| Contig-U15634-1 |
| Contig ID |
Contig-U15634-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1540 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
1683877 |
| End point |
1685418 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
12 |
| Number of EST |
17 |
| Link to clone list |
U15634 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 2. 3 |
| Homology vs DNA |
Query= Contig-U15634-1 (Contig-U15634-1Q) /CSM_Contig/Contig-U15634-1Q.Seq.d
(1550 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ344868) Dictyostelium discoideum cDNA clone:dda20c20, 3' ... 1172 0.0 3
(C24346) Dictyostelium discoideum gamete cDNA, clone FC-AV16. 1168 0.0 1
(BJ343779) Dictyostelium discoideum cDNA clone:dda17m01, 3' ... 1136 0.0 1
(BJ347344) Dictyostelium discoideum cDNA clone:dda26g24, 3' ... 1094 0.0 1
(BJ376507) Dictyostelium discoideum cDNA clone:ddc28g20, 3' ... 1082 0.0 1
(BJ430725) Dictyostelium discoideum cDNA clone:ddv8a13, 3' e... 908 0.0 2
(BJ327523) Dictyostelium discoideum cDNA clone:dda20c20, 5' ... 948 0.0 2
(AU053360) Dictyostelium discoideum slug cDNA, clone SLI459. 634 0.0 2
(BJ389928) Dictyostelium discoideum cDNA clone:dds20h15, 5' ... 749 0.0 3
(BJ412441) Dictyostelium discoideum cDNA clone:ddv8a13, 5' e... 702 0.0 2
(BJ428076) Dictyostelium discoideum cDNA clone:ddv10m16, 3' ... 472 0.0 4
(BJ324726) Dictyostelium discoideum cDNA clone:dda7m18, 5' e... 595 e-165 1
(BJ409952) Dictyostelium discoideum cDNA clone:ddv10m16, 5' ... 549 e-155 2
(BJ363853) Dictyostelium discoideum cDNA clone:ddc28g20, 5' ... 549 e-155 2
(AU062224) Dictyostelium discoideum slug cDNA, clone SLI459. 432 e-116 1
(BJ324848) Dictyostelium discoideum cDNA clone:dda8j07, 5' e... 355 3e-93 1
(AU053678) Dictyostelium discoideum slug cDNA, clone SLJ388. 291 7e-88 2
(EF147279) Populus trichocarpa clone WS0122_D02 unknown mRNA. 74 8e-32 4
(AY568070) Naegleria gruberi strain NEG-M prolyl-tRNA synthe... 88 3e-23 6
(AJ768876) Populus euphratica EST, clone P0000100022G07F1. 74 2e-19 2
(DL173483) Methods for Identifying the Target of a Compound ... 52 3e-18 6
(AX489043) Sequence 6343 from Patent WO02053728. 52 3e-18 6
(BJ411811) Dictyostelium discoideum cDNA clone:ddv5l22, 5' e... 105 5e-18 1
(CT739703) Paramecium tetraurelia 5-PRIME EST from clone LK0... 58 3e-17 4
(CK107068) UB45DPE04.5pR Populus active cambium cDNA library... 74 4e-17 2
(CA824411) R41F07 two-month-old roots from clone 'Beaupre' P... 74 5e-17 2
(DT471819) WS0122.BR_D02 PT-GT-FL-A-3 Populus trichocarpa cD... 74 5e-17 2
(DB877651) Populus nigra mRNA, clone: PnFL2-017_I09, 5'end. 74 6e-17 2
(DT492073) WS02549.C21_J11 PT-MB-N-A-15 Populus trichocarpa ... 74 7e-17 2
(DT473935) WS01230.BR_D10 PT-GT-FL-A-3 Populus trichocarpa c... 74 7e-17 2
(CT777671) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 2e-16 5
(FE239967) CAPG5623.fwd CAPG Naegleria gruberi amoeba stage ... 88 3e-16 4
(FE234063) CAPG2619.fwd CAPG Naegleria gruberi amoeba stage ... 88 5e-16 2
(FE234226) CAPG2706.fwd CAPG Naegleria gruberi amoeba stage ... 88 5e-16 2
(FE239713) CAPG5501.fwd CAPG Naegleria gruberi amoeba stage ... 88 5e-16 2
(CT810488) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 6e-16 3
(CN926464) 000501AEPA001748HT (AEPA) Pinkie expanding leaf M... 58 6e-16 4
(CT791716) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 7e-16 3
(BU812071) UL91TH08 Populus leaf cDNA library Populus tremul... 70 8e-16 2
(EY681608) CS00-C1-650-023-H05-CT.F Sweet orange leaf, young... 54 1e-15 4
(FD456762) EGGB979TR Haematobia irritans eggs Haematobia irr... 50 3e-15 4
(EX273797) 1454380_5_K10_037 PY06 Carica papaya cDNA, mRNA s... 54 3e-15 4
(AR548933) Sequence 4064 from patent US 6747137. 52 4e-15 5
(EY680769) CS00-C1-650-014-F09-CT.F Sweet orange leaf, young... 54 4e-15 4
(CN938138) 010615AVBC002344HT (AVBC) Royal Gala young shoot ... 64 4e-15 4
(CN890016) 010617AAWA008714HT (AAWA) Royal Gala 59 DAFB seed... 64 5e-15 4
(CV885894) UCRCS04_2_01G03_T3 Ruby Orange Developing Flower ... 54 5e-15 4
(CV887314) UCRCS04_2_030E10_T3 Ruby Orange Developing Flower... 54 5e-15 4
(EY783050) CR05-C1-103-096-H04-CT.F Mandarin leaf, infected ... 54 5e-15 4
(CV825793) Mdlv4-4041o22.y1 Mdlv4 Malus x domestica cDNA clo... 64 8e-15 4
(CN931533) 000427AFBC005890HT (AFBC) Royal Gala pre-opened f... 64 8e-15 4
(CN938128) 010615AVBC002331HT (AVBC) Royal Gala young shoot ... 64 8e-15 4
(CN883243) 010813AASB004909HT (AASB) Royal Gala 10 DAFB frui... 64 8e-15 4
(DY287257) IC0AAA67BD05RM1 CitNFL Citrus clementina cDNA 5',... 54 9e-15 4
(CN907339) 020613ABKA001657HT (ABKA) Royal Gala temperature ... 64 1e-14 4
(CU568009) Theobroma cacao, mRNA sequence (KZ0ACAD1YL03FM1). 76 5e-14 2
(CU517661) Theobroma cacao, mRNA sequence (KZ0ABH12YJ24FM1). 76 5e-14 2
(CN930929) 000426AFBC003370HT (AFBC) Royal Gala pre-opened f... 64 3e-13 3
(CN929471) 000321AFBC001036HT (AFBC) Royal Gala pre-opened f... 64 3e-13 3
(DR991909) Mdlr7009K20.g1 Apple_EST_Mdlr Malus x domestica c... 58 3e-13 4
(CN863566) 000919AALA005070HT (AALA) Royal Gala 150 DAFB fru... 64 4e-13 3
(DT000139) Mdlr7001G01.g1 Apple_EST_Mdlr Malus x domestica c... 58 5e-13 4
(CT774502) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 5e-13 6
(EY714691) CS00-C3-702-045-E06-CT.F Sweet orange fruit, deve... 46 1e-12 4
(EC755644) PPE00009879 Agencourt Biosciences Agen-0020 Non-n... 66 1e-12 4
(EC757836) PPE00008054 Agencourt Biosciences Agen-0020 Non-n... 66 2e-12 4
(EC758873) PPE00006126 Agencourt Biosciences Agen-0020 Non-n... 66 2e-12 4
(DB878706) Populus nigra mRNA, clone: PnFL2-023_O12, 5'end. 74 2e-12 2
(EC854952) HDE00004135 Hyperamoeba dachnaya Non-normalized (... 76 4e-12 3
(EL565824) Physarum06311 Physarum polycephalum starvation st... 66 4e-12 4
(AK287030) Glycine max cDNA, clone: GMFL01-42-H07. 50 9e-12 4
(CV986308) Mdlv3_4038k14.y1 Mdlv3 Malus x domestica cDNA clo... 58 3e-11 3
(CV628792) Mdst6012a12.y1 Mdst Malus x domestica cDNA clone ... 50 3e-11 4
(FD440272) Atr02b_104_D02_C011.g1 FGP Female Amborella trich... 66 4e-11 3
(CK762938) atr02-3ms2-e05 Atr02 Amborella trichopoda cDNA cl... 66 5e-11 3
(CT782162) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 6e-11 4
(CT765144) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 6e-11 4
(CT799822) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 6e-11 4
(EY680814) CS00-C1-650-015-B10-CT.F Sweet orange leaf, young... 54 8e-11 3
(CV082569) Mdst6001h15.y1 Mdst Malus x domestica cDNA clone ... 50 9e-11 4
(FD464693) LARW722TR Haematobia irritans 1st Instar Larvae H... 50 1e-10 3
(FC816510) Sr_pAMT7_06f05_T7 S. ratti mixed stage pAMP Stron... 60 1e-10 4
(EB018023) LedoSEQ9590 Lentinula edodes pBluescript (EcoRI-X... 56 2e-10 2
(BP950322) Bruguiera gymnorhiza mRNA, clone: Bg05-09_C16, 5'... 58 4e-10 2
(BP941421) Bruguiera gymnorhiza mRNA, clone: Bg02-05_G15, 5'... 58 4e-10 2
(DY644761) PU3_plate43_G06 PU3 Prunus persica cDNA similar t... 48 5e-10 3
(EY702350) CS00-C3-701-006-A08-CT.F Sweet orange fruit, deve... 46 5e-10 4
(DY647968) PU4_plate21_P05 PU4 Prunus persica cDNA similar t... 48 6e-10 3
(EC756583) PPE00008621 Agencourt Biosciences Agen-0020 Non-n... 66 6e-10 3
(DB997675) Quercus mongolica subsp. crispula mRNA, clone: Qm... 48 6e-10 3
(DJ209513) Method for identification of useful proteins deri... 56 7e-10 4
(DY259837) KN0AAP10YF19FM1 Fruit-TF Citrus clementina cDNA 5... 50 1e-09 3
(EG658121) RCLEP83TP Castor bean cDNA library from leaves, 1... 58 3e-09 3
(EL386212) CFFM23631.b1_M04.ab1 CFF(LMS) safflower Carthamus... 52 3e-09 2
(EL391247) CFFM28375.b1_N14.ab1 CFF(LMS) safflower Carthamus... 52 3e-09 2
