactggttatccagaaccatacggtggaaaagtcggtgctgaaga 925
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 866  cgccattcaagaggtaactggttatccagaaccatacggtggaaaagtcggtgctgaaga 925

                                                                        
Query: 926  tacacaacaagttgatatggcctatcgtgtcattgccgatcacattcgtacactcacatt 985
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 926  tacacaacaagttgatatggcctatcgtgtcattgccgatcacattcgtacactcacatt 985

                                                                        
Query: 986  ctcaattgctgatggtgccgccccatccgtcgatggtagaggtcaagtcctccgtagaat 1045
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 986  ctcaattgctgatggtgccgccccatccgtcgatggtagaggtcaagtcctccgtagaat 1045

                                                                        
Query: 1046 ccttcgtcgtgccgtccgttatggtaaacaaaaattaaatgcaccagctggtttcttctc 1105
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1046 ccttcgtcgtgccgtccgttatggtaaacaaaaattaaatgcaccagctggtttcttctc 1105

                                                                        
Query: 1106 taaattggttgatgttgnnnnnnnnnntccagaatgggcaaactattccatcgaattttg 1165
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1106 taaattggttgatgttgnnnnnnnnnntccagaatgggcaaactattccatcgaattttg 1165

                                                                        
Query: 1166 tggtggtacacatttgtcaaacactaaacaagctgaactcttcaccattacctctgaaga 1225
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1166 tggtggtacacatttgtcaaacactaaacaagctgaactcttcaccattacctctgaaga 1225

                                                                        
Query: 1226 aactttgggtgctggtgtacgtcgtatcgtcgctgtcactggttctgaagctgcctctgc 1285
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1226 aactttgggtgctggtgtacgtcgtatcgtcgctgtcactggttctgaagctgcctctgc 1285

                                                                        
Query: 1286 tatagaactcaataaagaattggaagtcagattcaataatgccctcaaattatcaggttc 1345
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1286 tatagaactcaataaagaattggaagtcagattcaataatgccctcaaattatcaggttc 1345

                                                                        
Query: 1346 agaacttgccaaggaaatcgtttccttattagatcttctcaaggttgtcaccatttcagc 1405
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1346 agaacttgccaaggaaatcgtttccttattagatcttctcaaggttgtcaccatttcagc 1405

                                                                        
Query: 1406 aagtgttcgtatgaatttggttgaaactttgaaggaagttcaagcactccaaagaaaaca 1465
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1406 aagtgttcgtatgaatttggttgaaactttgaaggaagttcaagcactccaaagaaaaca 1465

                                                                        
Query: 1466 agtcaaagaacaagaaaccatcttggctcaacaagctcaaacctatttagagaaaacctc 1525
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1466 agtcaaagaacaagaaaccatcttggctcaacaagctcaaacctatttagagaaaacctc 1525

                                                                        
Query: 1526 tgaagaattggctaaatctcaaccaaaggttttcgtagatttagtaaacttcaattcaaa 1585
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1526 tgaagaattggctaaatctcaaccaaaggttttcgtagatttagtaaacttcaattcaaa 1585

                                                                        
Query: 1586 tactcctttaatcactgaaaccattnnnnnnnttcaaactaaatcaccaatgactgcaat 1645
            |||||||||||||||||||||||||       ||||||||||||||||||||||||||||
Sbjct: 1586 tactcctttaatcactgaaaccattaaaaaaattcaaactaaatcaccaatgactgcaat 1645

                                                                        
Query: 1646 catgttaattagtccagatgaagaaaaaggtaaagttacttgcattggtatcgttccaaa 1705
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1646 catgttaattagtccagatgaagaaaaaggtaaagttacttgcattggtatcgttccaaa 1705

                                                                        
Query: 1706 agattctgaaatctcaaaaactttaactgcaaatgcttgggttgtaaaggttaccgaagt 1765
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1706 agattctgaaatctcaaaaactttaactgcaaatgcttgggttgtaaaggttaccgaagt 1765

                                                                        
Query: 1766 tttaggtggtaaaggtggtggtaaagttgatgttgctcaaggtgttggttctaaattaga 1825
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1766 tttaggtggtaaaggtggtggtaaagttgatgttgctcaaggtgttggttctaaattaga 1825

                                                                        
Query: 1826 taaaatcgatgaagctattctcgtttcaagagaatttgcaaatgcaaactgattcaaatt 1885
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1826 taaaatcgatgaagctattctcgtttcaagagaatttgcaaatgcaaactgattcaaatt 1885

                    
Query: 1886 atctttat 1893
            ||||||||
Sbjct: 1886 atctttat 1893


 Score = 40.1 bits (20), Expect = 0.013
 Identities = 20/20 (100%)
 Strand = Plus / Plus

                                
Query: 1949 ttgtattgtattgtattgta 1968
            ||||||||||||||||||||
Sbjct: 1949 ttgtattgtattgtattgta 1968


 Score = 32.2 bits (16), Expect = 3.1
 Identities = 16/16 (100%)
 Strand = Plus / Plus

                            
Query: 1953 attgtattgtattgta 1968
            ||||||||||||||||
Sbjct: 1948 attgtattgtattgta 1963


>Contig-U12400-1 (Contig-U12400-1Q) /CSM_Contig/Contig-U12400-1Q.Seq.d
          Length = 1702

 Score = 54.0 bits (27), Expect = 8e-07
 Identities = 42/47 (89%)
 Strand = Plus / Plus

                                                          
Query: 282 caaaaatgtattcgtgcaggtggtaaacataatgatttggatgatgt 328
           ||||||||| || | ||||||||||||||||||||||| ||| ||||
Sbjct: 286 caaaaatgtgttagagcaggtggtaaacataatgatttagataatgt 332


 Score = 40.1 bits (20), Expect = 0.013
 Identities = 23/24 (95%)
 Strand = Plus / Plus

                                   
Query: 180 ttattatttgcaaatgcaggtatg 203
           ||||||||| ||||||||||||||
Sbjct: 199 ttattatttacaaatgcaggtatg 222


 Score = 34.2 bits (17), Expect = 0.79
 Identities = 26/29 (89%)
 Strand = Plus / Plus

                                        
Query: 357 tttgagatgttgggtaattggtcatttgg 385
           ||||| |||||||||||||  ||||||||
Sbjct: 361 tttgaaatgttgggtaatttttcatttgg 389


 Score = 32.2 bits (16), Expect = 3.1
 Identities = 19/20 (95%)
 Strand = Plus / Plus

                               
Query: 609 ccatgtggtccatgttcaga 628
           |||||||| |||||||||||
Sbjct: 604 ccatgtggaccatgttcaga 623


>Contig-U11759-1 (Contig-U11759-1Q) /CSM_Contig/Contig-U11759-1Q.Seq.d
          Length = 2181

 Score = 44.1 bits (22), Expect = 8e-04
 Identities = 22/22 (100%)
 Strand = Plus / Plus

                                  
Query: 1075 aaaaattaaatgcaccagctgg 1096
            ||||||||||||||||||||||
Sbjct: 609  aaaaattaaatgcaccagctgg 630


  Database: CSM
    Posted date:  Jun 21, 2004  1:35 PM
  Number of letters in database: 8,075,542
  Number of sequences in database:  8402
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 28,317
Number of Sequences: 8402
Number of extensions: 28317
Number of successful extensions: 4265
Number of sequences better than 10.0: 78
length of query: 1968
length of database: 8,075,542
effective HSP length: 17
effective length of query: 1951
effective length of database: 7,932,708
effective search space: 15476713308
effective search space used: 15476713308
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 16 (32.2 bits)
dna update 2009. 2.10
Homology vs DNA 
Query= Contig-U15693-1 (Contig-U15693-1Q) /CSM_Contig/Contig-U15693-1Q.Seq.d
         (1968 letters)

