Contig-U15526-1
Contig ID Contig-U15526-1
Contig update 2004. 6.11
Contig sequence
>Contig-U15526-1 (Contig-U15526-1Q) /CSM_Contig/Contig-U15526-1Q.Seq.d
AGTCGATTCAATTTGTTGTTTGTTGTTTGGTTGTGTATAAATAGAATAGA
ATAAAATATGTTAAAGTCATTATCCAAACTTACACCCTCAATTAGAGGAG
TGGTTTCAATAAACAGAAGTTTTTGCACCAAAAAATTCTTACCTACAAAT
AGATCAGTCAGTGAATCAGATCCAGAGATTTATGATTTAATGATGAAAGA
GAAACAAAGACAATTTACAGGTTTAGAATTAATTGCTTCTGAAAATTTTA
CATCTAGAGCAGTTATGGAATCAATTGGATCATGTTTTACAAATAAATAT
GCAGAGGGTTTACCAGGTGCAAGATATTATGGTGGTAATGAAGTTGTTGA
TCAATTAGAGAATTTATGTATTAAAAGAGCATTGGAAACATTTAATTTAA
ATCCAGAAGAATGGGGTGTAAATGTACAACCATATAGTGGCAGTACTGCT
AATTTTGCTGCTTTCACTGGTTTATTAAAACCACATGATCGTATAATGGG
TTTAGATTTACCATCTGGTGGTCATTTAACACATGGTTATCAAACAGATA
AAAAAAAAATTAGTGCAACTAGTATTTTCTTTGAATCAATGCCATATCAA
GTTAATGAAACAGGTTATGTAGATTATAATAAGATGGAGGCAAATGCAGC
ATTATTTAGACCAAAACTTT----------CTTTGTGATATGGCACATAT
TAGTGGTATGGTCGCAGGTAAACAAGCAATTTCACCTTTCCTTTTCTGTG
ATGTTGTAACCACAACCACCCATAAAACTTTAAGAGGTCCACGTGCTGGT
CTTATCTTTTTCAGAAAGACTAAACGTAGAGATGCCAAAGGTAACATCAT
CGATGATGACCTCGAAAATAGAATTAACTTTGCAGTTTTCCCATCTTGTC
AAGGTGGTCCACACGAAAATACTATCGCTGGTATTGCTGTCGCTTTGAAG
GAAGCCTCATCTCCAGATTTCCAAGAATATACTAAACAAGTCAGAAGAAA
CTCTCAAACCATGGGCGAAGAACTCAAAAAGAGAGGTTATTCACTCGTAA
CCGAAGGTACCGATAATCATTTAGTTCTTTGGGATCTTAGACCACAAGGT
ATCACTGGCAGTAAAATTGAAAAGGCTTGTGACGAAGCTCATATCACTGT
AAATAAAAATGCTGTCTATGGTGATACAAATGCAATCGCTCCTGGTGGTG
TACGTTTAGGTGCTCCTGCTCTCACAAGCAGAGGTCTCAAAGAACAAGAC
TTTGTTAAAGTCGTCGATTTCTTAGATCGTGTCGTTAAAATCTCTTTAGA
TATCCAATCAAAAGTTGGTAAGAAAATGCCAGATTTCCAAAGAGCAATCG
CTGATAATCAAGATTTAAAACAAATTAGACAAGAAGTTAAAGAATTCTCT
ACTAAATTTGGTATGCCAGGTGAATTATAAAATAAAATAATAAAAAAAAA
AAAA

Gap gap included
Contig length 1444
Chromosome number (1..6, M) 6
Chromosome length 3595308
Start point 94056
End point 92613
Strand (PLUS/MINUS) MINUS
Number of clones 16
Number of EST 28
Link to clone list U15526
List of clone(s)