(EL382352) CFFM19716.b1_H09.ab1 CFF(LMS) safflower Carthamus... 52 3e-09 2
(EL386727) CFFM2411.b1_F03.ab1 CFF(LMS) safflower Carthamus ... 52 3e-09 2
(EG661639) RCLFR88TP Castor bean cDNA library from leaves, 1... 58 3e-09 3
(EG661991) RCLFV50TP Castor bean cDNA library from leaves, 1... 58 4e-09 3
(BI501342) kx31a08.y1 Parastrongyloides trichosuri PA pAMP1 ... 64 5e-09 3
(FE238338) CAPG4806.fwd CAPG Naegleria gruberi amoeba stage ... 64 6e-09 2
(FE247021) CAPG9729.fwd CAPG Naegleria gruberi amoeba stage ... 64 6e-09 2
(AL396639) T3 end of clone AR0AA031F05 of library AR0AA from... 56 1e-08 2
(CV046269) EST 7976 Green Apricot Fruit Lambda Zap II Librar... 46 1e-08 3
(DC889235) Citrus unshiu mRNA, clone: FBI1190, 5'-end sequen... 46 2e-08 4
(CT823415) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 2e-08 1
(CT813511) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 2e-08 1
(CT804893) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 2e-08 1
(CT795216) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 2e-08 1
(CT792323) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 2e-08 1
(CT768699) Paramecium tetraurelia 5-PRIME EST from clone LK0... 74 2e-08 1
(BU822923) UB45DPE04 Populus tremula cambium cDNA library Po... 74 2e-08 1
(AY104927) Zea mays PCO113544 mRNA sequence. 40 2e-08 4
(AR164429) Sequence 25 from patent US 6271441. 40 2e-08 4
(CS800603) Sequence 63 from Patent WO2007092704. 40 2e-08 4
(BP919940) Adiantum capillus-veneris mRNA, clone: YMU001_000... 64 3e-08 2
(CT795285) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 3e-08 4
(EC765538) EST 2034 Guarana fruits cDNA library Paullinia cu... 50 4e-08 3
(DY893330) CeleSEQ12639 Cunninghamella elegans pBluescript (... 72 7e-08 1
(CO870190) 3017HAEMUN28B11 BgORESTES unexposed NHM 3017 Haem... 72 7e-08 1
(AK286175) Glycine max cDNA, clone: GMFL01-23-D21. 50 7e-08 3
(AX829564) Sequence 284 from Patent WO03072602. 48 9e-08 4
(AX818534) Sequence 284 from Patent EP1338608. 48 9e-08 4
(AX594754) Sequence 408 from Patent EP1258494. 48 9e-08 4
(EF058392) Synthetic construct Saccharomyces cerevisiae clon... 48 9e-08 4
(CO754199) Mdfrt3050a13.y1 Mdfrt Malus x domestica cDNA clon... 58 1e-07 3
(FF095994) CPAD-aac44a05.b1 PB2801_EST_CPAD1 Caenorhabditis ... 48 1e-07 3
(DY036955) aof02-12ms1-e13 Aof02 Asparagus officinalis cDNA ... 56 1e-07 3
(FD764636) Zfi02b_1_D12_C017.b1 cDNA library derived from fe... 46 1e-07 3
(FF083560) CPAD-aaa11a09.b1 PB2801_EST_CPAD1 Caenorhabditis ... 48 1e-07 3
(FE405875) CBTT3664.fwd CBTT_Daphnia_pulex_Chosen_One_Librar... 44 2e-07 3
(CN873743) 001206AARA002269HT (AARA) Royal Gala partially se... 58 2e-07 3
(DJ130483) Method for identification of useful proteins deri... 48 2e-07 5
(AY568069) Entamoeba terrapinae strain M prolyl-tRNA synthet... 44 3e-07 4
(AW694618) NF078B10ST1F1080 Developing stem Medicago truncat... 56 4e-07 3
(BF645128) NF028E11EC1F1086 Elicited cell culture Medicago t... 56 5e-07 3
(FG497603) 030415KAWC009346HT (KAWC) Actinidia chinensis - a... 48 5e-07 2
(EH715649) CNML1971.b1_E13.ab1 CNM(LMS) spotted knapweed Cen... 50 5e-07 2
(EV258512) MTYDL21TF JCVI-MT1 Medicago truncatula cDNA 5', m... 56 5e-07 3
(EV258724) MTYDN66TF JCVI-MT1 Medicago truncatula cDNA 5', m... 56 6e-07 3
(EH716222) CNML2550.b1_K14.ab1 CNM(LMS) spotted knapweed Cen... 50 6e-07 2
(EL387976) CFFM25310.b1_L16.ab1 CFF(LMS) safflower Carthamus... 52 6e-07 2
(EH720098) CNML6548.b1_G05.ab1 CNM(LMS) spotted knapweed Cen... 52 6e-07 2
(EL451036) CHTM3987.b2_F13.ab1 CHT(LMS) Jerusalem artichoke ... 40 8e-07 3
(DN943468) L3_67_L_TC_P5-G10-SP6.ab1 1 480 cv. 9621-94 infec... 54 1e-06 2
(DB923849) Manihot esculenta mRNA, clone: CAS01_011_I18, 5'end. 50 2e-06 2
(DB920728) Manihot esculenta mRNA, clone: CAS01_002_O11, 5'end. 50 2e-06 2
(AP004579) Lotus japonicus genomic DNA, chromosome 2, clone:... 50 2e-06 5
(DB998304) Quercus mongolica subsp. crispula mRNA, clone: Qm... 46 2e-06 2
(DB938827) Manihot esculenta mRNA, clone: CAS01_052_P06, 5'end. 50 2e-06 2
(DB934389) Manihot esculenta mRNA, clone: CAS01_040_J18, 5'end. 50 2e-06 2
(DW702211) EST025692 Trichophyton rubrum cDNA library 7 Tric... 48 2e-06 2
(EH719966) CNML6425.b1_A24.ab1 CNM(LMS) spotted knapweed Cen... 50 2e-06 2
(AP004967) Lotus japonicus genomic DNA, chromosome 1, clone:... 52 4e-06 2
(EC756528) PPE00010451 Agencourt Biosciences Agen-0020 Non-n... 66 4e-06 1
(EC754425) PPE00010816 Agencourt Biosciences Agen-0020 Non-n... 66 4e-06 1
(CT782749) Paramecium tetraurelia 3-PRIME EST from clone LK0... 66 4e-06 1
(AP004576) Lotus japonicus genomic DNA, chromosome 2, clone:... 50 4e-06 8
(AC175829) Medicago truncatula chromosome 7 BAC clone mth2-2... 56 5e-06 5
(AC005506) Plasmodium falciparum chromosome 12 clone PFYAC35... 48 5e-06 8
(CX530544) s13dNF43F08MJ064_247109 Methyl Jasmonate-Elicited... 56 5e-06 2
(CX533155) s13dNF0CE07MJ051_319473 Methyl Jasmonate-Elicited... 48 5e-06 3
(GE634692) LINN_XX_018_K12_LINN18.CR_K12 R. communis develop... 46 8e-06 3
(FC811919) Sr_pASP6_09c06_SP6 S. ratti mixed stage pAMP Stro... 60 9e-06 2
(EL393730) CFFM520.b1_P09.ab1 CFF(LMS) safflower Carthamus t... 52 9e-06 2
(FC811036) Sr_pASP6_06f05_SP6 S. ratti mixed stage pAMP Stro... 60 9e-06 2
(CK097263) UB45DPE04.3pR Populus active cambium cDNA library... 58 9e-06 2
(FD463215) LARVX96TR Haematobia irritans 1st Instar Larvae H... 50 1e-05 2
(FD464692) LARW722TF Haematobia irritans 1st Instar Larvae H... 50 1e-05 2
(FD460387) LARVF03TR Haematobia irritans 1st Instar Larvae H... 50 1e-05 2
(FD460386) LARVF03TF Haematobia irritans 1st Instar Larvae H... 50 1e-05 2
(FD456761) EGGB979TF Haematobia irritans eggs Haematobia irr... 50 1e-05 2
(FG470324) 020306KAKA008718HT (KAKA) Dormant kiwifruit buds ... 46 1e-05 2
(DY352625) ZO__Ec0004F15.r ZO__Ec Zingiber officinale cDNA c... 64 2e-05 1
(BP918210) Adiantum capillus-veneris mRNA, clone: YMU001_000... 64 2e-05 1
(CT813575) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-05 2
(FG469411) 020217KAKA006176HT (KAKA) Dormant kiwifruit buds ... 46 2e-05 2
(FG488542) 030114KAWC001811HT (KAWC) Actinidia chinensis - a... 50 2e-05 3
(ET074856) QM0AAB1BG11FM1 CCER1 Citrus clementina genomic cl... 50 2e-05 2
(FG465957) 011124KAKA001273HT (KAKA) Dormant kiwifruit buds ... 46 2e-05 2
(FG469837) 020304KAKA008141HT (KAKA) Dormant kiwifruit buds ... 46 3e-05 2
(FG466789) 011203KAKA002302HT (KAKA) Dormant kiwifruit buds ... 46 3e-05 2
(FG466105) 011124KAKA001444HT (KAKA) Dormant kiwifruit buds ... 46 3e-05 2
(FG495509) 030410KAWC007130HT (KAWC) Actinidia chinensis - a... 46 3e-05 2
(FG467942) 011204KAKA004444HT (KAKA) Dormant kiwifruit buds ... 46 3e-05 2
(AP006852) Candida albicans genomic DNA, chromosome 7, compl... 52 3e-05 13
(EH086969) PMEBB33TR Perkinsus marinus large insert cDNA lib... 42 3e-05 3
(CT773352) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 4e-05 3
(CR548612) Paramecium tetraurelia macronuclear largest chrom... 42 5e-05 2
(CN193232) PtdH679 hybrid poplar systemically wound-induced ... 60 5e-05 2
(EU233589) Paramysis arenosa isolate 1212arenosa glutamyl-pr... 62 7e-05 1
(EU233588) Paramysis arenosa isolate 1211arenosa glutamyl-pr... 62 7e-05 1
(EJ060188) 1095456059113 Global-Ocean-Sampling_GS-26-01-01-1... 52 7e-05 2
(EU233576) Hemimysis anomala isolate 1139hemi glutamyl-proly... 52 7e-05 2
(EU233575) Hemimysis anomala isolate 1043hemi glutamyl-proly... 52 7e-05 2
(CS730895) Sequence 825 from Patent WO2007095469. 34 7e-05 4
(CS730656) Sequence 586 from Patent WO2007095469. 34 7e-05 4