Database: ddbj_B
           98,226,423 sequences; 98,766,808,389 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AF188717) Dictyostelium discoideum alanyl-tRNA synthetase (...  1976   0.0    3
(BJ423140) Dictyostelium discoideum cDNA clone:ddv48n04, 5' ...  1179   0.0    1
(BJ397108) Dictyostelium discoideum cDNA clone:dds45h06, 5' ...  1080   0.0    3
(BJ332266) Dictyostelium discoideum cDNA clone:dda38c18, 5' ...  1013   0.0    3
(BJ423300) Dictyostelium discoideum cDNA clone:ddv48a22, 5' ...  1001   0.0    3
(BJ335055) Dictyostelium discoideum cDNA clone:dda48c21, 5' ...   991   0.0    3
(BJ355836) Dictyostelium discoideum cDNA clone:dda58j12, 3' ...   942   0.0    2
(BJ442064) Dictyostelium discoideum cDNA clone:ddv48a22, 3' ...   884   0.0    3
(BJ406731) Dictyostelium discoideum cDNA clone:dds36c10, 3' ...   876   0.0    3
(BJ438412) Dictyostelium discoideum cDNA clone:ddv37h23, 3' ...   874   0.0    2
(BJ403335) Dictyostelium discoideum cDNA clone:dds24f21, 3' ...   866   0.0    3
(BJ403135) Dictyostelium discoideum cDNA clone:dds24m04, 3' ...   842   0.0    2
(BJ443258) Dictyostelium discoideum cDNA clone:ddv52k08, 3' ...   799   0.0    4
(BJ349244) Dictyostelium discoideum cDNA clone:dda35i23, 3' ...   791   0.0    3
(BJ405958) Dictyostelium discoideum cDNA clone:dds33j17, 3' ...   779   0.0    2
(BJ408864) Dictyostelium discoideum cDNA clone:dds47p04, 3' ...   777   0.0    3
(BJ348906) Dictyostelium discoideum cDNA clone:dda34b20, 3' ...   777   0.0    2
(BJ353037) Dictyostelium discoideum cDNA clone:dda48c21, 3' ...   757   0.0    3
(AU284810) Dictyostelium discoideum gamete cDNA clone:FC-BL1...   747   0.0    2
(BJ407396) Dictyostelium discoideum cDNA clone:dds38m12, 3' ...   626   0.0    2
(BJ347787) Dictyostelium discoideum cDNA clone:dda31n02, 3' ...   618   0.0    3
(BJ330331) Dictyostelium discoideum cDNA clone:dda31n02, 5' ...  1045   0.0    2
(BJ391666) Dictyostelium discoideum cDNA clone:dds24c19, 5' ...   993   0.0    3
(BJ352216) Dictyostelium discoideum cDNA clone:dda46e01, 3' ...   571   0.0    3
(BJ406132) Dictyostelium discoideum cDNA clone:dds34c08, 3' ...   581   0.0    2
(BJ385697) Dictyostelium discoideum cDNA clone:ddc55h22, 3' ...   565   0.0    2
(BJ407940) Dictyostelium discoideum cDNA clone:dds44l02, 3' ...   563   0.0    2
(BJ419982) Dictyostelium discoideum cDNA clone:ddv37h23, 5' ...  1003   0.0    2
(BJ441893) Dictyostelium discoideum cDNA clone:ddv48n04, 3' ...   569   0.0    3
(BJ408217) Dictyostelium discoideum cDNA clone:dds45h06, 3' ...   567   0.0    3
(BJ331551) Dictyostelium discoideum cDNA clone:dda35i23, 5' ...   944   0.0    3
(BJ350047) Dictyostelium discoideum cDNA clone:dda38c18, 3' ...   569   0.0    3
(C25775) Dictyostelium discoideum gamete cDNA, clone FC-BC01.     955   0.0    3
(BJ396840) Dictyostelium discoideum cDNA clone:dds44l02, 5' ...   954   0.0    3
(BJ445194) Dictyostelium discoideum cDNA clone:ddv58b19, 3' ...   529   0.0    2
(BJ445128) Dictyostelium discoideum cDNA clone:ddv58d13, 3' ...   504   0.0    2
(BJ357242) Dictyostelium discoideum cDNA clone:dda62k23, 3' ...   543   0.0    2
(C25776) Dictyostelium discoideum gamete cDNA, clone FC-BC01.     543   0.0    2
(BJ394213) Dictyostelium discoideum cDNA clone:dds34c08, 5' ...   650   0.0    3
(BJ370892) Dictyostelium discoideum cDNA clone:ddc55h22, 5' ...   638   0.0    4
(BJ394727) Dictyostelium discoideum cDNA clone:dds36c10, 5' ...   591   0.0    4
(BJ391681) Dictyostelium discoideum cDNA clone:dds24f21, 5' ...   589   0.0    3
(BJ424420) Dictyostelium discoideum cDNA clone:ddv52k08, 5' ...   577   0.0    4
(BJ370154) Dictyostelium discoideum cDNA clone:ddc53h04, 5' ...   601   e-178  2
(BJ426368) Dictyostelium discoideum cDNA clone:ddv58b19, 5' ...   636   e-178  1
(BJ391505) Dictyostelium discoideum cDNA clone:dds24m04, 5' ...   561   e-155  1
(BJ441492) Dictyostelium discoideum cDNA clone:ddv46j24, 3' ...   383   e-151  2
(BJ403376) Dictyostelium discoideum cDNA clone:dds24n23, 3' ...   406   e-108  1
(BJ426300) Dictyostelium discoideum cDNA clone:ddv58d13, 5' ...   402   e-107  1
(DL173609) Methods for Identifying the Target of a Compound ...    74   5e-51  8
(AX489169) Sequence 6469 from Patent WO02053728.                   74   5e-51  8
(AR548989) Sequence 4120 from patent US 6747137.                   74   4e-46  6
(DJ131881) Method for identification of useful proteins deri...    80   2e-38  6
(AX831298) Sequence 2018 from Patent WO03072602.                   80   5e-38  5
(AX820268) Sequence 2018 from Patent EP1338608.                    80   5e-38  5
(DJ210764) Method for identification of useful proteins deri...    80   7e-38  5
(EF650269) Mydas clavatus alanyl-tRNA synthetase (AATS) gene...   129   1e-37  3
(DQ332533) Synthetic construct Saccharomyces cerevisiae clon...    80   2e-37  5
(U18672) Saccharomyces cerevisiae cytoplasmic alanyl-tRNA sy...    80   2e-37  5
(I42578) Sequence 3 from patent US 5629188.                        80   2e-37  5
(Z75243) S.cerevisiae chromosome XV reading frame ORF YOR335c.     80   5e-37  5
(BJ383459) Dictyostelium discoideum cDNA clone:ddc53h04, 3' ...   143   1e-36  2
(AM758901) Clytia hemisphaerica EST, 5' end sequence, clone ...   129   5e-35  5
(BM952188) rc56d10.y1 Meloidogyne hapla egg pAMP1 v1 Meloido...   109   8e-35  3
(Z49821) S.cerevisiae PDR10, MYO2, PDR10, SCD5, MIP1, ALA1, ...    80   1e-33  5
(DB741542) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB730908) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB754014) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB737382) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB750171) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB754654) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB735185) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB745180) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(DB732732) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-33  2
(EE003797) ROE00012109 Rhizopus oryzae Company Rhizopus oryz...   137   2e-32  3
(EE004920) ROE00005214 Rhizopus oryzae Company Rhizopus oryz...   137   3e-32  3
(EJ536019) 1092955259340 Global-Ocean-Sampling_GS-29-01-01-1...   117   4e-32  2
(DB751745) Apis mellifera head cDNA, RIKEN full-length enric...   105   3e-31  2
(BI926102) EST545991 tomato flower, buds 0-3 mm Solanum lyco...   131   7e-31  2
(CK248639) EST732276 potato callus cDNA library, normalized ...   131   8e-31  2
(CK243374) EST727011 potato callus cDNA library, normalized ...   131   9e-31  2
(CK249522) EST733159 potato callus cDNA library, normalized ...   131   9e-31  2
(CZ285790) cp43c11.f Candida parapsilosis Random Genomic Lib...    70   9e-31  4
(CK243373) EST727010 potato callus cDNA library, normalized ...   131   1e-30  2
(CK247842) EST731479 potato callus cDNA library, normalized ...   131   1e-30  2
(DB730693) Apis mellifera head cDNA, RIKEN full-length enric...   105   1e-30  3
(DB743924) Apis mellifera head cDNA, RIKEN full-length enric...    98   1e-30  3
(EJ550067) 1092959435222 Global-Ocean-Sampling_GS-29-01-01-1...   117   4e-30  2
(EF650292) Laxenecera albicincta alanyl-tRNA synthetase (AAT...   123   2e-29  3
(EU436059) Saltella sphondylii voucher su41 alanyl-tRNA synt...    62   2e-29  5
(DB710460) Solanum lycopersicum cDNA, clone: LEFL2005G03, 5'...   131   5e-29  2
(CT856288) Oryza sativa Indica Group EST sequence:OSIGCRA218...    88   6e-29  4
(CX700207) 87044.1 Stolon Solanum tuberosum cDNA clone 87044...   131   2e-28  2
(EU436058) Saltella nigripes voucher su40 alanyl-tRNA synthe...    96   3e-28  3
(EF650306) Lycostommyia albifacies alanyl-tRNA synthetase (A...   100   3e-28  3
(EU436027) Icaridion debile voucher su2 alanyl-tRNA syntheta...   109   5e-28  2
(FF770641) XABT73054.fwd Gateway compatible cien cDNA librar...   100   1e-27  3
(FF763874) XABT68670.fwd Gateway compatible cien cDNA librar...   100   2e-27  3
(FK064919) XABT126844.b1 Gateway compatible cien cDNA librar...   100   2e-27  3
(FF747919) XABT57365.fwd Gateway compatible cien cDNA librar...   103   2e-27  3
(DY893572) CeleSEQ12947 Cunninghamella elegans pBluescript (...    82   2e-27  3
(DB718907) Solanum lycopersicum cDNA, clone: LEFL2030F17, 5'...   131   3e-27  2
(EF650291) Lamyra gulo alanyl-tRNA synthetase (AATS) gene, p...   119   4e-27  3
(EF650293) Nusa infumata alanyl-tRNA synthetase (AATS) gene,...   115   8e-27  2
(DB726216) Solanum lycopersicum cDNA, clone: LEFL2051L09, 5'...   131   1e-25  1
(BE434392) EST405470 tomato breaker fruit, TIGR Solanum lyco...   131   1e-25  1
(EF650289) Cerotainia albipilosa alanyl-tRNA synthetase (AAT...   117   1e-25  2
(EU436057) Saltella bezzii voucher su39 alanyl-tRNA syntheta...    72   2e-25  3
(AL431245) T7 end of clone BB0AA002G10 of library BB0AA from...    66   2e-25  3
(EF650267) Mitrodetus dentitarsis alanyl-tRNA synthetase (AA...   105   2e-25  3
(FE414084) CBTU4347.fwd CBTU_Daphnia_pulex_Chosen_One_Librar...    80   3e-25  3
(FK108934) XABT154938.b1 Gateway compatible cien cDNA librar...    96   6e-25  2
(FF754328) XABT61824.fwd Gateway compatible cien cDNA librar...    96   6e-25  2
(EF650270) Afroleptomydas sp. 'Clanwilliam' alanyl-tRNA synt...    92   6e-25  4
(EF650268) Opomydas townsendi alanyl-tRNA synthetase (AATS) ...    92   6e-25  4
(EF650294) Pilica formidolosa alanyl-tRNA synthetase (AATS) ...   115   2e-24  2
(FF785176) XABT82941.fwd Gateway compatible cien cDNA librar...    88   4e-24  3
(FF764853) XABT69304.fwd Gateway compatible cien cDNA librar...    88   4e-24  3
(FK096265) XABT146131.b1 Gateway compatible cien cDNA librar...    88   5e-24  3
(FF880130) CBWU20425.b1 Yutaka Satou unpublished cDNA librar...    88   5e-24  3
(FK108377) XABT154603.b1 Gateway compatible cien cDNA librar...    88   5e-24  3
(FF753544) XABT61304.fwd Gateway compatible cien cDNA librar...    88   5e-24  3
(FK066065) XABT127510.b1 Gateway compatible cien cDNA librar...    88   5e-24  3
(FF808848) XABT98988.fwd Gateway compatible cien cDNA librar...    88   5e-24  3
(FK132701) XABT169518.b1 Gateway compatible cien cDNA librar...    88   5e-24  3
(FF804542) XABT95734.fwd Gateway compatible cien cDNA librar...    88   6e-24  3
(DY885130) CeleSEQ324 Cunninghamella elegans pBluescript (Ec...    82   6e-24  3
(FF856506) CBWU5921.b1 Yutaka Satou unpublished cDNA library...    88   7e-24  3
(FF716295) XABT35011.fwd Gateway compatible cien cDNA librar...    88   7e-24  3
(DB718441) Solanum lycopersicum cDNA, clone: LEFL2028P24, 5'...   125   7e-24  1
(DB581127) Halocynthia roretzi cDNA clone:ma310e14, 5' end.       101   8e-24  2
(DJ025883) Genome-wide DNA marker of Saccharomyces cerevisiae.     80   1e-23  12
(EF650319) Holcocephala calva alanyl-tRNA synthetase (AATS) ...    92   1e-23  3
(FF629942) G825P539RF1.T0 Acorn worm normalized gastrula pEx...    94   6e-23  3
(FF477569) G613P6177RG8.T0 Acorn worm blastula/gastrula pCMV...    94   7e-23  3
(BW081340) Ciona intestinalis cDNA, clone:rcieg085a05, 3' en...    88   7e-23  2
(BW217139) Ciona intestinalis cDNA, clone:cieg085a05, 5' end...    88   8e-23  2
(FK069080) XABT129327.b1 Gateway compatible cien cDNA librar...    88   1e-22  2
(EU436028) Gluma nitida voucher su3 alanyl-tRNA synthetase (...    62   1e-22  4
(EF650290) Choerades bella alanyl-tRNA synthetase (AATS) gen...   103   2e-22  3
(M55993) B.mori alanyl-tRNA synthetase mRNA, complete cds.         68   2e-22  6
(CK446639) pncs907aA05.SP6 Aspergillus nidulans negative sub...    78   3e-22  3
(FF736228) XABT49480.fwd Gateway compatible cien cDNA librar...    88   4e-22  3
(EF650265) Phycus frommeri alanyl-tRNA synthetase (AATS) gen...    74   5e-22  4
(EU410379) Ospriocerus aeacus voucher Asil-370 alanyl-tRNA s...    70   7e-22  3
(CR382126) Kluyveromyces lactis strain NRRL Y-1140 chromosom...    78   7e-22  4
(AR319950) Sequence 2500 from patent US 6562958.                   54   1e-21  6
(DB958360) Glycine max cDNA, clone: GMFL02-09-B13, 5'end.         117   2e-21  1
(FK653723) 454GmaGlobSeed388355 Soybean Seeds Containing Glo...   117   2e-21  1
(FC674836) CAXX10263.fwd CAXX Lottia gigantea from male gona...    80   5e-21  3
(DT662487) He_wd2a1_72H06_M13R Heliconius erato wing disk 2 ...    54   2e-20  4
(AY568074) Naegleria gruberi strain NEG-M alanyl-tRNA synthe...    62   2e-20  5
(DT665565) He_wd2a1_52A01_M13R Heliconius erato wing disk 2 ...    54   2e-20  4
(CR382133) Debaryomyces hansenii strain CBS767 chromosome A ...    76   4e-20  19
(FF613444) G825P5173RE7.T0 Acorn worm normalized gastrula pE...    94   5e-20  3
(EF650288) Atomosia puella alanyl-tRNA synthetase (AATS) gen...   100   9e-20  2
(BH535766) BOGIL41TR BOGI Brassica oleracea genomic clone BO...   111   1e-19  1
(FG913287) UCRVU08_CCNS8741_b4 Cowpea IT97K-461-4 Mixed Tiss...   111   1e-19  1
(FG808493) UCRVU04_CCNI10479_b1 Cowpea 524B Mixed Tissue and...   111   1e-19  1
(AZ917266) 4911.fd64h15.x1 Saccharomyces bayanus MCYC 623-6C...   100   3e-19  2
(EF650282) Diogmites grossus alanyl-tRNA synthetase (AATS) g...    80   3e-19  2
(EF650284) Molobratia teutonus alanyl-tRNA synthetase (AATS)...    64   4e-19  4
(FC229805) CAGG2744.fwd CAGG Nematostella vectensis Nemve Ea...   109   4e-19  1
(CJ393083) Molgula tectiformis cDNA, gonad clone:mtgd008g13,...    92   7e-19  3
(FE849031) CAFO1831.fwd CAFO Pichia stipitis aerobic xylose ...    64   1e-18  4
(FE844386) CAFH387.fwd CAFH Pichia stipitis aerobic dextrose...    64   1e-18  4
(FE854364) CAFT1076.fwd CAFT Pichia stipitis oxygen limited ...    64   1e-18  4