est1=AFA645F,1,592
est2=AFB160F,1,593
est3=AFD838F,1,611
est4=AHN411F,1,562
est5=CFE112F,1,562
est6=VFJ668F,6,616
est7=AFB715F,10,587
est8=AFB834F,10,563
est9=AFO740F,10,611
est10=VFJ411F,15,611
est11=AFJ444F,17,535
est12=FC-BS15F,33,670
est13=VSG539F,44,182
est14=AFE373F,54,574
est15=AFJ444Z,671,1424
est16=VFJ411Z,674,1385
est17=AFA645Z,678,1426
est18=AFB715Z,701,1395
est19=AFB834Z,708,1389
est20=AFB193Z,709,1420
est21=AFD838Z,712,1389
est22=AFE373Z,714,1426
est23=FC-BS15Z,720,1444
est24=VFJ668Z,737,1389
est25=AFO740Z,757,1426
est26=AHN411Z,759,1421
est27=AFA307Z,802,1398
est28=AFB160Z,1165,1379
Translated Amino Acid sequence
srfnllfvvwlcinrie*NMLKSLSKLTPSIRGVVSINRSFCTKKFLPTNRSVSESDPEI
YDLMMKEKQRQFTGLELIASENFTSRAVMESIGSCFTNKYAEGLPGARYYGGNEVVDQLE
NLCIKRALETFNLNPEEWGVNVQPYSGSTANFAAFTGLLKPHDRIMGLDLPSGGHLTHGY
QTDKKKISATSIFFESMPYQVNETGYVDYNKMEANAALFRPKL---

---LCDMAHISGMVAGKQAISPFLFCDVVTTTTHKTLRGPRAGLIFFRKTKRRDAKGNII
DDDLENRINFAVFPSCQGGPHENTIAGIAVALKEASSPDFQEYTKQVRRNSQTMGEELKK
RGYSLVTEGTDNHLVLWDLRPQGITGSKIEKACDEAHITVNKNAVYGDTNAIAPGGVRLG
APALTSRGLKEQDFVKVVDFLDRVVKISLDIQSKVGKKMPDFQRAIADNQDLKQIRQEVK
EFSTKFGMPGEL*nkiikkkk


Translated Amino Acid sequence (All Frames)
Frame A:
srfnllfvvwlcinrie*NMLKSLSKLTPSIRGVVSINRSFCTKKFLPTNRSVSESDPEI
YDLMMKEKQRQFTGLELIASENFTSRAVMESIGSCFTNKYAEGLPGARYYGGNEVVDQLE
NLCIKRALETFNLNPEEWGVNVQPYSGSTANFAAFTGLLKPHDRIMGLDLPSGGHLTHGY
QTDKKKISATSIFFESMPYQVNETGYVDYNKMEANAALFRPKL---

---LCDMAHISGMVAGKQAISPFLFCDVVTTTTHKTLRGPRAGLIFFRKTKRRDAKGNII
DDDLENRINFAVFPSCQGGPHENTIAGIAVALKEASSPDFQEYTKQVRRNSQTMGEELKK
RGYSLVTEGTDNHLVLWDLRPQGITGSKIEKACDEAHITVNKNAVYGDTNAIAPGGVRLG
APALTSRGLKEQDFVKVVDFLDRVVKISLDIQSKVGKKMPDFQRAIADNQDLKQIRQEVK
EFSTKFGMPGEL*nkiikkkk

Frame B:
vdsiccllfgcv*ie*nkic*shypnlhpqleewfq*tevfapknsylqidqsvnqiqrf
mi***krnkdnlqv*n*lllkilhleqlwnqldhvlqinmqrvyqvqdimvvmkllin*r
iyvlkehwkhli*iqkngv*mynhivavllilllslvy*nhmiv*wv*iyhlvvi*hmvi
kqikkklvqlvfslnqchiklmkqvm*iiirwrqmqhyldqnf---

---fviwhilvvwsqvnkqfhlsfsvml*pqppikl*evhvlvlsfserlnvempkvtss
mmtskieltlqfshlvkvvhtkilslvllsl*rkphlqisknilnkseetlkpwaknskr
evihs*pkvpiii*ffgildhkvslavklkrlvtklisl*ikmlsmviqmqsllvvyv*v
lllsqaevsknktllkssis*ivslksl*isnqklvrkcqiskeqsliiki*nkldkklk
nsllnlvcqvnykik**kkk