(BW624871) Lotus japonicus cDNA, clone: LjFL2-010-DA02, 5' e... 52 9e-05 2
(DC594326) Lotus japonicus mRNA, clone: GENr079h02, 5' end s... 52 9e-05 2
(DT766724) EST1200573 Aquilegia cDNA library Aquilegia formo... 40 1e-04 3
(U10399) Saccharomyces cerevisiae chromosome VIII cosmid 8082. 48 1e-04 4
(DW092619) CLPY3918.b1_K19.ab1 CLP(XYZ) lettuce perennis Lac... 44 1e-04 3
(EH760252) CNSL6370.b1_C10.ab1 CNS(LMS) yellow starthistle C... 44 1e-04 2
(EV274728) GLMC976TF JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 50 1e-04 2
(DT766725) EST1200574 Aquilegia cDNA library Aquilegia formo... 40 1e-04 3
(DR949319) EST1140858 Aquilegia cDNA library Aquilegia formo... 40 2e-04 3
(CT914203) Phaeodactylum tricornutum 5-PRIME EST from clone ... 50 2e-04 2
(CU638744) Podospora anserina genomic DNA chromosome 6, supe... 50 2e-04 2
(CU013532) M.truncatula DNA sequence from clone MTH2-45F3 on... 38 2e-04 6
(CU898415) Podospora anserina mRNA sequence from clone HH0AB... 50 2e-04 2
(CT816283) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 2e-04 2
(CT746701) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 3e-04 2
(CT784063) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 3e-04 2
(CT797073) Paramecium tetraurelia 5-PRIME EST from clone LK0... 42 3e-04 2
(EU233587) Paramysis bacescoi isolate 1203bacescoi glutamyl-... 50 3e-04 2
(EU233586) Paramysis bacescoi isolate 1202bacescoi glutamyl-... 50 3e-04 2
(CR940347) Theileria annulata genomic DNA chromosome 1 part 1. 60 3e-04 1
(CT581932) Pinus pinaster bud EST. 60 3e-04 1
(CT581575) Pinus pinaster bud EST. 60 3e-04 1
(CB983076) CAB70007_IaF_D11 Cabernet Sauvignon Berry Post-Ve... 46 3e-04 2
(CF610079) INFIO01_000917 Grape Inflorescence pSPORT1 Librar... 46 3e-04 2
(FF609739) G825P5148RH1.T0 Acorn worm normalized gastrula pE... 42 3e-04 3
(DN636923) ACAC-aab47f11.g1 Hydra EST UCI 7 Hydra magnipapil... 48 4e-04 2
(FC068351) sT7aVVM021I06023 VVM Vitis vinifera cDNA clone VV... 46 4e-04 2
(AE014846) Plasmodium falciparum 3D7 chromosome 12, section ... 48 4e-04 9
(CX835679) ACAC-aaa83a06.g1 Hydra EST UCI 7 Hydra magnipapil... 48 4e-04 2
(CB889920) taa63c03.x1 Hydra EST -III Hydra magnipapillata c... 48 4e-04 2
(CF200868) RR890915N0001_Ic_Fc_F05 Vitis sp. RR890915N Vitis... 46 4e-04 2
(FC807940) CBGC9328.fwd CBGC Lottia gigantea 15h 18h embryos... 46 4e-04 2
(DT597429) wmi03-4ms2-h11 Wmi03 Welwitschia mirabilis cDNA c... 42 4e-04 3
(CF203452) RR890915I00002_Ia_Fa_F07 Vitis sp. RR890915I Viti... 46 4e-04 2
(EE088090) S6B01450 Fruits 7-9 mm (VvS6) Vitis vinifera cDNA... 46 5e-04 2
(FC720255) CBBG13302.fwd CBBG Lottia gigantea 12,15,18h embr... 46 5e-04 2
(EE089272) S6B04381 Fruits 7-9 mm (VvS6) Vitis vinifera cDNA... 46 5e-04 2
(DW089200) CLPY13314.b1_C18.ab1 CLP(XYZ) lettuce perennis La... 42 5e-04 3
(EE089170) S6B04192 Fruits 7-9 mm (VvS6) Vitis vinifera cDNA... 46 5e-04 2
(EH765652) CNSM11668.b1_H13.ab1 CNS(LMS) yellow starthistle ... 44 5e-04 2
(EU233590) Schistomysis assimilis isolate 1208 glutamyl-prol... 40 5e-04 3
(CD064479) MA1-0038P-L031-F09-U.B MA1-0038 Schistosoma manso... 42 6e-04 3
(AC137702) Medicago truncatula clone mth2-7k10, complete seq... 38 7e-04 6
(AI975894) EST270488 Schistosoma mansoni female, Phil LoVerd... 42 9e-04 3
(EH083983) PMEAS13TR Perkinsus marinus large insert cDNA lib... 42 0.001 2
(EH079122) PMEC931TR Perkinsus marinus large insert cDNA lib... 42 0.001 2
(EU233574) Paramysis intermedia isolate 572interKhe glutamyl... 48 0.001 2
(EU233573) Paramysis intermedia isolate 496interDon glutamyl... 48 0.001 2
(EU233572) Paramysis intermedia isolate 360interAkh glutamyl... 48 0.001 2
(DW284726) UI-S-GU1-aeb-o-18-0-UI.s1 UI-S-GU1 Euprymna scolo... 58 0.001 1
(DW284518) UI-S-HH0-adz-i-18-0-UI.s1 UI-S-HH0 Euprymna scolo... 58 0.001 1
(DW274335) UI-S-GS1-acv-d-01-0-UI.s1 UI-S-GS1 Euprymna scolo... 58 0.001 1
(DW273797) UI-S-GS1-act-b-10-0-UI.s1 UI-S-GS1 Euprymna scolo... 58 0.001 1
(DW270957) UI-S-GS1-acj-j-06-0-UI.s1 UI-S-GS1 Euprymna scolo... 58 0.001 1
(DW263010) UI-S-GN0-abl-f-13-0-UI.s1 UI-S-GN0 Euprymna scolo... 58 0.001 1
(DW258873) UI-S-GG1-aba-j-12-0-UI.s1 UI-S-GG1 Euprymna scolo... 58 0.001 1
(DW257357) UI-S-GG0-aat-k-19-0-UI.s1 UI-S-GG0 Euprymna scolo... 58 0.001 1
(DW256786) UI-S-GB1-aap-n-09-0-UI.s1 UI-S-GB1 Euprymna scolo... 58 0.001 1
(DW256495) UI-S-GB1-aan-b-24-0-UI.s1 UI-S-GB1 Euprymna scolo... 58 0.001 1
(DW253553) UI-S-GB1-aae-h-24-0-UI.s1 UI-S-GB1 Euprymna scolo... 58 0.001 1
(DW252978) UI-S-GB1-aaf-f-14-0-UI.s1 UI-S-GB1 Euprymna scolo... 58 0.001 1
(BP951676) Bruguiera gymnorhiza mRNA, clone: Bg05-19_A02, 5'... 58 0.001 1
(EC134031) HVE00008706 Hartmannella vermiformis Normalized l... 40 0.001 3
(BM324106) PIC1_24_C06.b1_A002 Pathogen-infected compatible ... 48 0.001 2
(BM884687) rc13h09.y1 Meloidogyne hapla egg pAMP1 v1 Meloido... 42 0.001 2
(CW303166) 104_787_11465097_148_35670_037 Sorghum methylatio... 48 0.001 2
(U00037) Caenorhabditis elegans cosmid T20H4, complete seque... 46 0.001 4
(BQ543281) EST626908 TpMugugaSh01 Theileria parva cDNA clone... 46 0.001 2
(BI267587) NF112E03IN1F1023 Insect herbivory Medicago trunca... 56 0.001 2
(EC134396) HVE00011924 Hartmannella vermiformis Normalized l... 40 0.001 3
(DT715096) s13dFA51E03SD023_512400 Tall fescue, Festuca arun... 52 0.001 2
(EB995037) 7613640 CE04 Caenorhabditis elegans cDNA clone 27... 46 0.001 2
(DT710619) s13dFA53H10ST092_423035 Tall fescue, Festuca arun... 52 0.001 2
(CS731621) Sequence 1551 from Patent WO2007095469. 34 0.001 4
(EC134604) HVE00012378 Hartmannella vermiformis Normalized l... 40 0.001 3
(CL150396) 104_332_10778499_116_31358_051 Sorghum methylatio... 48 0.001 2
(CT984510) partial cDNA sequence from a Lambda ZAP II normal... 44 0.002 2
(FE706002) Pv044A_M13F_B04.ab1 Phaseolus vulgaris cv Early g... 50 0.002 2
(ES700290) ve_004a_a01 Lolium perenne ve Lolium perenne cDNA... 52 0.002 2
(AL392916) T7 end of clone AR0AA007G01 of library AR0AA from... 44 0.002 2
(CT987519) partial cDNA sequence from a Lambda ZAP II normal... 44 0.002 2
(FE706001) Pv044A_M13R_B04.ab1 Phaseolus vulgaris cv Early g... 50 0.002 2
(CS731403) Sequence 1333 from Patent WO2007095469. 34 0.002 4
(DW088580) CLPY12391.b1_N01.ab1 CLP(XYZ) lettuce perennis La... 42 0.002 2
(CV530083) ALV_012C_G03 Phaseolus vulgaris leaf EST library ... 50 0.002 2
(CR382135) Debaryomyces hansenii strain CBS767 chromosome C ... 40 0.003 2
(EW753958) sb_007_11A18_m13reverselong Onychiurus arcticus r... 38 0.003 3
(BE660976) 4-C12 GmaxSC Glycine max cDNA, mRNA sequence. 52 0.003 2
(DY582305) B013-F6 Acropora millepora prawn chip library B A... 40 0.004 2
(CT789663) Paramecium tetraurelia 5-PRIME EST from clone LK0... 38 0.004 2
(EL909717) INIT2_34_E05.b1_A006 G5 trophont cDNA (INIT2) Ich... 38 0.004 2
(EU233581) Limnomysis benedeni isolate 381LimnDam glutamyl-p... 56 0.004 1
(EU233580) Limnomysis benedeni isolate 380LimnDam glutamyl-p... 56 0.004 1
(EU233579) Limnomysis benedeni isolate 810limno glutamyl-pro... 56 0.004 1
(CG930673) MBELB24TR mth2 Medicago truncatula genomic clone ... 56 0.004 1
(DV633599) EST1102195 Dulce mature fruit library Cucumis mel... 56 0.004 1
(BY988303) Physcomitrella patens subsp. patens cDNA clone: P... 56 0.004 1
(BY985342) Physcomitrella patens subsp. patens cDNA clone: P... 56 0.004 1
(BY963521) Physcomitrella patens subsp. patens cDNA clone: P... 56 0.004 1
(BY952292) Physcomitrella patens subsp. patens cDNA clone: P... 56 0.004 1
(FC414588) CAYZ33200.fwd CAYZ Physcomitrella patens subsp. p... 56 0.004 1
(FC413924) CAYZ32816.fwd CAYZ Physcomitrella patens subsp. p... 56 0.004 1