(FE843683) CAFH1456.fwd CAFH Pichia stipitis aerobic dextros...    64   1e-18  4
(FE854431) CAFT1111.fwd CAFT Pichia stipitis oxygen limited ...    64   1e-18  4
(FC647276) CAXU8955.fwd CAXU Lottia gigantea from female gon...    88   2e-18  2
(AL408452) T3 end of clone AV0AA008F04 of library AV0AA from...    66   2e-18  3
(EF207962) Heliconius erato alanyl-tRNA synthetase-like (Aat...    54   4e-18  4
(CO087450) GR__Ea05O17.f GR__Ea Gossypium raimondii cDNA clo...    90   4e-18  3
(EF650327) Neoitamus cyanurus alanyl-tRNA synthetase (AATS) ...    86   5e-18  2
(FF429787) G142P60110RG4.T0 Acorn worm juvenile pCMVSport6 l...    94   6e-18  2
(CG821418) SOYAS73TV LargeInsertSoybeanGenLib Glycine max ge...   105   6e-18  1
(FG158666) AGN_RNC023xk22f1.ab1 AGN_RNC Nicotiana tabacum cD...    88   8e-18  2
(EF650296) Trichardis sp. TD-2008 alanyl-tRNA synthetase (AA...    84   2e-17  2
(ER484180) 1093015286829 Global-Ocean-Sampling_GS-35-01-01-1...    72   2e-17  4
(AC189427) Brassica rapa subsp. pekinensis clone KBrB065N20,...   103   2e-17  1
(FD543949) RR2FR22TF RR2(MS) Raphanus raphanistrum subsp. ra...   103   2e-17  1
(EF650304) Connomyia varipennis alanyl-tRNA synthetase (AATS...    52   3e-17  3
(CJ366476) Molgula tectiformis cDNA, gastrula/neurula clone:...    92   7e-17  2
(EY679970) CS00-C1-650-006-A06-CT.F Sweet orange leaf, young...    90   8e-17  3
(DW492730) GH_RMIRS_093_A08_F Cotton Normalized Library rand...    90   8e-17  2
(CJ392091) Molgula tectiformis cDNA, gonad clone:mtgd018j02,...    92   8e-17  2
(DW492731) GH_RMIRS_093_A08_R Cotton Normalized Library rand...    90   9e-17  2
(AI726299) BNLGHi5539 Six-day Cotton fiber Gossypium hirsutu...    90   1e-16  2
(GH105045) G993P134RK23.T0 Neurospora crassa cDNA - 1 hour G...    82   1e-16  2
(GE957862) G1176P158RM21.T1 Neurospora crassa cDNA - 1 hour ...    82   1e-16  2
(GH089737) G993P113RE21.T0 Neurospora crassa cDNA - 1 hour G...    82   1e-16  2
(GE948105) G1176P149RH22.T0 Neurospora crassa cDNA - 1 hour ...    82   1e-16  2
(GE957924) G1176P158RM21.T0 Neurospora crassa cDNA - 1 hour ...    82   1e-16  2
(GE944381) G1176P141RF2.T0 Neurospora crassa cDNA - 1 hour O...    82   1e-16  2
(EF650264) Bombylius major alanyl-tRNA synthetase (AATS) gen...    66   3e-16  4
(EF650310) Scylaticus costalis alanyl-tRNA synthetase (AATS)...    92   3e-16  2
(EX811978) CBNA2681.fwd CBNA Phycomyces blakesleeanus NRRL15...   100   3e-16  2
(EX817996) CBNA5866.fwd CBNA Phycomyces blakesleeanus NRRL15...   100   4e-16  2
(Z22673) A.thaliana tRNA synthetase.                              100   4e-16  1
(BT008807) Arabidopsis thaliana At1g50200 gene, complete cds.     100   4e-16  1
(BT008649) Arabidopsis thaliana clone RAFL09-78-D07 (R19577)...   100   4e-16  1
(BT002526) Arabidopsis thaliana Unknown protein mRNA, comple...   100   4e-16  1
(AK226885) Arabidopsis thaliana mRNA for putative alanine--t...   100   4e-16  1
(AC007980) Arabidopsis thaliana chromosome I BAC F14I3 genom...   100   4e-16  1
(CQ804806) Sequence 1217 from Patent WO2004035798.                100   4e-16  1
(EG525580) AYAXO28TF pooled cDNA populations Arabidopsis tha...   100   4e-16  1
(EG485831) AYASN68TR pooled cDNA populations Arabidopsis tha...   100   4e-16  1
(AV529902) Arabidopsis thaliana cDNA clone:APZL51f06R, 5' end.    100   4e-16  1
(AV528274) Arabidopsis thaliana cDNA clone:APZL05b11R, 5' end.    100   4e-16  1
(BP562614) Arabidopsis thaliana cDNA clone:RAFL09-97-M18, 5'...   100   4e-16  1
(EX848264) CBNC7310.fwd CBNC Phycomyces blakesleeanus NRRL15...   100   4e-16  1
(EX847212) CBNC6781.fwd CBNC Phycomyces blakesleeanus NRRL15...   100   4e-16  1
(DV617176) EST1220172 Glossina morsitans morsitans Fat body ...    50   5e-16  4
(EK272688) 1095462264906 Global-Ocean-Sampling_GS-31-01-01-1...    54   6e-16  5
(EL600367) He_pwd_0136F12_M13R Heliconius erato pooled wing ...    54   6e-16  3
(EF650318) Damalis monochaetes alanyl-tRNA synthetase (AATS)...    54   2e-15  3
(DN312686) PL06013B1D12 cDNA from juvenile hermaphodites Sch...    46   3e-15  6
(AM469609) Vitis vinifera contig VV78X203805.6, whole genome...    76   4e-15  4
(DY266596) IC0AAA1BD12RM1 CitNFL Citrus clementina cDNA 5', ...    90   5e-15  3
(EF650295) Laphystia tolandi alanyl-tRNA synthetase (AATS) g...    96   6e-15  1
(FK924246) EST_lsal_evj_957020 lsalevj mixed_tissue_mixed_st...    96   6e-15  1
(EF650308) Prolepsis tristis alanyl-tRNA synthetase (AATS) g...    50   1e-14  4
(CR858480) Pongo abelii mRNA; cDNA DKFZp459G207 (from clone ...    82   1e-14  3
(EU436048) Lasionemopoda hirsuta voucher su25 alanyl-tRNA sy...    92   2e-14  2
(GH101196) G993P128RL9.T0 Neurospora crassa cDNA - 1 hour Gl...    82   2e-14  2
(EU436085) Zuskamira inexpectata voucher su75 alanyl-tRNA sy...    70   2e-14  3
(GH097135) G993P121RP2.T0 Neurospora crassa cDNA - 1 hour Gl...    82   2e-14  2
(CN571925) rf35b08.x1 Meloidogyne hapla J2 pAMP1 v1 Meloidog...    94   2e-14  1
(EC134092) HVE00009680 Hartmannella vermiformis Normalized l...    48   2e-14  4
(ER465317) 1092963919945 Global-Ocean-Sampling_GS-35-01-01-1...    72   4e-14  3
(AM450310) Vitis vinifera contig VV78X124834.14, whole genom...    72   4e-14  5
(EF148384) Populus trichocarpa x Populus deltoides clone WS0...    62   6e-14  4
(EU436031) Archisepsis excavata voucher su8 alanyl-tRNA synt...    82   6e-14  2
(ER037135) 1095521483039 Global-Ocean-Sampling_GS-33-01-01-1...    62   6e-14  3
(CV708473) UCRPT01_0011G02_r Poncirus trifoliata CTV-challen...    90   8e-14  2
(CR787743) Pongo abelii mRNA; EST DKFZp468I2329_r1 (from clo...    82   9e-14  2
(EF650311) Tillobroma punctipennis alanyl-tRNA synthetase (A...    76   9e-14  3
(GE922574) G1176P110RF13.T0 Neurospora crassa cDNA - 1 hour ...    82   9e-14  2
(GH088705) G993P110RM16.T0 Neurospora crassa cDNA - 1 hour G...    82   9e-14  2
(CX159373) DV01207.5prime DV Drosophila virilis Embryo Droso...    92   9e-14  1
(CU329670) Schizosaccharomyces pombe chromosome I.                 82   1e-13  20
(CR629714) Pongo abelii mRNA; EST DKFZp469M0521_r1 (from clo...    82   1e-13  2
(EY681459) CS00-C1-650-022-C03-CT.F Sweet orange leaf, young...    90   1e-13  2
(CD576239) UCRPT01_03de07_g3 Poncirus trifoliata CTV-challen...    90   1e-13  2
(EY764718) CR05-C1-100-063-F02-CT.F Mandarin leaf, greenhous...    90   1e-13  2
(DV182174) CT001_D11_CT001_3700_91.ab1 C. tentans tissue cul...    64   1e-13  2
(EY767503) CR05-C1-102-017-A11-CT.F Mandarin leaf, infected ...    90   1e-13  2
(DT662478) He_wd2a1_72G04_M13R Heliconius erato wing disk 2 ...    54   1e-13  3
(DY267065) IC0AAA20BF11RM1 CitNFL Citrus clementina cDNA 5',...    90   1e-13  2
(DY267573) IC0AAA21DD03RM1 CitNFL Citrus clementina cDNA 5',...    90   2e-13  2
(DY274573) IC0AAA37AC07RM1 CitNFL Citrus clementina cDNA 5',...    90   2e-13  2
(FC819793) Sr_pAMT7_015n20_T7 S. ratti mixed stage pAMP Stro...    74   2e-13  3
(BJ418823) Dictyostelium discoideum cDNA clone:ddv34k03, 5' ...    54   2e-13  4
(DW484033) GH_RMIRS_045_B09_077_R Cotton Normalized Library ...    82   2e-13  3
(BJ338004) Dictyostelium discoideum cDNA clone:dda59b23, 5' ...    54   3e-13  4
(BJ397198) Dictyostelium discoideum cDNA clone:dds45m11, 5' ...    54   3e-13  4
(BJ427228) Dictyostelium discoideum cDNA clone:ddv61a20, 5' ...    54   3e-13  4
(EK041560) 1092959522921 Global-Ocean-Sampling_GS-31-01-01-1...    68   3e-13  2
(GE540731) CCHS27160.b1_O22.ab1 CCHS Espina Barnadesia spino...    80   4e-13  2
(GH090934) G993P18FI10.T0 Neurospora crassa cDNA - 1 hour Gl...    82   4e-13  2
(AC225511) Medicago truncatula clone mth2-88i1, complete seq...    90   4e-13  1
(FH287845) CHO_OF4201xp07f1.ab1 CHO_OF4 Nicotiana tabacum ge...    90   4e-13  1
(CV712141) UCRPT01_0016P23_r Poncirus trifoliata CTV-challen...    90   4e-13  1
(CV709297) UCRPT01_0012K10_r Poncirus trifoliata CTV-challen...    90   4e-13  1
(CB417303) EST0379 Mature peel (flavedo) cDNA subtraction li...    90   4e-13  1
(BQ869008) QGD4e08.yg.ab1 QG_ABCDI lettuce salinas Lactuca s...    90   4e-13  1
(EY762553) CR05-C1-100-055-G10-CT.F Mandarin leaf, greenhous...    90   4e-13  1
(EY738956) CS00-C3-705-050-C10-CT.F Sweet orange fruit, deve...    90   4e-13  1
(EY656406) CS00-C1-100-119-D02-CT.F Sweet orange leaf, green...    90   4e-13  1
(CU366431) Aphanomyces euteiches cDNA.                             42   6e-13  4
(EF650305) Gonioscelis ventralis alanyl-tRNA synthetase (AAT...    46   7e-13  4
(EB609121) AGENCOURT_56953483 D. grimshawi EST Drosophila gr...    86   1e-12  2
(AM680859) Entamoeba terrapinae GSS, clone terra180e04.q1k.        76   1e-12  2
(AV413970) Lotus japonicus cDNA clone:MWM238a07_r, 5' end.         88   1e-12  1
(EX059700) BR044344 salt-treated whole plant cDNA library KB...    88   1e-12  1
(AV830219) Arabidopsis thaliana cDNA clone:RAFL09-64-P04, 5'...    88   1e-12  1
(DY963514) CLSM13766.b1_L10.ab1 CLS(LMS) lettuce sativa Lact...    82   2e-12  2
(CX178486) E12_45-121_10.ab1 leaf inoculated with Marssonia ...    62   2e-12  3
(CR929880) Danio rerio EST sequence, clone 244-D05-2.              52   2e-12  4
(DT501783) WS01314.BR_D07 PTxD-IL-FL-A-4 Populus trichocarpa...    62   3e-12  3
(EH083343) PMEAO09TR Perkinsus marinus large insert cDNA lib...    60   3e-12  3
(CR380951) Candida glabrata strain CBS138 chromosome A compl...    82   5e-12  9
(EU436054) Palaeosepsis pusio voucher su33 alanyl-tRNA synth...    86   6e-12  1
(CK290840) EST753554 Nicotiana benthamiana mixed tissue cDNA...    68   6e-12  2
(CK289717) EST752439 Nicotiana benthamiana mixed tissue cDNA...    68   7e-12  2
(CT674226) Danio rerio EST, clone ZF_mu_153m15 5'.                 52   8e-12  4
(EE689923) AGENCOURT_88897702 NIH_ZGC_27 Danio rerio cDNA cl...    52   8e-12  4
(CK015740) AGENCOURT_16542303 NIH_ZGC_10 Danio rerio cDNA cl...    52   8e-12  4
(EF650283) Lestomyia fraudiger alanyl-tRNA synthetase (AATS)...    52   9e-12  4
(EJ953724) 1093018961034 Global-Ocean-Sampling_GS-30-02-01-1...    50   9e-12  5
(EK705572) 1092404068699 Global-Ocean-Sampling_GS-33-01-01-1...    54   1e-11  3
(EH580716) FDR306-P00007-DEPE-F_C22 FDR306 Danio rerio cDNA ...    52   1e-11  4
(EK865333) 1093018080890 Global-Ocean-Sampling_GS-33-01-01-1...    54   1e-11  3
(EK875854) 1093018107260 Global-Ocean-Sampling_GS-33-01-01-1...    54   1e-11  3
(ER012338) 1095521400128 Global-Ocean-Sampling_GS-33-01-01-1...    54   1e-11  3
(EU436032) Archisepsis pleuralis voucher su9 alanyl-tRNA syn...    78   2e-11  3
(EJ856877) 1093017947682 Global-Ocean-Sampling_GS-30-02-01-1...    50   2e-11  5
(EF650287) Dioctria atricapillus alanyl-tRNA synthetase (AAT...    60   2e-11  3
(BQ408844) GA__Ed0012D07r Gossypium arboreum 7-10 dpa fiber ...    82   2e-11  2
(CK028546) AGENCOURT_16624091 NIH_ZGC_7 Danio rerio cDNA clo...    52   2e-11  4
(EY769513) CR05-C1-102-002-A04-CT.F Mandarin leaf, infected ...    82   2e-11  2
(DW484034) GH_RMIRS_045_B09_F Cotton Normalized Library rand...    82   2e-11  2
(EB556236) AGENCOURT_51203776 D. virilis EST Drosophila viri...    84   2e-11  1
(BP189739) Dugesia japonica cDNA, clone: 02205_HH, expressed...    84   2e-11  1
(BX842632) Neurospora crassa DNA linkage group I BAC contig ...    74   2e-11  3
(ER574841) 1093015809473 Global-Ocean-Sampling_GS-36-01-01-2...    42   5e-11  5
(AM600114) Paracentrotus lividus EST, clone MPMGp1174G2271Q,...    64   7e-11  2
(BC171669) Danio rerio zgc:113920, mRNA (cDNA clone MGC:1983...    52   7e-11  4
(BC171667) Danio rerio zgc:113920, mRNA (cDNA clone MGC:1983...    52   7e-11  4
(GE932098) G1176P120RI8.T0 Neurospora crassa cDNA - 1 hour O...    82   7e-11  2
(FG360651) CBHB496.fwd CBHB Trichoderma virens strain Gv29-8...    54   8e-11  2
(AC206538) Pongo abelii BAC clone CH276-53E8 from chromosome...    82   9e-11  1
(AC125476) Medicago truncatula clone mth2-10e13, complete se...    82   9e-11  1
(DW048291) CLLX14895.b1_N04.ab1 CLL(XYZ) lettuce saligna Lac...    82   9e-11  1
(DT573462) EST1084102 GH_TMO Gossypium hirsutum cDNA, mRNA s...    82   9e-11  1
(CR789057) Pongo abelii mRNA; EST DKFZp468F0932_r1 (from clo...    82   9e-11  1
(CR554880) Pongo abelii mRNA; EST DKFZp469K0114_r1 (from clo...    82   9e-11  1
(CR543395) Pongo abelii mRNA; EST DKFZp459G098_r1 (from clon...    82   9e-11  1
(BM358474) GA__Ea0009K01r Gossypium arboreum 7-10 dpa fiber ...    82   9e-11  1
(BM358439) GA__Ea0009E13r Gossypium arboreum 7-10 dpa fiber ...    82   9e-11  1
(GH110681) G993P141RB9.T0 Neurospora crassa cDNA - 1 hour Gl...    82   9e-11  1
(GH110522) G993P141FB9.T0 Neurospora crassa cDNA - 1 hour Gl...    82   9e-11  1
(GH096054) G993P119RM23.T0 Neurospora crassa cDNA - 1 hour G...    82   9e-11  1
(GE945869) G1176P144RB19.T0 Neurospora crassa cDNA - 1 hour ...    82   9e-11  1
(BC097014) Danio rerio zgc:113920, mRNA (cDNA clone IMAGE:74...    52   9e-11  4
(DX971482) CHORI105-20C11.TV.2 CHORI105.pTARBAC1.3 Trypanoso...    68   1e-10  3
(DV091451) 327-384-43_I16_M13-FP Nematostella vectensis norm...    54   1e-10  2
(EJ776024) 1093000601117 Global-Ocean-Sampling_GS-30-02-01-1...    48   1e-10  4
(BJ370418) Dictyostelium discoideum cDNA clone:ddc54f05, 5' ...    54   2e-10  3
(EK132522) 1093010383142 Global-Ocean-Sampling_GS-31-01-01-1...    48   2e-10  4
(BC071378) Danio rerio alanyl-tRNA synthetase, mRNA (cDNA cl...    52   2e-10  4
(EF650312) Willistonina bilineata alanyl-tRNA synthetase (AA...    60   2e-10  2
(BJ419749) Dictyostelium discoideum cDNA clone:ddv37g05, 5' ...    54   3e-10  3
(GE930425) G1176P124RK11.T0 Neurospora crassa cDNA - 1 hour ...    48   3e-10  3
(BJ421875) Dictyostelium discoideum cDNA clone:ddv44j05, 5' ...    54   3e-10  3
(BJ421195) Dictyostelium discoideum cDNA clone:ddv41c04, 5' ...    54   3e-10  3
(GE545543) CCHS4492.b1_G20.ab1 CCHS Espina Barnadesia spinos...    80   4e-10  1
(EU436026) Lopa convexa voucher su1 alanyl-tRNA synthetase (...    44   4e-10  4
(BC128794) Danio rerio alanyl-tRNA synthetase, mRNA (cDNA cl...    52   5e-10  4
(EE821703) 020605ONLN145086HT ONLN Ovis aries cDNA, mRNA seq...    60   5e-10  3
(EH586556) FDR306-P00023-DEPE-F_B22 FDR306 Danio rerio cDNA ...    52   6e-10  3
(EU436053) Ortalischema albitarse voucher su31 alanyl-tRNA s...    70   7e-10  2
(EU436050) Microsepsis armillata voucher su28 alanyl-tRNA sy...    76   8e-10  2
(EF650271) Neolophonotus bimaculatus alanyl-tRNA synthetase ...    72   8e-10  2
(EF650274) Proctacanthus philadelphicus alanyl-tRNA syntheta...    66   8e-10  2
(FG521107) 030702KAZB009869HT (KAZB) Actinidia chinensis you...    68   1e-09  2
(AM505060) Paracentrotus lividus EST, clone MPMGp1171P073Q, ...    64   1e-09  2
(AM507962) Paracentrotus lividus EST, clone MPMGp1171B0317Q,...    64   1e-09  2
(AM508849) Paracentrotus lividus EST, clone MPMGp1171K1423Q,...    64   1e-09  2
(AM522221) Paracentrotus lividus EST, clone MPMGp1171I2222Q,...    64   1e-09  2
(EK241913) 1095460228545 Global-Ocean-Sampling_GS-31-01-01-1...    46   1e-09  4
(ET542261) fcg3x.607750a22.f C. graminicola genomic sequence...    62   1e-09  3
(EL602584) He_pwd_0205G05_M13R Heliconius erato pooled wing ...    54   2e-09  3
(EF650286) Saropogon luteus alanyl-tRNA synthetase (AATS) ge...    52   2e-09  4
(EJ567995) 1092960005092 Global-Ocean-Sampling_GS-29-01-01-1...    48   2e-09  4
(DN443528) LIB5338-108-A1-K2-D4 LIB5338 Canis lupus familiar...    58   3e-09  3
(BJ562700) Ipomoea nil cDNA clone:jm37l07, 5' end, single read.    60   3e-09  2
(BJ425146) Dictyostelium discoideum cDNA clone:ddv54d22, 5' ...    50   3e-09  3
(CJ750557) Ipomoea nil cDNA clone:jmsf50b10, 5' end.               60   4e-09  2
(AM514673) Paracentrotus lividus EST, clone MPMGp1171P0719Q,...    62   4e-09  2
(EY847270) CA26-C1-002-067-A04-CT.F Sour orange leaf, field ...    76   5e-09  2
(EK098920) 1092962061505 Global-Ocean-Sampling_GS-31-01-01-1...    72   5e-09  2
(DQ048406) Pan troglodytes AARS gene, VIRTUAL TRANSCRIPT, pa...    66   5e-09  3
(EF650300) Emphysomera pallidapex alanyl-tRNA synthetase (AA...    76   6e-09  1
(CR769524) Pongo abelii mRNA; EST DKFZp469N0829_r1 (from clo...    76   6e-09  1
(CP000941) Xylella fastidiosa M12, complete genome.                76   6e-09  1
(DN877952) nae17e02.y1 Dog eye eye minus lens and cornea. Un...    58   7e-09  3
(EU436034) Archisepsis scabra voucher su11 alanyl-tRNA synth...    48   7e-09  2
(CA098862) SCRLCL6032G04.g CL6 Saccharum officinarum cDNA cl...    42   9e-09  4
(BU103214) SCRLCL6032G04.g Saccharum officinarum mRNA (Nogue...    42   9e-09  4
(CD215692) pgp2n.pk008.j5 Normalized chicken pituitary/hypot...    40   9e-09  5
(ER497878) 1093015355106 Global-Ocean-Sampling_GS-35-01-01-1...    48   9e-09  3
(BU421866) 603019083F1 CSEQRBN09 Gallus gallus cDNA clone Ch...    40   1e-08  5
(AJ722115) Gallus gallus EST, clone 11d4s5.                        40   1e-08  5
(CN233227) RJA108A09.ab1 RJbrain Gallus gallus cDNA 5', mRNA...    40   1e-08  5
(DB891525) Populus nigra mRNA, clone: PnFL2-095_P09, 5'end.        62   1e-08  2
(CX174114) G03_69-74_13.ab1 leaf inoculated with Marssonia p...    62   1e-08  2
(ER580532) 1093015835772 Global-Ocean-Sampling_GS-36-01-01-2...    56   2e-08  2
(DR425172) naw15d11.y1 Chicken eye (hatched). Unnormalized (...    40   2e-08  5
(ER445384) 1092963827109 Global-Ocean-Sampling_GS-35-01-01-1...    60   2e-08  2
(DU099733) JBnY022G19F Brassica napus BAC library JBnY Brass...    72   2e-08  2
(DU103339) JBnY022G20F Brassica napus BAC library JBnY Brass...    72   2e-08  2
(CP000584) Ostreococcus lucimarinus CCE9901 chromosome 4, co...    74   2e-08  1
(EU436030) Archisepsis diversiformis voucher su7 alanyl-tRNA...    74   2e-08  1
(DW489173) GH_RMIRS_073_F03_R Cotton Normalized Library rand...    74   2e-08  1
(DW489172) GH_RMIRS_073_F03_F Cotton Normalized Library rand...    74   2e-08  1
(DW148198) CLVX13226.b1_D19.ab1 CLV(XYZ) lettuce virosa Lact...    74   2e-08  1
(DW148140) CLVX13172.b1_H05.ab1 CLV(XYZ) lettuce virosa Lact...    74   2e-08  1
(DW085602) CLPX8674.b1_C10.ab1 CLP(XYZ) lettuce perennis Lac...    74   2e-08  1
(DW082334) CLPX5154.b1_D17.ab1 CLP(XYZ) lettuce perennis Lac...    74   2e-08  1
(CD524119) ku96c09.y1 Strongyloides ratti PA female naive pA...    74   2e-08  1
(GH106057) G993P133RL13.T0 Neurospora crassa cDNA - 1 hour G...    74   2e-08  1
(GE938699) G1176P133RP20.T0 Neurospora crassa cDNA - 1 hour ...    74   2e-08  1
(FF329328) 280439790 Pea aphid whole body normalized full le...    74   2e-08  1
(FF320343) 280407743 Pea aphid whole body normalized full le...    74   2e-08  1
(FF317626) 280393364 Pea aphid whole body normalized full le...    74   2e-08  1
(FF312747) 279385561 Pea aphid whole body normalized full le...    74   2e-08  1
(FF295136) 279304728 Pea aphid whole body normalized full le...    74   2e-08  1
(EX649881) 256735934 Pea aphid whole body normalized full le...    74   2e-08  1
(EX648419) 256721676 Pea aphid whole body normalized full le...    74   2e-08  1
(EX639914) 256631207 Pea aphid whole body normalized full le...    74   2e-08  1
(EX637333) 256614881 Pea aphid whole body normalized full le...    74   2e-08  1
(EX626015) 255434375 Pea aphid whole body normalized full le...    74   2e-08  1
(EX622954) 255422642 Pea aphid whole body normalized full le...    74   2e-08  1
(EX612498) 255379665 Pea aphid whole body normalized full le...    74   2e-08  1
(EX610508) 255371893 Pea aphid whole body normalized full le...    74   2e-08  1
(AE003849) Xylella fastidiosa 9a5c, complete genome.               74   2e-08  1
(EJ087370) 1095460123705 Global-Ocean-Sampling_GS-26-01-01-1...    46   2e-08  4
(EJ078905) 1095458144962 Global-Ocean-Sampling_GS-26-01-01-1...    54   3e-08  2
(EK376910) 1095469444746 Global-Ocean-Sampling_GS-31-01-01-1...    42   3e-08  3
(ER334930) 1092344296218 Global-Ocean-Sampling_GS-34-01-01-1...    50   3e-08  4
(AC216770) Populus trichocarpa clone POP051-A24, complete se...    62   4e-08  6
(ES228145) T01172_J07_C1C2_E07_012 CC - Norway Spruce Subtra...    66   4e-08  2
(EF650313) Lasiopogon aldrichii alanyl-tRNA synthetase (AATS...    64   5e-08  2
(EF650277) Dysmachus trigonus alanyl-tRNA synthetase (AATS) ...    64   5e-08  2
(BQ063703) AGENCOURT_6873025 NIH_MGC_99 Homo sapiens cDNA cl...    58   5e-08  3
(CN952301) Ha_mx0_58d02_SP6 Lobster Multiple Tissues, Normal...    72   5e-08  2
(ER283588) 1092343443190 Global-Ocean-Sampling_GS-34-01-01-1...    50   6e-08  4
(FG496481) 030414KAWC007674HT (KAWC) Actinidia chinensis - a...    68   6e-08  2
(ER432621) 1092963784228 Global-Ocean-Sampling_GS-35-01-01-1...    72   6e-08  2
(FC642975) CAXU6308.fwd CAXU Lottia gigantea from female gon...    50   7e-08  2
(DQ682019) Synthetic construct Francisella tularensis clone ...    46   7e-08  6
(EK163153) 1095458040398 Global-Ocean-Sampling_GS-31-01-01-1...    58   8e-08  2
(CU466930) Candidatus Cloacamonas acidaminovorans provisiona...    58   8e-08  2
(AC115598) Dictyostelium discoideum chromosome 2 map 581427-...    54   9e-08  11
(EH116683) HA_MX0_95g05_SP6 Lobster Multiple Tissues, Normal...    72   9e-08  1
(GE484530) CCFS1587.b1_E13.ab1 CCF(STU) sunflower Helianthus...    72   9e-08  1
(EK314434) 1095462408118 Global-Ocean-Sampling_GS-31-01-01-1...    46   1e-07  3
(EK549329) 1095516109108 Global-Ocean-Sampling_GS-32-01-01-1...    48   1e-07  3
(EU436049) Meroplius fukuharai voucher su26 alanyl-tRNA synt...    62   1e-07  2
(EU020715) Lithobius forticatus clone Lfo3070f4 putative AAT...    40   1e-07  3
(BJ558889) Ipomoea nil cDNA clone:jm26p13, 5' end, single read.    54   2e-07  2
(EL506625) B06_PF-SAU3A-T3-M-P25_D.AB1 Blood stage Plasmodiu...    58   2e-07  2
(EL506624) B06_PF-SAU3A-T3-M-P25.AB1 Blood stage Plasmodium ...    58   2e-07  2
(EJ439767) 1093015299550 Global-Ocean-Sampling_GS-28-01-01-1...    36   2e-07  5
(EF650309) Rhabdogaster pedion alanyl-tRNA synthetase (AATS)...    48   2e-07  3
(DQ295241) Uncultured marine bacterium Ant39E11, partial gen...    58   2e-07  2
(AM521760) Paracentrotus lividus EST, clone MPMGp1171L0911Q,...    56   2e-07  2
(AJ452586) Gallus gallus EST, clone library riken1, clone 31...    40   2e-07  4
(DT663696) He_wd2a1_95B07_M13R Heliconius erato wing disk 2 ...    54   2e-07  2
(AM515276) Paracentrotus lividus EST, clone MPMGp1171G0927Q,...    56   2e-07  2
(AM540949) Paracentrotus lividus EST, clone MPMGp1171J2271Q,...    56   2e-07  2
(EL393877) CFFM5335.b1_N14.ab1 CFF(LMS) safflower Carthamus ...    62   2e-07  2
(AK052744) Mus musculus 0 day neonate kidney cDNA, RIKEN ful...    38   2e-07  5
(AM516764) Paracentrotus lividus EST, clone MPMGp1171G1535Q,...    56   3e-07  2
(AM504484) Paracentrotus lividus EST, clone MPMGp1171J221Q, ...    56   3e-07  2
(EE816270) 010914ONDC174069HT ONDC Ovis aries cDNA, mRNA seq...    50   3e-07  3
(DQ048405) Homo sapiens AARS gene, VIRTUAL TRANSCRIPT, parti...    58   3e-07  3
(DQ894824) Synthetic construct Homo sapiens clone IMAGE:1000...    58   3e-07  3
(DQ891634) Synthetic construct clone IMAGE:100004264; FLH178...    58   3e-07  3
(CP000655) Polynucleobacter sp. QLW-P1DMWA-1, complete genome.     58   3e-07  2
(ER443681) 1092963822667 Global-Ocean-Sampling_GS-35-01-01-1...    70   3e-07  1
(EB592761) AGENCOURT_51880091 D. ananassae EST Drosophila an...    70   3e-07  1
(CX532855) s13dNF75G11MJ084_271992 Methyl Jasmonate-Elicited...    70   3e-07  1
(CX529287) s13dNF18F07MJ059_244632 Methyl Jasmonate-Elicited...    70   3e-07  1
(CR853430) Pongo abelii mRNA; EST DKFZp469G137_r1 (from clon...    70   3e-07  1
(CD155164) ML1-0039T-R275-D09-U.G ML1-0039 Schistosoma manso...    70   3e-07  1
(CB894828) EST647620 HOGA Medicago truncatula cDNA clone HOG...    70   3e-07  1
(BG453786) NF094A07LF1F1050 Developing leaf Medicago truncat...    70   3e-07  1
(BG448365) NF024C05EC1F1035 Elicited cell culture Medicago t...    70   3e-07  1
(BF648615) NF048B01EC1F1011 Elicited cell culture Medicago t...    70   3e-07  1
(GE929678) G1176P124RF22.T0 Neurospora crassa cDNA - 1 hour ...    70   3e-07  1
(EK304342) 1095462375713 Global-Ocean-Sampling_GS-31-01-01-1...    60   4e-07  3
(BC011451) Homo sapiens alanyl-tRNA synthetase, mRNA (cDNA c...    58   4e-07  3
(AK299098) Homo sapiens cDNA FLJ61339 complete cds, highly s...    58   4e-07  3
(CQ725247) Sequence 11181 from Patent WO02068579.                  58   4e-07  3
(BX571681) Zebrafish DNA sequence from clone DKEY-73N10 in l...    44   4e-07  3
(AK222824) Homo sapiens mRNA for alanyl-tRNA synthetase vari...    58   4e-07  3
(ER500387) 1093015396748 Global-Ocean-Sampling_GS-35-01-01-1...    60   4e-07  2
(EV438022) agen0049_004c_c10_q1ca Goat early pregnancy (d4-8...    50   4e-07  3
(BM491711) pgp2n.pk007.d2 Normalized Chicken Pituitary/Hypot...    40   4e-07  4
(AR454590) Sequence 63 from patent US 6682888.                     58   4e-07  3
(DN387681) LIB3893-013-Q1-K1-D5 LIB3893 Canis lupus familiar...    50   4e-07  3
(BM426512) pgf2n.pk002.o22 Normalized Chicken Abdominal Fat ...    40   5e-07  4
(DN364378) LIB3629-013-Q1-K6-B4 LIB3629 Canis lupus familiar...    44   5e-07  4
(AJ883842) Trichophyton rubrum EST, clone TrMZG08ACJ.              44   5e-07  3
(BI394316) pgp1n.pk014.d24 Normalized Chicken Pituitary/Hypo...    40   5e-07  4
(BJ704025) Ptyochromis sp. 'redtail sheller' cDNA clone:no57...    62   6e-07  2
(EF650280) Tolmerus atricapillus alanyl-tRNA synthetase (AAT...    62   7e-07  2
(AJ449077) Gallus gallus EST, clone library riken1, clone 20...    40   7e-07  4
(AJ446381) Gallus gallus EST, clone library riken1, clone 13...    40   7e-07  4
(BP282100) Homo sapiens cDNA clone: KMR03273, Sugano cDNA li...    58   7e-07  2
(DN375632) LIB38529_012_C06_T7_1 LIB38529 Canis lupus famili...    58   7e-07  2
(CN277048) 17000531864156 GRN_EB Homo sapiens cDNA 5', mRNA ...    58   7e-07  2
(DN424095) LIB4216-087-Q1-K1-G3 LIB4216 Canis lupus familiar...    58   7e-07  2
(CN277035) 17000533312418 GRN_ES Homo sapiens cDNA 5', mRNA ...    58   7e-07  2
(BP281787) Homo sapiens cDNA clone: KMR02383, Sugano cDNA li...    58   8e-07  2
(BM834619) K-EST0109627 S11SNU1 Homo sapiens cDNA clone S11S...    58   8e-07  2
(CN277061) 17000532204340 GRN_ES Homo sapiens cDNA 5', mRNA ...    58   8e-07  2
(CN277040) 17000531878272 GRN_EB Homo sapiens cDNA 5', mRNA ...    58   8e-07  2
(CN277051) 17000532613534 GRN_ES Homo sapiens cDNA 5', mRNA ...    58   8e-07  2
(BE888227) 601511747F1 NIH_MGC_71 Homo sapiens cDNA clone IM...    58   8e-07  2
(BE728330) 601561719F1 NIH_MGC_20 Homo sapiens cDNA clone IM...    58   8e-07  2
(BE387386) 601274465F1 NIH_MGC_20 Homo sapiens cDNA clone IM...    58   8e-07  2
(CR984614) RZPD Homo sapiens cDNA expression clone RZPDp9016...    58   8e-07  2
(AC148538) Pan troglodytes clone CH251-167M3, WORKING DRAFT ...    66   8e-07  3
(DB858085) Lipochromis sp. 'matumbi hunter' cDNA clone:hm701...    62   8e-07  2
(AC186000) Pan troglodytes BAC clone CH251-167M3 from chromo...    66   8e-07  3
(CN277062) 17000531390060 GRN_EB Homo sapiens cDNA 5', mRNA ...    58   8e-07  2
(CN277037) 17000533183280 GRN_ES Homo sapiens cDNA 5', mRNA ...    58   8e-07  2