(FC333955) CAYY15026.fwd CAYY Physcomitrella patens subsp. p... 56 0.004 1
(EC134496) HVE00012710 Hartmannella vermiformis Normalized l... 40 0.005 3
(DV154858) CV03096A2A09.f1 CV03-normalized library Euphorbia... 42 0.005 3
(CF099794) rd77g01.y1 Meloidogyne incognita parasitic adult ... 42 0.006 2
(FG894665) UCRVU08_CCNS13443_b1 Cowpea IT97K-461-4 Mixed Tis... 48 0.006 2
(FE730245) SB06002X1A12.f1 Normalized subtracted Keck-Tagu L... 40 0.006 3
(EI475873) PV_GBa0086F15.f PV_GBa Phaseolus vulgaris genomic... 48 0.006 2
(EI429204) PV_GBa0020I11.f PV_GBa Phaseolus vulgaris genomic... 48 0.006 2
(AK104881) Oryza sativa Japonica Group cDNA clone:001-044-H0... 40 0.006 4
(EI872947) CAH1-40F3TR CAA1Ba Cicer arietinum genomic clone ... 48 0.007 2
(AK069541) Oryza sativa Japonica Group cDNA clone:J023023E12... 40 0.007 4
(DT476615) WS01230.B21_D10 PT-GT-FL-A-3 Populus trichocarpa ... 48 0.008 2
(EY727631) CS00-C3-703-103-F08-CT.F Sweet orange fruit, deve... 42 0.008 2
(EK494647) 1095505151775 Global-Ocean-Sampling_GS-32-01-01-1... 38 0.013 2
(BG526218) 57-92 Stevia field grown leaf cDNA Stevia rebaudi... 44 0.014 2
(DN303687) PL05003B2B06 cDNA from sexually mature hermaphodi... 54 0.016 1
(DN291938) PL030009A10H10 cDNA from sexually mature hermapho... 54 0.016 1
(BQ589802) E012678-024-020-M19-SP6 MPIZ-ADIS-024-storage roo... 54 0.016 1
(GD998559) 454GmaGlobSeed741208 Soybean Seeds Containing Glo... 54 0.016 1
(EX302865) 1617913_5_M07_020 PY06 Carica papaya cDNA, mRNA s... 54 0.016 1
(EX296954) 1610994_5_L24_086 PY06 Carica papaya cDNA, mRNA s... 54 0.016 1
(AM180355) Clostridium difficile 630 complete genome. 54 0.016 1
(EL451035) CHTM3987.b1_F13.ab1 CHT(LMS) Jerusalem artichoke ... 40 0.018 2
(AJ763642) Gerbera hybrid cv. 'Terra Regina' EST, clone G000... 42 0.022 2
(DV612855) EST1215851 Glossina morsitans morsitans Fat body ... 38 0.031 3
(DV620075) EST1223071 Glossina morsitans morsitans Fat body ... 38 0.031 3
(FL030585) 3374710 CERES-264 Zea mays cDNA clone 645873 5', ... 42 0.038 2
(CD090080) MC1-0067T-M197-B02-U.G MC1-0067 Schistosoma manso... 42 0.043 3
(FF685202) RH_MEa0015dG01 RH_MEa blackberry emerging leaf Ru... 38 0.049 2
(FF636943) G825P582RE11.T0 Acorn worm normalized gastrula pE... 42 0.051 2
(FG517904) 030606KAZB006514HT (KAZB) Actinidia chinensis you... 48 0.052 2
(FP016157) Medicago truncatula chromosome 5 clone mth4-11o22... 44 0.061 4
(EK458167) 1095468708862 Global-Ocean-Sampling_GS-32-01-01-1... 52 0.064 1
(AG261149) Lotus japonicus DNA, clone:LjT52e24_sfi. 52 0.064 1
(EL394763) CFFM616.b1_O10.ab1 CFF(LMS) safflower Carthamus t... 52 0.064 1
(DB996616) Quercus mongolica subsp. crispula mRNA, clone: Qm... 52 0.064 1
(BP918319) Adiantum capillus-veneris mRNA, clone: YMU001_000... 52 0.064 1
(BI450703) kt73f10.y4 Strongyloides ratti L2 pAMP1 v1 Chiape... 52 0.064 1
(EX235339) PY01123X1H02.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(EX234109) PY01105X1H12.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(EX232141) PY01072X1F11.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(EX231631) PY01061X1C02.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(EX231436) PY01071X1F11.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(EX231165) PY01065X1E11.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(EX229067) PY01029X1H01.f1 PY01 Carica papaya cDNA, mRNA seq... 52 0.064 1
(CP001184) Ureaplasma urealyticum serovar 10 str. ATCC 33699... 52 0.064 1
(AW329489) N200732e rootphos(-) Medicago truncatula cDNA clo... 44 0.070 2
(CX534333) s13dNF0KD07MJ058_322423 Methyl Jasmonate-Elicited... 40 0.075 2
(CB891500) EST648469 KV3 Medicago truncatula cDNA clone KV3-... 40 0.077 2
(FG838749) UCRVU05_CCNN3004_b1 Cowpea IT84S-2049 Mixed Tissu... 50 0.079 2
(CS730611) Sequence 541 from Patent WO2007095469. 34 0.082 4
(CW159306) 104_565_11149289_148_36408_073 Sorghum methylatio... 42 0.082 2
(BZ337976) ia92b11.g1 WGS-SbicolorF (JM107 adapted methyl fi... 42 0.083 2
(BY801243) Thellungiella halophila cDNA clone: RTFL01-02-C11... 38 0.083 3
(DR949320) EST1140859 Aquilegia cDNA library Aquilegia formo... 40 0.088 2
(EX821261) CBNA7489.fwd CBNA Phycomyces blakesleeanus NRRL15... 50 0.088 2
(EE642443) CHEM2406.b1_L01.ab1 CHE(LMS) serpentine sunflower... 40 0.089 2
(FC817515) Sr_pAMT7_09c06_T7 S. ratti mixed stage pAMP Stron... 46 0.089 2
(DY617874) AC4074 NOLLY Medicago truncatula cDNA 5', mRNA se... 44 0.089 2
(CB344515) CA48EN0002_IVbF_D02 Cabernet Sauvignon Leaf-CA48E... 46 0.090 2
(GE754157) MUS16-O14.x1d-t SHGC-MUS Mytilus californianus cD... 50 0.091 2
(EE653145) CHES2377.b1_A19.ab1 CHE(LMS) serpentine sunflower... 40 0.093 2
(EX411693) GQ03611.B7_D16 GQ036 - Shoot tip - Active growth ... 38 0.094 2
(EL478649) CHUL7187.b1_E22.ab1 CHU(LMS) puzzle sunflower Hel... 40 0.094 2
(CG953415) MBECE72TR mth2 Medicago truncatula genomic clone ... 38 0.094 2
(EE606240) CHWL1187.b1_E09.ab1 CHW(LMS) silverleaf sunflower... 40 0.099 2
(CN125544) RHOH1_11_E11.g1_A002 Acid- and alkaline-treated r... 42 0.10 2
(EK279405) 1095462289687 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.11 3
(BY828510) Thellungiella halophila cDNA clone: RTFL01-42-J20... 38 0.13 3
(AW146749) 614083B12.y2 614 - root cDNA library from Walbot ... 40 0.17 2
(BY823776) Thellungiella halophila cDNA clone: RTFL01-35-K19... 38 0.17 3
(CU706047) Phaeodactylum tricornutum mRNA 5-prime sequence f... 36 0.17 3
(BQ294337) 1091028C08.y2 1091 - Immature ear with common EST... 40 0.18 2
(BY815317) Thellungiella halophila cDNA clone: RTFL01-23-A23... 38 0.19 3
(EH088270) PMEA552TR Perkinsus marinus large insert cDNA lib... 34 0.19 2
(EH085665) PMEB268TR Perkinsus marinus large insert cDNA lib... 34 0.19 2
(EH073665) PMDAY50TR Perkinsus marinus small insert cDNA lib... 34 0.19 2
(EH085851) PMEB402TR Perkinsus marinus large insert cDNA lib... 34 0.19 2
(EH080669) PMECL24TR Perkinsus marinus large insert cDNA lib... 34 0.19 2
(CB403951) OSTR014H8_1 AD-wrmcDNA Caenorhabditis elegans cDN... 46 0.24 2
(DN776950) E4474 [C6688|drtg6-64] Drought Library Thellungie... 38 0.24 3
(CA831478) 1117020B09.y1 1117 - Unigene V from Maize Genome ... 40 0.24 2
(FE941399) AHAI-aaa32e09.b2 Pristionchus_pacificus_AHAI1_EST... 38 0.24 3
(AW120080) 614083B10.y1 614 - root cDNA library from Walbot ... 40 0.24 2
(CF047165) QCK5b05.yg QCK Zea mays cDNA clone QCK5b05, mRNA ... 40 0.24 2
(BF733122) 1000077F05.x2 1000 - Unigene I from Maize Genome ... 40 0.25 2
(CF047059) QCK3g09.yg QCK Zea mays cDNA clone QCK3g09, mRNA ... 40 0.25 2
(BG464198) EM1_70_G11.b1_A002 Embryo 1 (EM1) Sorghum bicolor... 40 0.25 2
(CF033729) QCF1d07.yg QCF Zea mays cDNA clone QCF1d07, mRNA ... 40 0.25 2
(EI420870) PV_GBa0009B23.f PV_GBa Phaseolus vulgaris genomic... 42 0.25 2
(AK279569) Gryllus bimaculatus mRNA, GBcontig26430. 50 0.25 1
(ET546347) fcg3x.607850a13.f C. graminicola genomic sequence... 50 0.25 1
(ET535510) fcg3x.222350d05 C. graminicola genomic sequence G... 50 0.25 1
(ET531388) fcg3x.223950b19 C. graminicola genomic sequence G... 50 0.25 1
(EC757084) PPE00003236 Agencourt Biosciences Agen-0020 Non-n... 50 0.25 1
(DY330158) OB_MEa0005C13.r OB_MEa Ocimum basilicum cDNA clon... 50 0.25 1
(DN685278) CGX40-H03.x1d-t SHGC-CGX Gasterosteus aculeatus c... 50 0.25 1
(DC912524) Physcomitrella patens subsp. patens cDNA, clone:p... 50 0.25 1
(DB930806) Manihot esculenta mRNA, clone: CAS01_030_N10, 5'end. 50 0.25 1
(DB854146) Nilaparvata lugens mRNA, EST clone:NLNA6108, 5' e... 50 0.25 1
(DB844255) Nilaparvata lugens mRNA, EST clone:NLEA7345, 5' e... 50 0.25 1