>(AF188717) Dictyostelium discoideum alanyl-tRNA synthetase (AlaS)
            mRNA, complete cds.
          Length = 2924

 Score = 1976 bits (997), Expect(3) = 0.0
 Identities = 1003/1005 (99%)
 Strand = Plus / Plus


Query: 117  agagagaaatgtgaacatacatttgttccatcatcagcagtaattccacatgatgatcca 176
            |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 77   agagagaaatatgaacatacatttgttccatcatcagcagtaattccacatgatgatcca 136


Query: 177  actttattatttgcaaatgcaggtatgaatcaatttaaaccaatctttttaggacaagtt 236
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 137  actttattatttgcaaatgcaggtatgaatcaatttaaaccaatctttttaggacaagtt 196


Query: 237  aatccaaaatcagaacaagcaaaattgaagagagcagtcaatagtcaaaaatgtattcgt 296
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 197  aatccaaaatcagaacaagcaaaattgaagagagcagtcaatagtcaaaaatgtattcgt 256


Query: 297  gcaggtggtaaacataatgatttggatgatgtaggtaaggatacttatcatcacaccttc 356
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 257  gcaggtggtaaacataatgatttggatgatgtaggtaaggatacttatcatcacaccttc 316


Query: 357  tttgagatgttgggtaattggtcatttggcaattactttaagaaggaggcaatcacttgg 416
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 317  tttgagatgttgggtaattggtcatttggcaattactttaagaaggaggcaatcacttgg 376


Query: 417  gcatgggaattattgacagaggtatacaaattagataaagaacgtttatatgtcacttac 476
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 377  gcatgggaattattgacagaggtatacaaattagataaagaacgtttatatgtcacttac 436


Query: 477  tttagaggtgacccagagaaaggattggaagcagatctcgaagcaaagaacctttggttg 536
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 437  tttagaggtgacccagagaaaggattggaagcagatctcgaagcaaagaacctttggttg 496


Query: 537  caatatttaccagaggaacgtgtgctcccattcggtatgaaagagaacttttgggagatg 596
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 497  caatatttaccagaggaacgtgtgctcccattcggtatgaaagagaacttttgggagatg 556


Query: 597  ggtgaccaaggtccatgtggtccatgttcagagatccactatgacaaagtggaaggtcgt 656
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 557  ggtgaccaaggtccatgtggtccatgttcagagatccactatgacaaagtggaaggtcgt 616


Query: 657  gatggtgcctcctttgtcaatgctgatgacccaactttgattgaaatttggaatttggtt 716
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 617  gatggtgcctcctttgtcaatgctgatgacccaactttgattgaaatttggaatttggtt 676


Query: 717  ttcattcaatataatcgtgaggctgataaatccttacgtccattaccacaaaaacacgtc 776
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 677  ttcattcaatataatcgtgaggctgataaatccttacgtccattaccacaaaaacacgtc 736


Query: 777  gacactggtatgggtctcgaacgtttaacttcaatcattcaaaaagtaccaaccaattat 836
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 737  gacactggtatgggtctcgaacgtttaacttcaatcattcaaaaagtaccaaccaattat 796


Query: 837  gataccgatgtttttatgccaatctttgccgccattcaagaggtaactggttatccagaa 896
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 797  gataccgatgtttttatgccaatctttgccgccattcaagaggtaactggttatccagaa 856


Query: 897  ccatacggtggaaaagtcggtgctgaagatacacaacaagttgatatggcctatcgtgtc 956
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 857  ccatacggtggaaaagtcggtgctgaagatacacaacaagttgatatggcctatcgtgtc 916


Query: 957  attgccgatcacattcgtacactcacattctcaattgctgatggtgccgccccatccgtc 1016
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 917  attgccgatcacattcgtacactcacattctcaattgctgatggtgccgccccatccgtc 976


Query: 1017 gatggtagaggtcaagtcctccgtagaatccttcgtcgtgccgtccgttatggtaaacaa 1076
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 977  gatggtagaggtcaagtcctccgtagaatccttcgtcgtgccgtccgttatggtaaacaa 1036


Query: 1077 aaattaaatgcaccagctggtttcttctctaaattggttgatgtt 1121
            ||||||||||||||| |||||||||||||||||||||||||||||
Sbjct: 1037 aaattaaatgcaccaactggtttcttctctaaattggttgatgtt 1081

 Score =  948 bits (478), Expect(2) = 0.0
 Identities = 478/478 (100%)
 Strand = Plus / Plus


Query: 1133 tccagaatgggcaaactattccatcgaattttgtggtggtacacatttgtcaaacactaa 1192
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2131 tccagaatgggcaaactattccatcgaattttgtggtggtacacatttgtcaaacactaa 2190


Query: 1193 acaagctgaactcttcaccattacctctgaagaaactttgggtgctggtgtacgtcgtat 1252
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2191 acaagctgaactcttcaccattacctctgaagaaactttgggtgctggtgtacgtcgtat 2250


Query: 1253 cgtcgctgtcactggttctgaagctgcctctgctatagaactcaataaagaattggaagt 1312
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2251 cgtcgctgtcactggttctgaagctgcctctgctatagaactcaataaagaattggaagt 2310


Query: 1313 cagattcaataatgccctcaaattatcaggttcagaacttgccaaggaaatcgtttcctt 1372
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2311 cagattcaataatgccctcaaattatcaggttcagaacttgccaaggaaatcgtttcctt 2370


Query: 1373 attagatcttctcaaggttgtcaccatttcagcaagtgttcgtatgaatttggttgaaac 1432
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2371 attagatcttctcaaggttgtcaccatttcagcaagtgttcgtatgaatttggttgaaac 2430


Query: 1433 tttgaaggaagttcaagcactccaaagaaaacaagtcaaagaacaagaaaccatcttggc 1492
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2431 tttgaaggaagttcaagcactccaaagaaaacaagtcaaagaacaagaaaccatcttggc 2490


Query: 1493 tcaacaagctcaaacctatttagagaaaacctctgaagaattggctaaatctcaaccaaa 1552
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2491 tcaacaagctcaaacctatttagagaaaacctctgaagaattggctaaatctcaaccaaa 2550


Query: 1553 ggttttcgtagatttagtaaacttcaattcaaatactcctttaatcactgaaaccatt 1610
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2551 ggttttcgtagatttagtaaacttcaattcaaatactcctttaatcactgaaaccatt 2608

 Score =  543 bits (274), Expect(2) = 0.0
 Identities = 274/274 (100%)
 Strand = Plus / Plus


Query: 1618 ttcaaactaaatcaccaatgactgcaatcatgttaattagtccagatgaagaaaaaggta 1677
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2616 ttcaaactaaatcaccaatgactgcaatcatgttaattagtccagatgaagaaaaaggta 2675


Query: 1678 aagttacttgcattggtatcgttccaaaagattctgaaatctcaaaaactttaactgcaa 1737
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2676 aagttacttgcattggtatcgttccaaaagattctgaaatctcaaaaactttaactgcaa 2735


Query: 1738 atgcttgggttgtaaaggttaccgaagttttaggtggtaaaggtggtggtaaagttgatg 1797
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2736 atgcttgggttgtaaaggttaccgaagttttaggtggtaaaggtggtggtaaagttgatg 2795


Query: 1798 ttgctcaaggtgttggttctaaattagataaaatcgatgaagctattctcgtttcaagag 1857
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2796 ttgctcaaggtgttggttctaaattagataaaatcgatgaagctattctcgtttcaagag 2855


Query: 1858 aatttgcaaatgcaaactgattcaaattatcttt 1891
            ||||||||||||||||||||||||||||||||||
Sbjct: 2856 aatttgcaaatgcaaactgattcaaattatcttt 2889

 Score = 67.9 bits (34), Expect(3) = 0.0
 Identities = 34/34 (100%)
 Strand = Plus / Plus


Query: 76  tggatgttaatcaaattagaaaaacttttatcga 109
           ||||||||||||||||||||||||||||||||||
Sbjct: 36  tggatgttaatcaaattagaaaaacttttatcga 69

 Score = 38.2 bits (19), Expect(3) = 0.0
 Identities = 25/27 (92%)
 Strand = Plus / Plus


Query: 41 ggaaggagagagaaaatataaaagaag 67
          ||||||||| | |||||||||||||||
Sbjct: 1  ggaaggagatataaaatataaaagaag 27