(CX701197) gmrtDrNS01_35-A_M13R_E11_087.s1 Water stressed 5h... 50 0.25 1
(CU902772) Podospora anserina mRNA sequence from clone HH0AB... 50 0.25 1
(BM142779) saj54h01.y1 Gm-c1072 Glycine max cDNA clone SOYBE... 50 0.25 1
(GE122097) 454GmaGlobSeed864745 Soybean Seeds Containing Glo... 50 0.25 1
(GD805067) 454GmaGlobSeed547716 Soybean Seeds Containing Glo... 50 0.25 1
(GD751077) 454GmaGlobSeed493726 Soybean Seeds Containing Glo... 50 0.25 1
(GD713312) 454GmaGlobSeed455961 Soybean Seeds Containing Glo... 50 0.25 1
(GD225489) G1045P395FH21.T1 Aplysia californica Pooled Norma... 50 0.25 1
(FD464356) LARW521TF Haematobia irritans 1st Instar Larvae H... 50 0.25 1
(FD463214) LARVX96TF Haematobia irritans 1st Instar Larvae H... 50 0.25 1
(FD456465) EGGB793TR Haematobia irritans eggs Haematobia irr... 50 0.25 1
(FD456464) EGGB793TF Haematobia irritans eggs Haematobia irr... 50 0.25 1
(EY088226) CAZI18277.fwd CAZI Artemisia annua normalized lea... 50 0.25 1
(EY078237) CAZI13198.fwd CAZI Artemisia annua normalized lea... 50 0.25 1
(FG900683) UCRVU08_CCNS16555_b1 Cowpea IT97K-461-4 Mixed Tis... 48 0.26 2
(CF054442) QCN29e03.yg QCN Zea mays cDNA clone QCN29e03, mRN... 40 0.26 2
(CF034905) QCG11d04.yg QCG Zea mays cDNA clone QCG11d04, mRN... 40 0.26 2
(CF035887) QCG24b03.yg QCG Zea mays cDNA clone QCG24b03, mRN... 40 0.26 2
(EX988303) CBAF1099.g1:P T. versicolor host exudate reverse ... 44 0.27 2
(CA220769) SCBGFL4050E04.g FL4 Saccharum officinarum cDNA cl... 40 0.28 2
(BU080441) 946156F02.y1 946 - tassel primordium prepared by ... 40 0.28 2
(CA281021) SCRFSD1020E07.g SD1 Saccharum officinarum cDNA cl... 40 0.28 2
(CA828214) 1114025D02.y4 1114 - Unigene IV from Maize Genome... 40 0.29 2
(CF040444) QCI13g02.yg QCI Zea mays cDNA clone QCI13g02, mRN... 40 0.29 2
(FG857259) UCRVU05_CCNN21157_b1 Cowpea IT84S-2049 Mixed Tiss... 48 0.30 2
(CD225985) CCC1_42_G07.g1_A007 Callus culture/cell suspensio... 40 0.30 2
(AU211721) Caenorhabditis elegans cDNA clone:yk775h06 : 3' e... 46 0.30 2
(FG921477) UCRVU09_CCNT4736_b1 Cowpea UCR 707 Mixed Tissue a... 48 0.30 2
(DN205797) MEST823_D10.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mRN... 40 0.30 2
(CO520949) 3530_1_138_1_F02.y_1 3530 - Full length cDNA libr... 40 0.30 2
(CA205231) SCSFSB1102G03.g SB1 Saccharum officinarum cDNA cl... 40 0.30 2
(CA283196) SCBGSD1051D10.g SD1 Saccharum officinarum cDNA cl... 40 0.31 2
(CA191781) SCCCST1C03A08.g ST1 Saccharum officinarum cDNA cl... 40 0.31 2
(AW461012) 707096G04.x1 707 - Mixed adult tissues from Walbo... 40 0.31 2
(AU213998) Caenorhabditis elegans cDNA clone:yk808a01 : 3' e... 46 0.31 2
(EY148564) CBTN11324.b1_H23.ab1:P Triphysaria pusilla root t... 44 0.31 2
(BJ818006) Caenorhabditis elegans cDNA clone:yk1684b12 : 3' ... 46 0.31 2
(BJ779171) Caenorhabditis elegans cDNA clone:yk1408g11 : 3' ... 46 0.31 2
(DY400276) V-946-5C-B09.Gal4-R UGV-Reseq Zea mays cDNA, mRNA... 40 0.31 2
(CX606887) ANR1_5_B07.g1_A002 Anaerobic roots Sorghum bicolo... 40 0.32 2
(DV549522) 1000077-F05.GAD10-F UGI-Reseq Zea mays cDNA, mRNA... 40 0.32 2
(DN224037) MEST1151_D08.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mR... 40 0.32 2
(BJ811738) Caenorhabditis elegans cDNA clone:yk1459g08 : 3' ... 46 0.32 2
(BJ785194) Caenorhabditis elegans cDNA clone:yk1567h01 : 3' ... 46 0.32 2
(BJ817591) Caenorhabditis elegans cDNA clone:yk1679d04 : 3' ... 46 0.32 2
(EY164057) CBTN9680.b1_O19.ab1:P Triphysaria pusilla root ti... 44 0.32 2
(EC371244) G840P31RB19.T0 Oscarella carmela pSport1 Library ... 38 0.32 2
(BJ142748) Caenorhabditis elegans cDNA clone:yk1188a12 : 3' ... 46 0.33 2
(CX613567) GABR1_8_H09.g1_A002 GA- or brassinolide-treated s... 40 0.33 2
(BJ785242) Caenorhabditis elegans cDNA clone:yk1568d07 : 3' ... 46 0.33 2
(CA452741) Rp3A#1_D10 subtracted cDNA library of maize inbre... 40 0.33 2
(BJ782975) Caenorhabditis elegans cDNA clone:yk1517c03 : 3' ... 46 0.33 2
(BJ794129) Caenorhabditis elegans cDNA clone:yk1696e03 : 3' ... 46 0.33 2
(BJ780512) Caenorhabditis elegans cDNA clone:yk1424c06 : 3' ... 46 0.33 2
(BJ780543) Caenorhabditis elegans cDNA clone:yk1424f08 : 3' ... 46 0.34 2
(EY172273) CBTI3620.b1_H17.ab1:P Triphysaria pusilla root ti... 44 0.34 2
(BJ777028) Caenorhabditis elegans cDNA clone:yk1383g07 : 3' ... 46 0.34 2
(BJ809001) Caenorhabditis elegans cDNA clone:yk1428b09 : 3' ... 46 0.34 2
(BJ810252) Caenorhabditis elegans cDNA clone:yk1442c12 : 3' ... 46 0.34 2
(DN213642) MEST974_E06.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mRN... 40 0.34 2
(BJ781663) Caenorhabditis elegans cDNA clone:yk1501h02 : 3' ... 46 0.35 2
(EB162880) ZM_BFb0303I21.r ZM_BFb Zea mays cDNA 5', mRNA seq... 40 0.35 2
(FG880214) UCRVU07_CCNP13469_b1 Cowpea UCR 779 Mixed Tissue ... 48 0.35 2
(EY148333) CBTN1121.b1_B18.ab1:P Triphysaria pusilla root ti... 44 0.35 2
(EY160456) CBTN8027.b1_F16.ab1:P Triphysaria pusilla root ti... 44 0.35 2
(CN059457) Salamander_6_E03.ab1 AG Ambystoma tigrinum tigrin... 40 0.35 2
(CO467270) MZCCL10213E10.g Maize Endosperm cDNA Library Zea ... 40 0.36 2
(EB165422) ZM_BFb0341E09.r ZM_BFb Zea mays cDNA 5', mRNA seq... 40 0.36 2
(CD438715) EL01N0516E06.b Endosperm_5 Zea mays cDNA, mRNA se... 40 0.37 2
(CO448827) MZCCL10129G10.g Maize Endosperm cDNA Library Zea ... 40 0.38 2
(CN066465) G09_Ag2_p27_C1_M13R AG Ambystoma tigrinum tigrinu... 40 0.39 2
(ER567329) 1093015775286 Global-Ocean-Sampling_GS-36-01-01-2... 44 0.39 3
(CO463133) MZCCS15029C12.g Maize Endosperm cDNA Library Zea ... 40 0.39 2
(CO440446) MZCCL10022F05.g Maize Endosperm cDNA Library Zea ... 40 0.39 2
(ES302592) _34Z_D09 Bermudagrass Normalized cDNA Library Cyn... 42 0.41 2
(CO453992) MZCCL10195H08.g Maize Endosperm cDNA Library Zea ... 40 0.42 2
(CA177381) SCQGST1032A08.g ST1 Saccharum officinarum cDNA cl... 40 0.43 2
(FK616298) 454GmaGlobSeed350930 Soybean Seeds Containing Glo... 44 0.44 2
(FK409738) 454GmaGlobSeed144370 Soybean Seeds Containing Glo... 44 0.44 2
(ES402577) MUT13-M01.x1d-t SHGC-MUT Mytilus californianus cD... 48 0.45 2
(GE105483) 454GmaGlobSeed848131 Soybean Seeds Containing Glo... 44 0.45 2
(FK274611) 454GmaGlobSeed9243 Soybean Seeds Containing Globu... 44 0.46 2
(BT038646) Zea mays full-length cDNA clone ZM_BFb0303I21 mRN... 40 0.48 2
(AA072448) zEST00674 Maize Leaf, Stratagene #937005 Zea mays... 38 0.51 2
(CN938256) 010615AVBC002639HT (AVBC) Royal Gala young shoot ... 38 0.52 3
(AM053400) Epidinium ecaudatum EST, clone Eec07_F06. 38 0.53 3
(CN938237) 010615AVBC002605HT (AVBC) Royal Gala young shoot ... 38 0.59 3
(BT016683) Zea mays clone Contig516 mRNA sequence. 40 0.61 2
(FL287514) 22206920 CERES-504 Zea mays cDNA clone 1595301 5'... 36 0.71 2
(EC902608) ZM_BFc0051A11.r ZM_BFc Zea mays cDNA clone ZM_BFc... 36 0.71 2
(EE180592) ZM_BFc0162P09.r ZM_BFc Zea mays cDNA clone ZM_BFc... 36 0.71 2
(FL287512) 22266599 CERES-504 Zea mays cDNA clone 1602116 5'... 36 0.71 2
(CD990549) QAY1e09.yg QAY Zea mays cDNA clone QAY1e09, mRNA ... 36 0.73 2
(BI478491) 949070A04.y1 949 - Juvenile leaf and shoot cDNA f... 38 0.76 2
(DB956323) Glycine max cDNA, clone: GMFL02-03-H06, 5'end. 44 0.79 2
(BW632942) Lotus japonicus cDNA, clone: LjFL2-033-AA12, 5' e... 42 0.79 2
(CN939468) 010616AVBC005556HT (AVBC) Royal Gala young shoot ... 38 0.81 3
(BW680941) Glycine max cDNA clone: GMFL01-47-D23, 5'end, sim... 44 0.81 2
(FM182452) Zea mays EST, clone ZEASTAR-B-002-B03. 40 0.85 2
(DB971514) Glycine max cDNA, clone: GMFL02-46-A16, 5'end. 44 0.89 2
>(BJ344868) Dictyostelium discoideum cDNA clone:dda20c20, 3' end,
single read.