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 2,123,530,092
Number of extensions: 126100542
Number of successful extensions: 11694624
Number of sequences better than 10.0: 1669
Length of query: 1968
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1944
Effective length of database: 96,409,374,237
Effective search space: 187419823516728
Effective search space used: 187419823516728
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
protein update 2009. 7.17
Homology vs Protein 
Query= Contig-U15693-1 (Contig-U15693-1Q) /CSM_Contig/Contig-U15693-1Q.Seq.d
         (1968 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q54Y20) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   726   0.0
CP001330_129(CP001330|pid:none) Micromonas sp. RCC299 chromosome...   520   e-146
CP000497_274(CP000497|pid:none) Pichia stipitis CBS 6054 chromos...   515   e-144
(P36428) RecName: Full=Alanyl-tRNA synthetase, mitochondrial;   ...   513   e-143
AC007980_17(AC007980|pid:none) Arabidopsis thaliana chromosome I...   513   e-143
Z22673_2(Z22673|pid:none) A.thaliana tRNA synthetase.                 509   e-142
FN392321_477(FN392321|pid:none) Pichia pastoris GS115 chromosome...   497   e-139
(P21894) RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;     ...   494   e-138
CU928168_72(CU928168|pid:none) Kluyveromyces thermotolerans stra...   493   e-137
BX842632_19(BX842632|pid:none) Neurospora crassa DNA linkage gro...   489   e-136
CR954204_497(CR954204|pid:none) Ostreococcus tauri strain OTTH05...   489   e-136
(P40825) RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;     ...   485   e-135
CR380951_223(CR380951|pid:none) Candida glabrata strain CBS138 c...   485   e-135
(O13914) RecName: Full=Probable alanyl-tRNA synthetase, cytoplas...   485   e-135
AM502240_136(AM502240|pid:none) Leishmania infantum chromosome 22.    484   e-135
U18672_1(U18672|pid:none) Saccharomyces cerevisiae cytoplasmic a...   483   e-134
CR382126_105(CR382126|pid:none) Kluyveromyces lactis strain NRRL...   481   e-134
FN357383_9(FN357383|pid:none) Schistosoma mansoni genome sequenc...   479   e-133
AM494959_146(AM494959|pid:none) Leishmania braziliensis chromoso...   479   e-133
CT005261_152(CT005261|pid:none) Leishmania major strain Friedlin...   477   e-133
(P49588) RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;     ...   477   e-133
AM920437_1024(AM920437|pid:none) Penicillium chrysogenum Wiscons...   476   e-132
AK044451_1(AK044451|pid:none) Mus musculus adult retina cDNA, RI...   476   e-132
(Q8BGQ7) RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;     ...   476   e-132
AK150227_1(AK150227|pid:none) Mus musculus bone marrow macrophag...   474   e-132
AY069255_1(AY069255|pid:none) Drosophila melanogaster GM03058 fu...   474   e-132
BC148083_1(BC148083|pid:none) Bos taurus alanyl-tRNA synthetase,...   474   e-132
EF028073_1(EF028073|pid:none) Bos taurus BTA18 scaffold186240_12...   474   e-132
D32050_1(D32050|pid:none) Homo sapiens mRNA for alanyl-tRNA synt...   474   e-132
BC161712_1(BC161712|pid:none) Xenopus laevis hypothetical protei...   473   e-131
AE017346_259(AE017346|pid:none) Cryptococcus neoformans var. neo...   473   e-131
(Q5RC02) RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;     ...   471   e-131
AK299098_1(AK299098|pid:none) Homo sapiens cDNA FLJ61339 complet...   470   e-131
BX649641_5(BX649641|pid:none) Zebrafish DNA sequence from clone ...   468   e-130
BC128794_1(BC128794|pid:none) Danio rerio alanyl-tRNA synthetase...   468   e-130
BC071378_1(BC071378|pid:none) Danio rerio alanyl-tRNA synthetase...   468   e-130
AC125476_24(AC125476|pid:none) Medicago truncatula clone mth2-10...   427   e-118
(Q14CH7) RecName: Full=Probable alanyl-tRNA synthetase, mitochon...   422   e-116
BC166719_1(BC166719|pid:none) Rattus norvegicus alanyl-tRNA synt...   419   e-115
CR940347_223(CR940347|pid:none) Theileria annulata strain Ankara...   405   e-111
CP001101_310(CP001101|pid:none) Chlorobium phaeobacteroides BS1,...   394   e-108
(A0LXX3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   386   e-105
CP001108_293(CP001108|pid:none) Prosthecochloris aestuarii DSM 2...   385   e-105
CP001100_593(CP001100|pid:none) Chloroherpeton thalassium ATCC 3...   385   e-105
(Q11V49) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   385   e-105
(A1BD33) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   381   e-104
(A5FIP9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   380   e-104
(A4SGJ6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   379   e-103
AP007174_1(AP007174|pid:none) Aspergillus oryzae RIB40 genomic D...   378   e-103
(Q3ATN3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   377   e-102
(A6L1L8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   377   e-102
(Q3B1I7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   376   e-102
(A6LEZ8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   376   e-102
AP009380_1381(AP009380|pid:none) Porphyromonas gingivalis ATCC 3...   371   e-101
(A6H0Y3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   370   e-101
(Q7MV54) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   370   e-101
CU466930_1614(CU466930|pid:none) Candidatus Cloacamonas acidamin...   369   e-100
AP010656_517(AP010656|pid:none) Candidatus Azobacteroides pseudo...   365   4e-99
(A0LLA3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   350   1e-94
AL590442_147(AL590442|pid:none) chromosome II of strain GB-M1 of...   348   4e-94
AY568074_1(AY568074|pid:none) Naegleria gruberi strain NEG-M ala...   346   2e-93
AF188716_1(AF188716|pid:none) Drosophila melanogaster mitochondr...   345   5e-93
(B1ZZ40) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   344   6e-93
AY142830_1(AY142830|pid:none) Heliobacillus mobilis Alanyl-tRNA ...   340   1e-91
(A1ATU9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   334   8e-90
CP001229_855(CP001229|pid:none) Sulfurihydrogenibium azorense Az...   331   5e-89
(Q2LPL7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   331   5e-89
(Q15RG5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   329   3e-88
(Q39Z77) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   328   3e-88
(Q8DC49) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   327   1e-87
(P61701) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   327   1e-87
(Q7MHR6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   327   1e-87
(B2V709) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   326   2e-87
(Q3ILF3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   325   4e-87
(A7MYT5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   325   5e-87
(Q2RHZ3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   324   6e-87
FM954972_2448(FM954972|pid:none) Vibrio splendidus LGP32 chromos...   324   6e-87
CP001111_1478(CP001111|pid:none) Stenotrophomonas maltophilia R5...   323   1e-86
CP001279_122(CP001279|pid:none) Nautilia profundicola AmH, compl...   323   1e-86
(B2FL33) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   322   3e-86
CP001322_2924(CP001322|pid:none) Desulfatibacillum alkenivorans ...   322   4e-86
(O67323) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   322   4e-86
(A7HH87) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   322   4e-86
(B1Y1G9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   321   7e-86
(Q30YS5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   320   9e-86
(Q01XA0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   320   1e-85
(Q1D084) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   320   1e-85
CP001089_3121(CP001089|pid:none) Geobacter lovleyi SZ, complete ...   320   2e-85
(A4SS99) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   319   2e-85
CP001087_2702(CP001087|pid:none) Desulfobacterium autotrophicum ...   319   2e-85
(Q2NVL2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   319   2e-85
AF188715_1(AF188715|pid:none) Caenorhabditis elegans alanyl-tRNA...   319   3e-85
(B1XCM5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   3e-85
CU928163_2962(CU928163|pid:none) Escherichia coli UMN026 chromos...   318   3e-85
AE005174_3567(AE005174|pid:none) Escherichia coli O157:H7 EDL933...   318   3e-85
CU928158_352(CU928158|pid:none) Escherichia fergusonii ATCC 3546...   318   3e-85
(Q32CN1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   3e-85
(B2U049) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   3e-85
(A1AEN7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   3e-85
CU928164_2865(CU928164|pid:none) Escherichia coli IAI39 chromoso...   318   3e-85
CU651637_2560(CU651637|pid:none) Escherichia coli LF82 chromosom...   318   3e-85
(A7ZQC5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   3e-85
(Q0TEI3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   3e-85
AP009153_1915(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...   318   5e-85
(Q3JCK8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   6e-85
(Q7N7A5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   6e-85
(A5ICV6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   318   6e-85
(P61700) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   317   8e-85
(A1VEQ6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   317   8e-85
(B1IUY2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   317   8e-85
(A8GA09) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   317   1e-84
CP001147_525(CP001147|pid:none) Thermodesulfovibrio yellowstonii...   317   1e-84
(Q5WVQ2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   317   1e-84
DQ407888_1(DQ407888|pid:none) Ictalurus punctatus clone SDDH11R ...   316   2e-84
(A1VYL8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   316   2e-84
(Q6AQ16) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   316   2e-84
CP000964_1082(CP000964|pid:none) Klebsiella pneumoniae 342, comp...   315   3e-84
(A7ZE62) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   315   3e-84
(Q8Z4D5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   315   4e-84
(A6TCV9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   315   4e-84
AM942759_369(AM942759|pid:none) Proteus mirabilis strain HI4320,...   315   5e-84
(B1JJA0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   315   5e-84
(A7FLR7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   315   5e-84
(Q1C420) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   7e-84
(Q57KU6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   7e-84
(A4TQ52) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   7e-84
(B0RTY1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   7e-84
(A4WDQ6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   7e-84
CP001010_1204(CP001010|pid:none) Polynucleobacter necessarius su...   314   7e-84
(A9N0C1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   7e-84
CP001138_2744(CP001138|pid:none) Salmonella enterica subsp. ente...   314   7e-84
CP001197_871(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy...   314   7e-84
(B0TZY8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   9e-84
(A1S4E9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   9e-84
(A9NCN7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   314   9e-84
(A0L3J9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   1e-83
(Q56273) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   1e-83
(Q31F91) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   1e-83
(B0TK15) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   1e-83
CP000472_1305(CP000472|pid:none) Shewanella piezotolerans WP3, c...   313   1e-83
(B2SUD0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   1e-83
(A9MFZ1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   1e-83
AM933172_2657(AM933172|pid:none) Salmonella enterica subsp. ente...   313   2e-83
CP001277_11(CP001277|pid:none) Candidatus Hamiltonella defensa 5...   313   2e-83
(Q8PLQ0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   2e-83
EF106972_77(EF106972|pid:none) Uncultured marine Nitrospinaceae ...   313   2e-83
CP001472_1874(CP001472|pid:none) Acidobacterium capsulatum ATCC ...   313   2e-83
(A8ANQ1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   2e-83
(A3QC89) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   313   2e-83
(A4SZL8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   2e-83
(A8ZY67) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   2e-83
(Q4FRQ0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   2e-83
(A7H4N3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   2e-83
(A7MJ41) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   3e-83
(A8FSV6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   3e-83
(A9KG28) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   312   3e-83
(A3D783) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   311   4e-83
CP001252_1218(CP001252|pid:none) Shewanella baltica OS223, compl...   311   4e-83
EF531339_152(EF531339|pid:none) Candidatus Chloracidobacterium t...   311   4e-83
(A1WIG8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   311   6e-83
(Q8P9X0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   311   6e-83
(A1JK09) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   311   7e-83
(A1TZ92) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   311   7e-83
(Q5X4B7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   311   7e-83
(A6WR16) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   9e-83
(Q5E7G5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   9e-83
(Q0HXF8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   9e-83
CP001139_521(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ...   310   9e-83
(Q0HL60) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   9e-83
(A0KU94) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   9e-83
(A6Q576) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   1e-82
(A1VQK2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   1e-82
(Q14HB9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   2e-82
(B2SH99) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   2e-82
CP001364_4065(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp...   310   2e-82
(A9WCR2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   2e-82
(Q9JYG6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   310   2e-82
FM178379_635(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c...   309   2e-82
AP010904_4329(AP010904|pid:none) Desulfovibrio magneticus RS-1 D...   308   4e-82
(A0Q604) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   308   5e-82
(A1RHG5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   308   5e-82
(Q129G8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   308   6e-82
CP001050_251(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,...   308   6e-82
CP000381_1438(CP000381|pid:none) Neisseria meningitidis 053442, ...   307   8e-82
CP001600_3118(CP001600|pid:none) Edwardsiella ictaluri 93-146, c...   307   8e-82
AE003849_124(AE003849|pid:none) Xylella fastidiosa 9a5c, complet...   307   8e-82
(Q82TF8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   307   1e-81
(Q1I6Z8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   307   1e-81
(B0U1K9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   307   1e-81
(Q8EBS1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   307   1e-81
(A7GZA4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   306   1e-81
(Q9JTG4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   306   1e-81
(Q1H3U9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   306   1e-81
(A1KV20) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   306   2e-81
(B0UTE1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   306   2e-81
CP001616_2692(CP001616|pid:none) Tolumonas auensis DSM 9187, com...   306   2e-81
(Q7W6N4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   306   2e-81
CP001321_427(CP001321|pid:none) Haemophilus parasuis SH0165, com...   306   2e-81
(A5UDR0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   3e-81
(Q65VQ5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   3e-81
(B3H177) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   3e-81
(A1W7D0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   3e-81
CU914168_2218(CU914168|pid:none) Ralstonia solanacearum strain I...   305   4e-81
(A0RPR0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   4e-81
(Q6D1T0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   4e-81
(A3N018) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   4e-81
CP001068_728(CP001068|pid:none) Ralstonia pickettii 12J chromoso...   305   4e-81
(A6W1F1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   5e-81
(Q7WHL6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   305   5e-81
CU861906_798(CU861906|pid:none) Ralstonia solanacearum strain Mo...   304   9e-81
(Q0VNK2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   304   9e-81
CP001196_1415(CP001196|pid:none) Oligotropha carboxidovorans OM5...   304   9e-81
AM286690_1798(AM286690|pid:none) Alcanivorax borkumensis SK2, co...   304   9e-81
CP001635_3131(CP001635|pid:none) Variovorax paradoxus S110 chrom...   303   1e-80
(Q2SBT9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   303   1e-80
(P43815) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   303   2e-80
(A6VKD6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   303   2e-80
(Q821R2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   303   2e-80
(Q885J0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   302   3e-80
(A6Q747) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   302   3e-80
(Q2KY72) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   302   3e-80
(A1AXE0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   302   3e-80
(Q8UE87) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   301   4e-80
(Q67MV8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   301   4e-80
(Q4ZQI4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   301   4e-80
F97585(F97585)alanyl-tRNA synthetase RNA ligase) (ALars)  (ALani...   301   4e-80
J01581_1(J01581|pid:none) E. coli alaS gene coding for alanyl-tR...   301   8e-80
(A9FRF5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   1e-79
CP000153_1890(CP000153|pid:none) Sulfurimonas denitrificans DSM ...   300   1e-79
(B2JK72) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   1e-79
(Q2SV73) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   1e-79
(A5W0D9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   2e-79
(Q4K843) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   2e-79
CP000926_3953(CP000926|pid:none) Pseudomonas putida GB-1, comple...   300   2e-79
(A1V3F2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   2e-79
(A3N8K7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   2e-79
CP000712_1422(CP000712|pid:none) Pseudomonas putida F1, complete...   300   2e-79
CP001408_1666(CP001408|pid:none) Burkholderia pseudomallei MSHR3...   300   2e-79
CP001131_3807(CP001131|pid:none) Anaeromyxobacter sp. K, complet...   300   2e-79
(Q62KZ3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   2e-79
(B0KR43) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   300   2e-79
(Q13W97) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   2e-79
(A9VI09) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   2e-79
(B1YNJ6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   2e-79
CP000680_2883(CP000680|pid:none) Pseudomonas mendocina ymp, comp...   299   2e-79
CP000949_3739(CP000949|pid:none) Pseudomonas putida W619, comple...   299   3e-79
(B1JCG9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(Q817Z0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(A4VJB3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(Q634F6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(P61697) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(A0RJ00) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
CP001176_4343(CP001176|pid:none) Bacillus cereus B4264, complete...   299   3e-79
(Q81LK0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(Q6HDD7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   299   3e-79
(A5VQX4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   298   4e-79
CP001098_569(CP001098|pid:none) Halothermothrix orenii H 168, co...   298   4e-79
(A4XWE2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   298   4e-79
(A3M3W2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   298   5e-79
(B0B8X5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   298   5e-79
CP001389_1607(CP001389|pid:none) Rhizobium sp. NGR234, complete ...   298   5e-79
CP000863_1154(CP000863|pid:none) Acinetobacter baumannii ACICU, ...   298   5e-79
E71476(E71476)alanine-tRNA ligase (EC 6.1.1.7) - Chlamydia trach...   298   6e-79
CP001130_1527(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c...   298   6e-79
(O84754) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   298   6e-79
(A5EW88) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   298   6e-79
(A0K6N4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   297   8e-79
CP001016_2357(CP001016|pid:none) Beijerinckia indica subsp. indi...   297   8e-79
(B1K026) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   297   8e-79
(B2IHX3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   297   8e-79
CP000151_1366(CP000151|pid:none) Burkholderia sp. 383 chromosome...   297   8e-79
(A6X0E9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   297   1e-78
(B2SZN0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   296   1e-78
(A1USS4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   296   2e-78
CP000934_1326(CP000934|pid:none) Cellvibrio japonicus Ueda107, c...   296   2e-78
(Q4FMX6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   296   2e-78
AM999887_666(AM999887|pid:none) Wolbachia endosymbiont of Culex ...   296   2e-78
CP001510_2510(CP001510|pid:none) Methylobacterium extorquens AM1...   295   3e-78
(A9W5Y4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   295   3e-78
CP000378_920(CP000378|pid:none) Burkholderia cenocepacia AU 1054...   295   3e-78
(A9AC16) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   295   5e-78
CP000613_878(CP000613|pid:none) Rhodospirillum centenum SW, comp...   295   5e-78
(Q28QV8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   295   5e-78
(P70865) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   7e-78
(A4YXQ6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   7e-78
(Q1LQ59) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   9e-78
(A5EML9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   9e-78
(A6VA71) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   9e-78
(A8GQ73) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   9e-78
(Q487H5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   294   9e-78
(Q9A5C1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   1e-77
CU633749_2204(CU633749|pid:none) Cupriavidus taiwanensis str. LM...   293   1e-77
CP001562_1136(CP001562|pid:none) Bartonella grahamii as4aup, com...   293   2e-77
CP000319_1538(CP000319|pid:none) Nitrobacter hamburgensis X14, c...   293   2e-77
(Q1QMV7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(Q2IG40) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(Q6FCT2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(Q7NXM2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(A9IVY8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(A8LL20) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(Q2G8V0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   293   2e-77
(Q6G2Z4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   292   3e-77
CP000390_1257(CP000390|pid:none) Mesorhizobium sp. BNC1, complet...   292   3e-77
(Q5LRU1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   292   3e-77
(Q0K823) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   291   5e-77
CP000774_2565(CP000774|pid:none) Parvibaculum lavamentivorans DS...   291   8e-77
(Q8RFJ8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   291   8e-77
(Q9KDE6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   291   8e-77
CP000922_739(CP000922|pid:none) Anoxybacillus flavithermus WK1, ...   290   1e-76
CP000394_1369(CP000394|pid:none) Granulibacter bethesdensis CGDN...   290   1e-76
CP000628_1968(CP000628|pid:none) Agrobacterium radiobacter K84 c...   290   1e-76
CP001391_693(CP001391|pid:none) Wolbachia sp. wRi, complete geno...   290   1e-76
CP000377_1232(CP000377|pid:none) Silicibacter sp. TM1040, comple...   290   1e-76
(Q1GHA1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   290   1e-76
(A5CVU0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   290   1e-76
(Q0BSD5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   290   2e-76
CP001349_5297(CP001349|pid:none) Methylobacterium nodulans ORS 2...   290   2e-76
(A8ICW8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   289   2e-76
CP000683_960(CP000683|pid:none) Rickettsia massiliae MTU5, compl...   289   2e-76
(A4G2S9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   289   2e-76
(Q2N9K5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   289   3e-76
(Q3J0R1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   289   3e-76
(A8F323) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   288   4e-76
(Q3ST43) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   288   4e-76
(B1YJE5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   288   4e-76
(A8GU16) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   288   5e-76
CP001344_453(CP001344|pid:none) Cyanothece sp. PCC 7425, complet...   288   7e-76
(Q5N4B5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   288   7e-76
CP001227_897(CP001227|pid:none) Rickettsia peacockii str. Rustic...   288   7e-76
CP000100_874(CP000100|pid:none) Synechococcus elongatus PCC 7942...   288   7e-76
(A8F078) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   287   9e-76
(Q0AQY6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   287   9e-76
(Q5KWU5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   287   1e-75
(Q6FZF1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   287   1e-75
(Q92G00) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   1e-75
AC115598_31(AC115598|pid:none) Dictyostelium discoideum chromoso...   286   1e-75
CP001612_994(CP001612|pid:none) Rickettsia africae ESF-5, comple...   286   1e-75
(A8F866) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   1e-75
(A8EWI6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   1e-75
(Q165U5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   1e-75
CP001158_369(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A...   286   3e-75
(P57483) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   3e-75
(Q2RQI0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   3e-75
CP001161_371(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy...   286   3e-75
(Q1QZX1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   286   3e-75
(Q24UT2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   285   3e-75
CP001291_880(CP001291|pid:none) Cyanothece sp. PCC 7424, complet...   285   3e-75
(A7IMR0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   285   3e-75
(Q8EPS9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   285   4e-75
(Q65GS5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   285   4e-75
AF179611_8(AF179611|pid:none) Zymomonas mobilis ZM4 fosmid clone...   285   6e-75
(Q493M6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   284   1e-74
(A4IR80) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   284   1e-74
(A5V3L0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   284   1e-74
CP000557_2447(CP000557|pid:none) Geobacillus thermodenitrificans...   284   1e-74
(B0JI84) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   283   1e-74
(P74423) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   283   2e-74
(B0CFX4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   283   2e-74
AM778956_70(AM778956|pid:none) Microcystis aeruginosa PCC 7806 g...   283   2e-74
(Q7VQG3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   282   4e-74
(B1WYQ5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   281   5e-74
(Q7NI36) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   281   5e-74
(Q2K7T4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   281   5e-74
(Q835J8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   281   6e-74
(Q9X1B6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   281   8e-74
CT573072_132(CT573072|pid:none) Kuenenia stuttgartiensis genome ...   281   8e-74
CP001287_1373(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...   281   8e-74
(Q89I89) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   280   1e-73
CP001079_147(CP001079|pid:none) Anaplasma marginale str. Florida...   279   2e-73
(Q2ITM9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   279   2e-73
(Q3MGN4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   279   3e-73
(Q1CS22) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   4e-73
CP000916_1195(CP000916|pid:none) Thermotoga neapolitana DSM 4359...   278   4e-73
(Q92BK9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   4e-73
(A0AIV3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   4e-73
(Q8Y722) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   5e-73
(Q71ZG6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   5e-73
CP001217_1200(CP001217|pid:none) Helicobacter pylori P12, comple...   278   5e-73
(B1LBS9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   5e-73
(Q5FQ21) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   7e-73
(Q1WT32) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   7e-73
(Q8YUD4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   7e-73
(Q98NQ5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   278   7e-73
(A5IMH8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   277   1e-72
(B1XP68) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   277   1e-72
EF650316_1(EF650316|pid:none) Stichopogon trifasciatus alanyl-tR...   277   1e-72
(Q10VG8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   276   2e-72
(Q17ZF3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   276   2e-72
AB005243_3(AB005243|pid:none) Arabidopsis thaliana genomic DNA, ...   276   3e-72
AX366209_1(AX366209|pid:none) Sequence 3 from Patent WO0200696. ...   276   3e-72
EF650315_1(EF650315|pid:none) Stichopogon punctum alanyl-tRNA sy...   275   4e-72
(Q5HNT2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   275   4e-72
(Q2GEP2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   275   6e-72
AP009484_1260(AP009484|pid:none) Macrococcus caseolyticus JCSC54...   275   6e-72
(B2UV04) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   274   8e-72
(Q6GG85) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   274   8e-72
EF650296_1(EF650296|pid:none) Trichardis sp. TD-2008 alanyl-tRNA...   274   8e-72
(A5ITE3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   274   8e-72
BA000039_2102(BA000039|pid:none) Thermosynechococcus elongatus B...   274   8e-72
(A6QHF9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   274   8e-72
(Q2YT60) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   274   8e-72
(Q6G8V1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   274   8e-72
EF650307_1(EF650307|pid:none) Plesiomma sp. 'Guanacaste' alanyl-...   274   1e-71
EF650282_1(EF650282|pid:none) Diogmites grossus alanyl-tRNA synt...   273   1e-71
(B1IJG7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   273   2e-71
(A7GGF1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   273   2e-71
(Q2JLC4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   273   2e-71
EF650318_1(EF650318|pid:none) Damalis monochaetes alanyl-tRNA sy...   273   2e-71
EF650312_1(EF650312|pid:none) Willistonina bilineata alanyl-tRNA...   272   3e-71
EF650267_1(EF650267|pid:none) Mitrodetus dentitarsis alanyl-tRNA...   272   3e-71
EF650284_1(EF650284|pid:none) Molobratia teutonus alanyl-tRNA sy...   272   3e-71
(Q8D2W8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   272   3e-71
(Q048Z3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   272   4e-71
EF650298_1(EF650298|pid:none) Leptogaster arida alanyl-tRNA synt...   271   5e-71
EF650268_1(EF650268|pid:none) Opomydas townsendi alanyl-tRNA syn...   271   6e-71
EF650269_1(EF650269|pid:none) Mydas clavatus alanyl-tRNA synthet...   271   8e-71
EF650300_1(EF650300|pid:none) Emphysomera pallidapex alanyl-tRNA...   270   1e-70
EF650286_1(EF650286|pid:none) Saropogon luteus alanyl-tRNA synth...   270   1e-70
(Q7VHV4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   1e-70
(Q4A8G4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   1e-70
EU436058_1(EU436058|pid:none) Saltella nigripes voucher su40 ala...   270   1e-70
EF650281_1(EF650281|pid:none) Dasypogon diadema alanyl-tRNA synt...   270   1e-70
EF650303_1(EF650303|pid:none) Acnephalum cylindricum alanyl-tRNA...   270   1e-70
(Q7V3N0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   1e-70
CP000705_525(CP000705|pid:none) Lactobacillus reuteri DSM 20016,...   270   1e-70
EF650275_1(EF650275|pid:none) Asilus crabroniformis alanyl-tRNA ...   270   2e-70
(A5I4Z5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   2e-70
(Q5FLW6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   2e-70
(Q7V419) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   2e-70
(P61702) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   270   2e-70
EF650285_1(EF650285|pid:none) Pegesimallus laticornis alanyl-tRN...   269   2e-70
EF650304_1(EF650304|pid:none) Connomyia varipennis alanyl-tRNA s...   269   2e-70
(B1MXP8) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   269   3e-70
(Q9KXP9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   269   3e-70
EU410379_1(EU410379|pid:none) Ospriocerus aeacus voucher Asil-37...   269   3e-70
(Q7U3R9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   269   3e-70
CP001104_921(CP001104|pid:none) Eubacterium eligens ATCC 27750, ...   268   4e-70
EF650276_1(EF650276|pid:none) Asilus sericeus alanyl-tRNA synthe...   268   4e-70
EF650290_1(EF650290|pid:none) Choerades bella alanyl-tRNA synthe...   268   4e-70
(Q601M2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   268   4e-70
EF650277_1(EF650277|pid:none) Dysmachus trigonus alanyl-tRNA syn...   268   4e-70
(B1KXB7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   268   5e-70
EF650291_1(EF650291|pid:none) Lamyra gulo alanyl-tRNA synthetase...   268   5e-70
(A5N7T5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   268   5e-70
EF650272_1(EF650272|pid:none) Philodicus tenuipes alanyl-tRNA sy...   268   5e-70
(B1AJ08) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   268   5e-70
EF650311_1(EF650311|pid:none) Tillobroma punctipennis alanyl-tRN...   268   7e-70
(Q4AAD3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   267   9e-70
EF650294_1(EF650294|pid:none) Pilica formidolosa alanyl-tRNA syn...   267   9e-70
AM285311_39(AM285311|pid:none) Spiroplasma citri GII3-3X chromos...   267   9e-70
EF650280_1(EF650280|pid:none) Tolmerus atricapillus alanyl-tRNA ...   267   1e-69
EF650288_1(EF650288|pid:none) Atomosia puella alanyl-tRNA synthe...   267   1e-69
(Q97IG3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   266   2e-69
(A2CDK7) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   266   2e-69
EF650293_1(EF650293|pid:none) Nusa infumata alanyl-tRNA syntheta...   266   2e-69
EF650305_1(EF650305|pid:none) Gonioscelis ventralis alanyl-tRNA ...   266   2e-69
CP001184_358(CP001184|pid:none) Ureaplasma urealyticum serovar 1...   266   2e-69
EF650314_1(EF650314|pid:none) Lasiopogon cinctus alanyl-tRNA syn...   266   2e-69
(A8YTJ0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   266   2e-69
CP000554_2811(CP000554|pid:none) Prochlorococcus marinus str. MI...   266   2e-69
CP001634_1567(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c...   266   2e-69
EU436042_1(EU436042|pid:none) Dicranosepsis emiliae voucher su19...   266   2e-69
(Q0I6G6) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   266   2e-69
(Q3AGN4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   266   2e-69
CP001083_2682(CP001083|pid:none) Clostridium botulinum Ba4 str. ...   266   2e-69
EF650287_1(EF650287|pid:none) Dioctria atricapillus alanyl-tRNA ...   266   2e-69
(P59420) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   266   2e-69
EF650297_1(EF650297|pid:none) Lasiocnemus lugens alanyl-tRNA syn...   266   2e-69
(Q4L6W5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   265   5e-69
CP000587_214(CP000587|pid:none) Ostreococcus lucimarinus CCE9901...   265   5e-69
EF650271_1(EF650271|pid:none) Neolophonotus bimaculatus alanyl-t...   265   5e-69
Y08363_1(Y08363|pid:none) T.thermophilus alaS gene.                   265   6e-69
CR954253_1550(CR954253|pid:none) Lactobacillus delbrueckii subsp...   265   6e-69
(B0S104) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   264   8e-69
(Q2SSW4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   264   8e-69
(Q827S4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   264   1e-68
EF650274_1(EF650274|pid:none) Proctacanthus philadelphicus alany...   264   1e-68
EF650327_1(EF650327|pid:none) Neoitamus cyanurus alanyl-tRNA syn...   264   1e-68
(A8MGI3) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   264   1e-68
EU436085_1(EU436085|pid:none) Zuskamira inexpectata voucher su75...   264   1e-68
(Q04EQ9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   264   1e-68
(A3PA95) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   263   1e-68
FM177140_837(FM177140|pid:none) Lactobacillus casei BL23 complet...   263   2e-68
(A5GWM4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   263   2e-68
(Q03B02) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   263   2e-68
CT978603_2380(CT978603|pid:none) Synechococcus sp. RCC307 genomi...   263   2e-68
CP001393_1265(CP001393|pid:none) Anaerocellum thermophilum DSM 6...   262   3e-68
EU436050_1(EU436050|pid:none) Microsepsis armillata voucher su28...   262   3e-68
(A9B9E5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   262   3e-68
(A9BJE0) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   262   3e-68
EF650319_1(EF650319|pid:none) Holcocephala calva alanyl-tRNA syn...   262   4e-68
(B1W3I1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   261   5e-68
(Q31DD9) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   261   7e-68
EF650264_1(EF650264|pid:none) Bombylius major alanyl-tRNA synthe...   261   9e-68
(A2BNH2) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   261   9e-68
(Q4JVF5) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   260   1e-67
(B0K0Q1) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   260   1e-67
EU436044_1(EU436044|pid:none) Dicranosepsis javanica voucher su2...   260   1e-67
EU436027_1(EU436027|pid:none) Icaridion debile voucher su2 alany...   260   1e-67
(A4XKP4) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1...   259   2e-67