Length = 662
Score = 1172 bits (591), Expect(3) = 0.0
Identities = 591/591 (100%)
Strand = Plus / Minus
Query: 661 tggtattcaagctgccacttcacatgctttgggtcaaaaacttttcaaaaatgttcaata 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 662 tggtattcaagctgccacttcacatgctttgggtcaaaaacttttcaaaaatgttcaata 603
Query: 721 ttgaattcgagaatgataaaggtaccaaatcattggcatggcaaaacagttggggtttaa 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 602 ttgaattcgagaatgataaaggtaccaaatcattggcatggcaaaacagttggggtttaa 543
Query: 781 ccactcgtaccattggtgtcatggttatggtccatggtgatgacaaaggtttggttctcc 840
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 542 ccactcgtaccattggtgtcatggttatggtccatggtgatgacaaaggtttggttctcc 483
Query: 841 caccacgtatctccccaattcaagctgtcgtcattccactccactttaaggattccgata 900
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 482 caccacgtatctccccaattcaagctgtcgtcattccactccactttaaggattccgata 423
Query: 901 ccaccgccgtagattcaaaggctaaagaaatcgctgatcaattaaaggctgccggtattc 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 422 ccaccgccgtagattcaaaggctaaagaaatcgctgatcaattaaaggctgccggtattc 363
Query: 961 gtgtcaatttagataatcgtccaaactacaatccaggtcataaatacaatcattgggaat 1020
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 362 gtgtcaatttagataatcgtccaaactacaatccaggtcataaatacaatcattgggaat 303
Query: 1021 tgaaaggtgttccaattcgtattgaaatcggtccaaaagatgttgcctctggtactgtca 1080
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 302 tgaaaggtgttccaattcgtattgaaatcggtccaaaagatgttgcctctggtactgtca 243
Query: 1081 tctgttgtcgtagagataccgccgagaaatctaaagttgaaatctcaaacattgtcactg 1140
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 242 tctgttgtcgtagagataccgccgagaaatctaaagttgaaatctcaaacattgtcactg 183
Query: 1141 gtgtcaaggaattactcgacaacattcaatcaaatctctttgatcgtgctgttaaacaaa 1200
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 182 gtgtcaaggaattactcgacaacattcaatcaaatctctttgatcgtgctgttaaacaaa 123
Query: 1201 gaaatgatcatatcgtcaccatcaatcaatggaatgagtttgttccagctt 1251
|||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 122 gaaatgatcatatcgtcaccatcaatcaatggaatgagtttgttccagctt 72
Score = 56.0 bits (28), Expect(3) = 0.0
Identities = 28/28 (100%)
Strand = Plus / Minus
Query: 1271 tttagcaccatggtgcgaaaaagtctct 1298
||||||||||||||||||||||||||||
Sbjct: 54 tttagcaccatggtgcgaaaaagtctct 27
Score = 44.1 bits (22), Expect(3) = 0.0
Identities = 22/22 (100%)
Strand = Plus / Minus
Query: 1251 ttggataataaaaaccttgttt 1272
||||||||||||||||||||||
Sbjct: 73 ttggataataaaaaccttgttt 52
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,445,324,413
Number of extensions: 80089848
Number of successful extensions: 6174612
Number of sequences better than 10.0: 684
Length of query: 1550
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1526
Effective length of database: 96,409,374,237
Effective search space: 147120705085662
Effective search space used: 147120705085662
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.17 |
| Homology vs Protein |
Query= Contig-U15634-1 (Contig-U15634-1Q) /CSM_Contig/Contig-U15634-1Q.Seq.d
(1550 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AP008218_798(AP008218|pid:none) Oryza sativa (japonica cultivar-... 262 3e-69
AK069541_1(AK069541|pid:none) Oryza sativa Japonica Group cDNA c... 262 3e-69
EU267987_1(EU267987|pid:none) Oryza sativa Japonica Group clone ... 262 3e-69
BT038646_1(BT038646|pid:none) Zea mays full-length cDNA clone ZM... 257 7e-68
CP000586_244(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 253 1e-65
BC094679_1(BC094679|pid:none) Mus musculus glutamyl-prolyl-tRNA ... 252 3e-65
BC141049_1(BC141049|pid:none) Mus musculus glutamyl-prolyl-tRNA ... 252 3e-65
AY383705_1(AY383705|pid:none) Rattus norvegicus LRRGT00050 mRNA,... 249 1e-64
AY493416_1(AY493416|pid:none) Homo sapiens proliferation-inducin... 247 7e-64
(P07814) RecName: Full=Bifunctional aminoacyl-tRNA synthetase; A... 247 7e-64
(O60155) RecName: Full=Putative prolyl-tRNA synthetase C19C7.06;... 247 1e-63
CR933648_1(CR933648|pid:none) Homo sapiens mRNA; cDNA DKFZp313B0... 247 1e-63
AJ720548_1(AJ720548|pid:none) Gallus gallus mRNA for hypothetica... 246 2e-63
AB092649_1(AB092649|pid:none) Oryzias latipes EPRS gene for glut... 244 5e-63
BC161719_1(BC161719|pid:none) Xenopus laevis hypothetical protei... 244 6e-63
BC158466_1(BC158466|pid:none) Xenopus tropicalis hypothetical pr... 244 6e-63
AY314946_1(AY314946|pid:none) Herdmania curvata clone 4256 bifun... 244 8e-63
BX538353_4(BX538353|pid:none) Cryptosporidium parvum chromosome ... 243 2e-62
U00037_4(U00037|pid:none) Caenorhabditis elegans cosmid T20H4, c... 243 2e-62
FN392319_707(FN392319|pid:none) Pichia pastoris GS115 chromosome... 240 9e-62
CR382131_212(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 240 1e-61
AP006852_338(AP006852|pid:none) Candida albicans genomic DNA, ch... 236 1e-60
FN357358_29(FN357358|pid:none) Schistosoma mansoni genome sequen... 234 5e-60
CP000500_547(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 233 2e-59
AE017342_567(AE017342|pid:none) Cryptococcus neoformans var. neo... 233 2e-59
CR380947_79(CR380947|pid:none) Candida glabrata strain CBS138 ch... 232 3e-59
AM910996_308(AM910996|pid:none) Plasmodium knowlesi strain H chr... 232 3e-59
(P38708) RecName: Full=Putative prolyl-tRNA synthetase YHR020W; ... 230 9e-59
AM502236_128(AM502236|pid:none) Leishmania infantum chromosome 18. 230 1e-58
AE014188_134(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 230 1e-58
CT005257_121(CT005257|pid:none) Leishmania major strain Friedlin... 230 1e-58
CT005257_122(CT005257|pid:none) Leishmania major strain Friedlin... 230 1e-58
(P28668) RecName: Full=Bifunctional aminoacyl-tRNA synthetase; I... 225 3e-57
BT001645_1(BT001645|pid:none) Drosophila melanogaster RE41560 fu... 225 3e-57
CR940347_997(CR940347|pid:none) Theileria annulata strain Ankara... 224 5e-57
AC137702_22(AC137702|pid:none) Medicago truncatula clone mth2-7k... 219 2e-56
AY568070_1(AY568070|pid:none) Naegleria gruberi strain NEG-M pro... 221 3e-56
AM270348_8(AM270348|pid:none) Aspergillus niger contig An15c0210... 221 6e-56
AK298192_1(AK298192|pid:none) Homo sapiens cDNA FLJ58269 complet... 217 8e-55
BC154533_1(BC154533|pid:none) Danio rerio hypothetical LOC562037... 215 3e-54
BX908808_13(BX908808|pid:none) Neurospora crassa DNA linkage gro... 211 6e-54
AC147496_18(AC147496|pid:none) Medicago truncatula clone mth2-6i... 211 2e-53
AP007161_169(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 208 4e-52
AL590442_134(AL590442|pid:none) chromosome II of strain GB-M1 of... 204 5e-51
AY568069_1(AY568069|pid:none) Entamoeba terrapinae strain M prol... 201 6e-50
AY568068_1(AY568068|pid:none) Entamoeba moshkovskii strain FIC p... 199 2e-49
AF252642_1(AF252642|pid:none) Drosophila simulans strain sim8 gl... 199 3e-49
AF252637_1(AF252637|pid:none) Drosophila simulans strain sim1 gl... 199 3e-49
EU016662_9(EU016662|pid:none) Uncultured Group I marine crenarch... 191 8e-47
CP001102_258(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 183 8e-45
AB097406_1(AB097406|pid:none) Raphanus sativus RsProRS1 mRNA for... 182 3e-44
EU016634_23(EU016634|pid:none) Uncultured Group I marine crenarc... 181 6e-44
CP000685_4900(CP000685|pid:none) Flavobacterium johnsoniae UW101... 179 2e-43
(Q7MVS7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 178 4e-43
(Q8A988) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 176 3e-42
(A6L5I2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 175 5e-42
(A6GZF3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 172 2e-41
(A0M4Z3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 172 2e-41
(Q5JF49) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 172 2e-41
GM017008_245(GM017008|pid:none) Sequence 1838 from Patent EP1923... 172 2e-41
CP001034_432(CP001034|pid:none) Natranaerobius thermophilus JW/N... 172 3e-41
CP001251_770(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 172 4e-41
(Q5LCF0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 171 9e-41
CP000993_379(CP000993|pid:none) Borrelia recurrentis A1, complet... 171 9e-41
CP000976_388(CP000976|pid:none) Borrelia duttonii Ly, complete g... 171 9e-41
CP001146_658(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 171 9e-41
(Q661L6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 170 1e-40
CP001205_383(CP001205|pid:none) Borrelia burgdorferi ZS7, comple... 170 1e-40
(O51363) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 170 1e-40
(Q9L4Q8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 170 1e-40
CP001108_1539(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 169 2e-40
(A0Q2I3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 168 6e-40
CP000770_106(CP000770|pid:none) Candidatus Sulcia muelleri GWSS,... 167 7e-40
(Q9V022) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 167 1e-39
CP001099_1547(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 166 2e-39
AP010656_101(AP010656|pid:none) Candidatus Azobacteroides pseudo... 166 3e-39
(A6LAP3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 166 3e-39
(Q8U1C4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 165 4e-39
CP001398_1052(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 165 5e-39
CP001100_2642(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 164 6e-39
(Q67PA6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 164 6e-39
CP001365_771(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 164 8e-39
CP000909_1280(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 164 8e-39
AM461674_3(AM461674|pid:none) Vitis vinifera contig VV78X152482.... 164 8e-39
EU965113_1(EU965113|pid:none) Zea mays clone 283917 prolyl-tRNA ... 164 1e-38
BT061306_1(BT061306|pid:none) Zea mays full-length cDNA clone ZM... 164 1e-38
(Q8KCD1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 163 1e-38
AP009049_531(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 163 2e-38
CP001176_384(CP001176|pid:none) Bacillus cereus B4264, complete ... 162 2e-38
CP001186_372(CP001186|pid:none) Bacillus cereus G9842, complete ... 162 2e-38
(Q81IE9) RecName: Full=Prolyl-tRNA synthetase 2; EC=6.1... 162 2e-38
CP001283_392(CP001283|pid:none) Bacillus cereus AH820, complete ... 162 3e-38
CP000485_371(CP000485|pid:none) Bacillus thuringiensis str. Al H... 162 3e-38
CP001177_412(CP001177|pid:none) Bacillus cereus AH187, complete ... 162 3e-38
(Q6HNZ7) RecName: Full=Prolyl-tRNA synthetase 2; EC=6.1... 162 4e-38
(A8MLB3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 162 4e-38
AP009153_1753(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 161 7e-38
CP000885_3793(CP000885|pid:none) Clostridium phytofermentans ISD... 160 9e-38
CR954215_62(CR954215|pid:none) Ostreococcus tauri strain OTTH059... 160 9e-38
CP000594_62(CP000594|pid:none) Ostreococcus lucimarinus CCE9901 ... 160 9e-38
CP001334_44(CP001334|pid:none) Micromonas sp. RCC299 chromosome ... 160 9e-38
CP001101_811(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 160 2e-37
CP000764_363(CP000764|pid:none) Bacillus cereus subsp. cytotoxis... 160 2e-37
CP000431_3466(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 160 2e-37
CP001083_3464(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 159 2e-37
(Q1CXV1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 159 2e-37
CP000817_2746(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 159 3e-37
(A7GIT0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 159 3e-37
CP001581_3556(CP001581|pid:none) Clostridium botulinum A2 str. K... 159 3e-37
(Q5V5H0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 159 3e-37
CP000939_3343(CP000939|pid:none) Clostridium botulinum B1 str. O... 159 3e-37
CP001097_1630(CP001097|pid:none) Chlorobium limicola DSM 245, co... 159 3e-37
AL365234_15(AL365234|pid:none) Arabidopsis thaliana DNA chromoso... 159 3e-37
(Q6LZD3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 158 4e-37
(Q9Z5I7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 158 4e-37
CP001337_2404(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 158 4e-37
CP000813_196(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 158 6e-37
(Q8ZVQ9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 158 6e-37
CU179680_120(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 158 6e-37
(Q3ASP3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 158 6e-37
(Q3B2T0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 157 1e-36
AP008955_1058(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 157 1e-36
CP000850_1164(CP000850|pid:none) Salinispora arenicola CNS-205, ... 156 2e-36
CP001110_1003(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 156 2e-36
(Q0RBM4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 156 2e-36
(Q72GF9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 155 3e-36
(A6VK03) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 155 3e-36
(Q5SM28) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 155 3e-36
(Q11Q45) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 155 3e-36
(A8A9E3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 154 1e-35
AK106594_1(AK106594|pid:none) Oryza sativa Japonica Group cDNA c... 154 1e-35
(Q46G28) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 154 1e-35
AP004267_9(AP004267|pid:none) Oryza sativa Japonica Group genomi... 154 1e-35
CP000852_1934(CP000852|pid:none) Caldivirga maquilingensis IC-16... 153 1e-35
(Q8PYZ1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(Q8TJA2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 152 3e-35
(A3MV50) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 151 7e-35
(A5UJW4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 150 9e-35
(A6USJ4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(Q2G6Y3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 150 1e-34
(Q12ZC6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 149 2e-34
CP000159_2481(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 149 2e-34
(A6UTK4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 148 6e-34
(Q9RUW4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 146 2e-33
(Q1GTS7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 146 2e-33
CP001322_5067(CP001322|pid:none) Desulfatibacillum alkenivorans ... 146 2e-33
(Q971B5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 145 3e-33
CU469464_435(CU469464|pid:none) Candidatus Phytoplasma mali stra... 145 5e-33
(Q979Q5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 144 7e-33
CP001047_29(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, c... 142 3e-32
AM422018_677(AM422018|pid:none) Candidatus Phytoplasma australie... 142 3e-32
CP000859_2052(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 141 6e-32
AL445563_183(AL445563|pid:none) Mycoplasma pulmonis (strain UAB ... 141 7e-32
(Q98R27) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 141 7e-32
(Q4A9V2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 138 1e-31
(Q4A7Y3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 137 2e-31
CP001071_34(CP001071|pid:none) Akkermansia muciniphila ATCC BAA-... 140 2e-31
(Q600Q7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 137 2e-31
CP000896_274(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 139 2e-31
AE004437_312(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 139 3e-31
(A4YI09) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 138 5e-31
CP001087_1217(CP001087|pid:none) Desulfobacterium autotrophicum ... 137 8e-31
(O26708) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 136 2e-30
(Q4J8L4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 136 2e-30
(Q6YQX7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 136 2e-30
(Q2ILX2) RecName: Full=Prolyl-tRNA synthetase 2; EC=6.1... 135 3e-30
(Q2NJ01) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 135 4e-30
(Q4A5S0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 135 4e-30
CP000123_303(CP000123|pid:none) Mycoplasma capricolum subsp. cap... 134 1e-29
(Q2NFL1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 132 3e-29
(Q2FLY5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 132 3e-29
CP001400_1418(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 131 6e-29
CP001399_1519(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 130 1e-28
(Q9Y9G0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 130 2e-28
CP001184_466(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 129 3e-28
(Q0W0C9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 128 5e-28
(A0B9N3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 127 8e-28
(Q9PQ38) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 127 1e-27
FM864216_58(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T ... 124 2e-27
AP007255_3635(AP007255|pid:none) Magnetospirillum magneticum AMB... 124 1e-26
(Q6KZA3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 124 1e-26
AY568071_1(AY568071|pid:none) Trichomonas vaginalis strain ATCC ... 122 3e-26
CP001140_998(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 120 1e-25
AE000782_1589(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 118 5e-25
(O28664) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 118 5e-25
AP007150_137(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 113 2e-23
(Q74ND5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 113 2e-23
EU233579_1(EU233579|pid:none) Limnomysis benedeni isolate 810lim... 108 2e-22
EU020342_1(EU020342|pid:none) Antheraea paukstadtorum clone Apau... 108 2e-22
EU233577_1(EU233577|pid:none) Katamysis warpachowskyi isolate 68... 104 7e-22
EU020344_1(EU020344|pid:none) Prodoxus quinquepunctellus clone P... 102 2e-21
EU020339_1(EU020339|pid:none) Speleonectes tulumensis clone Stu1... 102 2e-21
EU020343_1(EU020343|pid:none) Cydia pomonella clone Cpo192f1 put... 102 3e-21
EU233575_1(EU233575|pid:none) Hemimysis anomala isolate 1043hemi... 103 8e-21
EU233559_1(EU233559|pid:none) Caspiomysis knipowitschi isolate 6... 100 4e-20
EU233591_1(EU233591|pid:none) Mysis segerstralei isolate 900sege... 100 6e-20
EU233556_1(EU233556|pid:none) Paramysis inflata isolate 651infla... 100 8e-20
EU233568_1(EU233568|pid:none) Paramysis lacustris isolate 439lac... 99 1e-19
EU020333_1(EU020333|pid:none) Limulus polyphemus clone Lpo192f1 ... 97 1e-19
EU020336_1(EU020336|pid:none) Narceus americanus clone Nam192f1 ... 97 1e-19
EU233572_1(EU233572|pid:none) Paramysis intermedia isolate 360in... 98 2e-19
EU233555_1(EU233555|pid:none) Paramysis baeri isolate 597baeriDa... 98 2e-19
EU020337_1(EU020337|pid:none) Nebalia hessleri clone Nhe192f1 pu... 95 4e-19
EU233582_1(EU233582|pid:none) Paramysis kroyeri isolate 640kro g... 97 5e-19
EU233584_1(EU233584|pid:none) Paramysis nouveli isolate 1204nouv... 97 5e-19
(Q7NBP5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 98 7e-19
EU020332_1(EU020332|pid:none) Lithobius forticatus clone Lfo192f... 93 3e-18
(P75382) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 82 5e-14
(P47525) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 80 2e-13
AY809196_1(AY809196|pid:none) Schistosoma japonicum SJCHGC04406 ... 79 3e-13
(Q2LTR7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 77 1e-12
CP001098_771(CP001098|pid:none) Halothermothrix orenii H 168, co... 76 4e-12
(Q0K6Q0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 75 5e-12
(Q7WFN9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 75 7e-12
(Q7W481) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 75 7e-12
AP010904_2436(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 75 7e-12
(Q7VTZ8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 75 7e-12
(Q1MRD0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 75 9e-12
(Q2KVA0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 75 9e-12
(Q46X21) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 74 1e-11
CP001616_825(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 74 1e-11
CP000381_1198(CP000381|pid:none) Neisseria meningitidis 053442, ... 74 1e-11
(A1K976) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 74 2e-11
CP000352_3086(CP000352|pid:none) Ralstonia metallidurans CH34, c... 73 3e-11
(Q1LIQ4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 73 3e-11
CP000698_2753(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 72 4e-11
(A9BGA8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 72 7e-11
(Q5F938) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 71 9e-11
(Q2SD07) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 71 9e-11
(Q2SZF6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 71 1e-10
(A6LPP0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 71 1e-10
(A4J5Y2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 70 2e-10
CP000910_635(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 70 2e-10
(Q8R7S9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 70 2e-10
CP001124_2861(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 70 3e-10
(Q3AB89) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 70 3e-10
AP009385_432(AP009385|pid:none) Burkholderia multivorans ATCC 17... 69 4e-10
(Q18CD2) RecName: Full=Prolyl-tRNA synthetase 1; EC=6.1... 69 4e-10
CP001408_3611(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 69 5e-10
CP001515_510(CP001515|pid:none) Bifidobacterium animalis subsp. ... 69 5e-10
(Q62GV8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 69 5e-10
CP001068_3017(CP001068|pid:none) Ralstonia pickettii 12J chromos... 69 5e-10
(Q1H497) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 69 5e-10
(Q9JU09) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 69 6e-10
(Q0HKJ4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 68 8e-10
(Q0HWU6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 68 8e-10
(A2C7N5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 68 8e-10
(A4G8R0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 68 1e-09
(Q7P0J3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 1e-09
(A0K4B4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 1e-09
(Q1BZD6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 1e-09
(Q97ED5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 1e-09
CP001013_573(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 67 2e-09
(Q72CD8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 2e-09
CP001089_1886(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 67 2e-09
(A1VE74) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 2e-09
(A5IGL5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 2e-09
(Q6FE23) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 2e-09
CP001336_3645(CP001336|pid:none) Desulfitobacterium hafniense DC... 67 2e-09
(A0KV13) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 67 2e-09
(A1RI33) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
CP001025_509(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 66 3e-09
(Q5ZXN7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
(Q49X48) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
(Q8XHQ4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
(Q5WYK5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
(Q0TMM3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
(Q39JU3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 3e-09
(Q7N8M7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 4e-09
(A4QF01) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 66 4e-09
(Q12L53) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 65 5e-09
(Q890M2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 65 7e-09
CP001091_1916(CP001091|pid:none) Actinobacillus pleuropneumoniae... 65 7e-09
(P43830) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 65 9e-09
(A4SJ23) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 65 9e-09
(Q39VY6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 65 9e-09
(Q1IST4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 65 9e-09
CP000884_5463(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 64 1e-08
CU694389_25(CU694389|pid:none) Ralstonia solanacearum strain Mol... 64 1e-08
AY458642_50(AY458642|pid:none) Uncultured marine bacterium 560 c... 64 1e-08
(A6TL31) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 1e-08
CU468230_588(CU468230|pid:none) Acinetobacter baumannii str. SDF... 64 2e-08
CP001078_186(CP001078|pid:none) Clostridium botulinum E3 str. Al... 64 2e-08
CP000934_2405(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 64 2e-08
(Q74D59) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
(Q2RJN1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
(Q6D1B9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
AJ410310_3(AJ410310|pid:none) Erwinia chrysanthemi nlpD gene (pa... 64 2e-08
(Q03QS8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
(A4W6T9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
(Q0VRL1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
(Q9CL72) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 64 2e-08
AP009484_850(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 64 2e-08
AM286690_739(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 64 2e-08
CP000687_1811(CP000687|pid:none) Actinobacillus pleuropneumoniae... 64 2e-08
(A8I438) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
(A1TTD0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
(Q5N044) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
CP000100_1957(CP000100|pid:none) Synechococcus elongatus PCC 794... 63 3e-08
(Q31LT0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
(A7HY28) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
(Q31GQ3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
CP001113_254(CP001113|pid:none) Salmonella enterica subsp. enter... 63 3e-08
CP001127_256(CP001127|pid:none) Salmonella enterica subsp. enter... 63 3e-08
(A9MPG5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
(A9N0U7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 63 3e-08
(Q9KYR6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 4e-08
(Q667L4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 4e-08
(Q65QU0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 4e-08
(A7FFJ4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 4e-08
FP236842_894(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 62 4e-08
(A6VKR5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 4e-08
(A6WQB8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 6e-08
(A6W7Y5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 6e-08
AM295250_892(AM295250|pid:none) Staphylococcus carnosus subsp. c... 62 6e-08
(A9KVR8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 6e-08
(A6Q3S4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 6e-08
(Q1LSM8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 6e-08
CP001252_1464(CP001252|pid:none) Shewanella baltica OS223, compl... 62 6e-08
(Q15WD6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 7e-08
(A1WUX1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 7e-08
(B0RDZ1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 7e-08
(Q87MC3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 7e-08
(A1VK86) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 62 7e-08
(Q7MIE5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(B5Y1H7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(A8H6J5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
CP000857_251(CP000857|pid:none) Salmonella enterica subsp. enter... 61 1e-07
(B6EHZ8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
CP001601_1530(CP001601|pid:none) Corynebacterium aurimucosum ATC... 61 1e-07
(Q7TUU4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
AE017220_241(AE017220|pid:none) Salmonella enterica subsp. enter... 61 1e-07
CP000613_1182(CP000613|pid:none) Rhodospirillum centenum SW, com... 61 1e-07
(B1XD64) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(B5Z0H4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