>(Q54Y20) RecName: Full=Alanyl-tRNA synthetase;          EC=6.1.1.7;
            AltName: Full=Alanine--tRNA ligase;          Short=AlaRS;
          Length = 946

 Score =  726 bits (1875), Expect = 0.0
 Identities = 378/492 (76%), Positives = 401/492 (81%), Gaps = 11/492 (2%)
 Frame = +3

Query: 75   MDVNQIRKTFIDFFREKCEHTFVPSSAVIPHDDPTLLFANAGMNQFKPIFLGQVNPKSEQ 254
            MDVNQIRKTFIDFFREKCEHTFVPSSAVIPHDDPTLLFANAGMNQFKPIFLGQVNPKSEQ
Sbjct: 1    MDVNQIRKTFIDFFREKCEHTFVPSSAVIPHDDPTLLFANAGMNQFKPIFLGQVNPKSEQ 60

Query: 255  AKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKEAITWAWELLT 434
            AKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKEAITWAWELLT
Sbjct: 61   AKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKEAITWAWELLT 120

Query: 435  EVYKLDKERLYVTYFRGDPEKGLEADLEAKNLWLQYLPEERVLPFGMKENFWEMGDQGPC 614
            EVYKLDKERLYVTYFRGDPEKGLEADLEAKNLWLQYLPEERVLPFGMKENFWEMGDQGPC
Sbjct: 121  EVYKLDKERLYVTYFRGDPEKGLEADLEAKNLWLQYLPEERVLPFGMKENFWEMGDQGPC 180

Query: 615  GPCSEIHYDKVEGRDGASFVNADDPTLIEIWNLVFIQYNREADKSLRPLPQKHVDTGMGL 794
            GPCSEIHYDKVEGRDGASFVNADDPTLIEIWNLVFIQYNREADKSLRPLPQKHVDTGMGL
Sbjct: 181  GPCSEIHYDKVEGRDGASFVNADDPTLIEIWNLVFIQYNREADKSLRPLPQKHVDTGMGL 240

Query: 795  ERLTSIIQKVPTNYDTDVFMPIFAAIQEVTGYPEPYGGKVGAEDTQQVDMAYRVIADHIR 974
            ERLTSIIQKVPTNYDTDVFMPIFAAIQEVTGYPEPYGGKVGAEDTQQVDMAYRVIADHIR
Sbjct: 241  ERLTSIIQKVPTNYDTDVFMPIFAAIQEVTGYPEPYGGKVGAEDTQQVDMAYRVIADHIR 300

Query: 975  TLTFSIADGAAPSVDGRGQVLRRILRRAVRYGKQKLNAPAGFFSKLVDVXXXXPEWANYS 1154
            TLTFSIADGAAPSVDGRGQVLRRILRRAVRYGKQKLNAPAGFFSKLVDV       AN+
Sbjct: 301  TLTFSIADGAAPSVDGRGQVLRRILRRAVRYGKQKLNAPAGFFSKLVDVVI-----ANFG 355

Query: 1155 IEFCGGTHLSNTKQAELFTITSEE-----TLGAGVRRIVAVTGSEAASAIELNKELEVRF 1319
              F     L    +     +T EE     TL  G+              +E  K ++
Sbjct: 356  EFF---PELRKKPEHIKMVLTREEDMFNKTLEKGI--------------VEFEKMIKKSV 398

Query: 1320 NNALKLSGSELAKEIVSL-LDLLKVVTISASVRMNL--VETLKEVQA-LQRKQVKEQ--E 1481
            NN L    +          +DL  ++    + ++++   E L E Q+ + RK+ KE+  E
Sbjct: 399  NNTLSAENAYFLSTCYGFPIDLTTIMAEEKNYKVDIKGYEGLCEAQSEIDRKRQKEKKVE 458

Query: 1482 TILAQQAQTYLE 1517
              L  +A  +L+
Sbjct: 459  LTLGAEANAWLK 470

 Score =  417 bits (1071), Expect = e-115
 Identities = 224/247 (90%), Positives = 224/247 (90%)
 Frame = +3

Query: 1134 PEWANYSIEFCGGTHLSNTKQAELFTITSEETLGAGVRRIVAVTGSEAASAIELNKELEV 1313
            PEWANYSIEFCGGTHLSNTKQAELFTITSEETLGAGVRRIVAVTGSEAASAIELNKELEV
Sbjct: 700  PEWANYSIEFCGGTHLSNTKQAELFTITSEETLGAGVRRIVAVTGSEAASAIELNKELEV 759

Query: 1314 RFNNALKLSGSELAKEIVSLLDLLKVVTISASVRMNLVETLKEVQALQRKQVKEQETILA 1493
            RFNNALKLSGSELAKEIVSLLDLLKVVTISASVRMNLVETLKEVQALQRKQVKEQETILA
Sbjct: 760  RFNNALKLSGSELAKEIVSLLDLLKVVTISASVRMNLVETLKEVQALQRKQVKEQETILA 819

Query: 1494 QQAQTYLEKTSEELAKSQPKVFVDLVNFNSNTPLITETIKKIQTKSPMTAIMLISPDEEK 1673
            QQAQTYLEKTSEELAKSQPKVFVDLVNFNSNTPLITETIKKIQTKSPMTAIMLISPDEEK
Sbjct: 820  QQAQTYLEKTSEELAKSQPKVFVDLVNFNSNTPLITETIKKIQTKSPMTAIMLISPDEEK 879

Query: 1674 GKVTCIGIVPKDSEISKTLTANAWXXXXXXXXXXXXXXXXXXXXXXXSKLDKIDEAILVS 1853
            GKVTCIGIVPKDSEISKTLTANAW                       SKLDKIDEAILVS
Sbjct: 880  GKVTCIGIVPKDSEISKTLTANAWVVKVTEVLGGKGGGKVDVAQGVGSKLDKIDEAILVS 939

Query: 1854 REFANAN 1874
            REFANAN
Sbjct: 940  REFANAN 946

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 3,125,233,732
Number of extensions: 64686686
Number of successful extensions: 169150
Number of sequences better than 10.0: 771
Number of HSP's gapped: 166174
Number of HSP's successfully gapped: 1375
Length of query: 656
Length of database: 1,051,180,864
Length adjustment: 135
Effective length of query: 521
Effective length of database: 614,245,399
Effective search space: 320021852879
Effective search space used: 320021852879
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
PSORT 

 psg: 0.75  gvh: 0.42  alm: 0.31  top: 0.67  tms: 0.07  mit: 0.16  mip: 0.00
 nuc: 0.08  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 1.00  tyr: 0.00  leu: 0.06  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 1.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 0.00 

	 48.0 %: nuclear
	 28.0 %: cytoplasmic
	 12.0 %: mitochondrial
	  8.0 %: Golgi
	  4.0 %: vesicles of secretory system

>> prediction for Contig-U15693-1 is nuc
VS (DIR, S) 0
VH (FL, L) 7
VF (FL, S) 0
AH (FL, L) 8
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 11
SF (FL, S) 0
CH (FL, L) 2
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 2
FC-IC (SUB) 0