CU928145_188(CU928145|pid:none) Escherichia coli 55989 chromosom... 61 1e-07
AE014075_227(AE014075|pid:none) Escherichia coli CFT073, complet... 61 1e-07
CP000266_172(CP000266|pid:none) Shigella flexneri 5 str. 8401, c... 61 1e-07
(B7NKX8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(B7N862) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
M97858_1(M97858|pid:none) Escherichia coli prolyl-tRNA synthetas... 61 1e-07
(A7ZWE2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(A8GIB4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(Q3ALR5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(Q7VKI5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(B7LW79) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(Q13U19) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(A8ERT9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 61 1e-07
(P75000) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
(Q606K3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
CP000943_4162(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 60 2e-07
CP001628_653(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 60 2e-07
(O66690) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
AM181176_4879(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 60 2e-07
(A2C0W8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
AP006725_935(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 60 2e-07
(A1WKI1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
(Q3Z9I5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
CP001229_1164(CP001229|pid:none) Sulfurihydrogenibium azorense A... 60 2e-07
(A1S4R2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 2e-07
CP000961_3220(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 60 2e-07
(A6T4Z7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 60 3e-07
DQ489736_631(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 60 3e-07
(Q6AP31) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 4e-07
(Q5WFT6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 4e-07
CP001614_757(CP001614|pid:none) Teredinibacter turnerae T7901, c... 59 4e-07
CP001618_2478(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 59 4e-07
CR954246_1582(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 59 4e-07
(Q2NRN0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 4e-07
(A2BVH0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 4e-07
(A8AL94) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 4e-07
CP001139_672(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 59 5e-07
A97516(A97516)probable prolyl-tRNA synthetase (proline-tRNA liga... 59 5e-07
CR936257_164(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 59 5e-07
(Q8UFV9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 5e-07
EU559167_115(EU559167|pid:none) Candidatus Nitrospira defluvii C... 59 5e-07
(B7UXX6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 6e-07
CP001389_1050(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 59 6e-07
X84019_2(X84019|pid:none) Z.mobilis grp gene with 5' and 3' chro... 59 6e-07
CP000777_2466(CP000777|pid:none) Leptospira biflexa serovar Pato... 59 6e-07
CP000394_1284(CP000394|pid:none) Granulibacter bethesdensis CGDN... 59 6e-07
(Q0BSM0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 6e-07
(Q038L9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 59 6e-07
FM177140_1740(FM177140|pid:none) Lactobacillus casei BL23 comple... 59 6e-07
CP001016_1766(CP001016|pid:none) Beijerinckia indica subsp. indi... 58 8e-07
CU468135_915(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 58 8e-07
(A1APU5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 8e-07
CP000020_676(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 58 8e-07
(A6X1L5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 8e-07
AP008937_721(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 58 1e-06
CP001154_3171(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 58 1e-06
(A3PBN3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 1e-06
(Q0AYJ4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 1e-06
(Q6HEZ6) RecName: Full=Prolyl-tRNA synthetase 1; EC=6.1... 58 1e-06
(B7IUH7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 1e-06
CP000908_1042(CP000908|pid:none) Methylobacterium extorquens PA1... 58 1e-06
CP001298_1114(CP001298|pid:none) Methylobacterium chloromethanic... 58 1e-06
(B7HLF2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 1e-06
(Q9WYY4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 58 1e-06
CP000686_2213(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 58 1e-06
(Q04U64) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(A4X5V6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(A8LQU6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(Q0I8J8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(Q053M7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(Q02IB8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(B7HDU2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(A0RNT1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(Q4KH98) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(A7ZD35) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 1e-06
(Q636K7) RecName: Full=Prolyl-tRNA synthetase 1; EC=6.1... 57 1e-06
(A7MI22) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
AP011115_6664(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 57 2e-06
(A1SZR1) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
CP000916_157(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 57 2e-06
(Q0S235) RecName: Full=Prolyl-tRNA synthetase 1; EC=6.1... 57 2e-06
CP000969_417(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 57 2e-06
(Q3IZS9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q3AWR9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
CP001321_1518(CP001321|pid:none) Haemophilus parasuis SH0165, co... 57 2e-06
(A8G3M4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
CP001095_563(CP001095|pid:none) Bifidobacterium longum subsp. in... 57 2e-06
CP001096_3215(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 57 2e-06
(Q1WUG0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(A6QGG3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(A6VA16) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q2YXK5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(A4WPJ3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q89KM8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q5HGG8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q6N5P6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q4L5W5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q2IWW0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(Q47Z50) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
CP001344_1135(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 57 2e-06
(Q8G3N0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(B7K1H5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(A1B1L0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 57 2e-06
(A5ISE7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
CP000472_3329(CP000472|pid:none) Shewanella piezotolerans WP3, c... 56 3e-06
(B0CLE9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
(Q6G9V0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
(Q47RV7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
(Q48FB4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
(Q6GHH2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
(Q0AGN2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
CP001279_1023(CP001279|pid:none) Nautilia profundicola AmH, comp... 56 3e-06
(Q87Y24) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 3e-06
(Q3KLW0) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 4e-06
(O31755) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 4e-06
(P36431) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 4e-06
FM872307_402(FM872307|pid:none) Chlamydia trachomatis B/TZ1A828/... 56 4e-06
(Q7U5D6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 4e-06
CP000951_1628(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 56 4e-06
FM954972_2246(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 56 4e-06
(B0KTK4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 4e-06
CP000628_1399(CP000628|pid:none) Agrobacterium radiobacter K84 c... 56 4e-06
(Q9PK01) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 56 4e-06
CU459003_2747(CU459003|pid:none) Magnetospirillum gryphiswaldens... 56 4e-06
CP000915_480(CP000915|pid:none) Francisella tularensis subsp. me... 56 4e-06
(Q21MA8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(Q3KH16) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(Q31C25) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(Q8YGL8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(Q9A6Z5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(A1SLL4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
CP000781_4425(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 55 5e-06
(Q73KJ8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(Q21YZ5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(A7Z4S8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
CP000267_1246(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 55 5e-06
(Q03FS9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
(Q88NK2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 5e-06
AE008917_1139(AE008917|pid:none) Brucella melitensis 16M chromos... 55 5e-06
AM420293_5764(AM420293|pid:none) Saccharopolyspora erythraea NRR... 55 5e-06
(Q1G9P3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
(Q3A6R6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
(Q9KA71) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
(Q6AEX8) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
(A8F3T2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
(Q4ZWM2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
(Q92QN2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 7e-06
CP000133_1600(CP000133|pid:none) Rhizobium etli CFN 42, complete... 55 9e-06
(Q82K46) RecName: Full=Prolyl-tRNA synthetase 1; EC=6.1... 55 9e-06
(A7NB07) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 55 9e-06
AY967208_1(AY967208|pid:none) Synthetic construct isolate FTT141... 54 1e-05
(Q98KS5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
AM295250_280(AM295250|pid:none) Staphylococcus carnosus subsp. c... 54 1e-05
(A0Q7N3) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
(Q6G3A4) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
(Q8F148) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
(A7HKV2) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
(A4IWT9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
(A8GN90) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 1e-05
AY458649_16(AY458649|pid:none) Uncultured marine bacterium 582 c... 54 2e-05
(A3DJL6) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 2e-05
(Q8G197) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 2e-05
(Q9ZDE7) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 2e-05
(Q5L6M5) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 2e-05
(A9MAJ9) RecName: Full=Prolyl-tRNA synthetase; EC=6.1.1... 54 2e-05
>AP008218_798(AP008218|pid:none) Oryza sativa (japonica
cultivar-group) genomic DNA, chromosome 12.
Length = 515
Score = 262 bits (670), Expect(2) = 3e-69
Identities = 125/270 (46%), Positives = 179/270 (66%)
Frame = +3
Query: 696 KNFSKMFNIEFENDKGTKSLAWQNSWGLTTRTIGVMVMVHGDDKGLVLPPRISPIQAVVI 875
+NF+KMF+I FENDKG++S+ WQNSW TTR+IGVMVM HGDDKGLVLPPR++P+Q +VI
Sbjct: 264 QNFAKMFDITFENDKGSRSMVWQNSWAYTTRSIGVMVMTHGDDKGLVLPPRVAPLQVIVI 323
Query: 876 PLHFKDSDTTAVDSKAKEIADQLKAAGIRVNLDNRPNYNPGHKYNHWELKGVPIRIEIGP 1055
P+ +KD DTTA+ ++ K+ + L+ AGIR +LD R NY+PG KY+HWE+KGVP+RIEIGP
Sbjct: 324 PVPYKDVDTTAIVNECKKTVETLEKAGIRADLDTRENYSPGWKYSHWEMKGVPLRIEIGP 383
Query: 1056 KDVASGTVICCRRDTAEKSKVEISNIVTGVKELLDNIQSNLFDRAVKQRNDHIVTINQWN 1235
KD+A+ RRD K+ + +++V V LLD +Q NLF+ A ++R+ + +N W+
Sbjct: 384 KDMANNQARVVRRDNGAKADIPTADLVEKVNGLLDEVQKNLFETAKQKRDACLKVVNTWD 443
Query: 1236 EFVPALDNKNLVLAPWCEKVXXXXXXXXXXXXXXXXXXXXXXGFCLTGAAKSLCIPLQNQ 1415
EF+ AL++K L+LAPWC++ GAAK+LC P +
Sbjct: 444 EFIVALNDKKLILAPWCDEEEVEKDVKARTKGD-------------LGAAKTLCTPFEQ- 489
Query: 1416 EHVKLPEIKDDTKCFCCQEKATKYTLFGRS 1505
P++ + T CF + A K++ +GRS
Sbjct: 490 -----PDLPEGTTCFASGKPAKKWSFWGRS 514
Score = 25.0 bits (53), Expect(2) = 3e-69
Identities = 10/16 (62%), Positives = 11/16 (68%)
Frame = +2
Query: 662 GIQAATSHALGQKLFK 709
G+Q ATSH LGQ K
Sbjct: 253 GVQGATSHCLGQNFAK 268
Score = 235 bits (600), Expect = 3e-60
Identities = 106/156 (67%), Positives = 122/156 (78%)
Frame = +1
Query: 181 KANLLGAGCKKEEDFSEWYQNVITRSEMIDYYDISGCYILRPWAYSIWEQIQAFFDAEIK 360
K LG KK+++F EWY V+ SEMI+YYDISGCYILRPWA IWE ++ FFDAEIK
Sbjct: 28 KETKLGMAYKKDDNFGEWYSEVVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIK 87
Query: 361 KLDVQNAYFPLLVSEKALTTEKDHIEGFAPEVAWVTKSGDSQLADPVAIRPTSETIMYPA 540
KL ++ YFPL V+E L EKDHIEGFAPEVAWVTKSG S L P+AIRPTSET+MYP
Sbjct: 88 KLKLKPYYFPLFVTENVLQKEKDHIEGFAPEVAWVTKSGKSDLEAPIAIRPTSETVMYPY 147
Query: 541 YANWIRSHRDLPLKLNQWVNVVRWEFKRPVPFLRSR 648
++ WIRSHRDLPL+ NQW NVVRWEF P PF+RSR
Sbjct: 148 FSKWIRSHRDLPLRCNQWCNVVRWEFSNPTPFIRSR 183
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,433,509,502
Number of extensions: 51140065
Number of successful extensions: 142710
Number of sequences better than 10.0: 927
Number of HSP's gapped: 142017
Number of HSP's successfully gapped: 1248
Length of query: 516
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 383
Effective length of database: 620,718,517
Effective search space: 237735192011
Effective search space used: 237735192011
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
3 |
| AH (FL, L) |
0 |
| AF (FL, S) |
4 |
| SL (DIR, L) |
2 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
1 |
| FC-IC (SUB) |
0 |