Frame C:
siqfvvcclvvyk*nrikyvkviiqtytln*rsgfnkqkflhqkiltyk*isq*irsrdl
*fnderetktiyrfrincf*kfyi*ssyginwimfyk*icrgftrckilww**sc*sire
fmy*ksigni*fksrrmgckctti*wqyc*fccfhwfiktt*syngfrftiwwsfntwls
nr*kkn*cn*yfl*inaiss**nrlcrl**dggkcsii*tkt---

---l*ygty*wygrr*tsnftfpfl*ccnhnhp*nfkrstcwsylfqkd*t*rcqr*hhr
**prk*n*lcsfpilsrwstrkyyrwyccrfegslisrfpriy*tsqkklsnhgrrtqke
rlftrnrryr*sfsslgs*ttryhwq*n*kgl*rssyhck*kcclw*ykcnrswwctfrc
scshkqrsqrtrlc*srrflrscr*nlfrypiksw*enarfpksnr**srfktn*trs*r
ily*iwyar*iik*nnkkkk

own update 2004. 6.23
Homology vs CSM-cDNA
Query= Contig-U15526-1 (Contig-U15526-1Q)
/CSM_Contig/Contig-U15526-1Q.Seq.d
(1454 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U15526-1 (Contig-U15526-1Q) /CSM_Contig/Conti... 2738 0.0
Contig-U14919-1 (Contig-U14919-1Q) /CSM_Contig/Conti... 182 1e-45
Contig-U06445-1 (Contig-U06445-1Q) /CSM_Contig/Conti... 40 0.009
Contig-U15751-1 (Contig-U15751-1Q) /CSM_Contig/Conti... 38 0.037
Contig-U16497-1 (Contig-U16497-1Q) /CSM_Contig/Conti... 36 0.15
Contig-U16015-1 (Contig-U16015-1Q) /CSM_Contig/Conti... 36 0.15
Contig-U13724-1 (Contig-U13724-1Q) /CSM_Contig/Conti... 36 0.15
Contig-U12138-1 (Contig-U12138-1Q) /CSM_Contig/Conti... 36 0.15
Contig-U11411-1 (Contig-U11411-1Q) /CSM_Contig/Conti... 36 0.15
Contig-U09338-1 (Contig-U09338-1Q) /CSM_Contig/Conti... 36 0.15

>Contig-U15526-1 (Contig-U15526-1Q) /CSM_Contig/Contig-U15526-1Q.Seq.d
Length = 1454

Score = 2738 bits (1381), Expect = 0.0
Identities = 1431/1441 (99%)
Strand = Plus / Plus


Query: 1 agtcgattcaatttgttgtttgttgtttggttgtgtataaatagaatagaataaaatatg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 agtcgattcaatttgttgtttgttgtttggttgtgtataaatagaatagaataaaatatg 60


Query: 61 ttaaagtcattatccaaacttacaccctcaattagaggagtggtttcaataaacagaagt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ttaaagtcattatccaaacttacaccctcaattagaggagtggtttcaataaacagaagt 120


Query: 121 ttttgcaccaaaaaattcttacctacaaatagatcagtcagtgaatcagatccagagatt 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ttttgcaccaaaaaattcttacctacaaatagatcagtcagtgaatcagatccagagatt 180


Query: 181 tatgatttaatgatgaaagagaaacaaagacaatttacaggtttagaattaattgcttct 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tatgatttaatgatgaaagagaaacaaagacaatttacaggtttagaattaattgcttct 240


Query: 241 gaaaattttacatctagagcagttatggaatcaattggatcatgttttacaaataaatat 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gaaaattttacatctagagcagttatggaatcaattggatcatgttttacaaataaatat 300


Query: 301 gcagagggtttaccaggtgcaagatattatggtggtaatgaagttgttgatcaattagag 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gcagagggtttaccaggtgcaagatattatggtggtaatgaagttgttgatcaattagag 360


Query: 361 aatttatgtattaaaagagcattggaaacatttaatttaaatccagaagaatggggtgta 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 aatttatgtattaaaagagcattggaaacatttaatttaaatccagaagaatggggtgta 420


Query: 421 aatgtacaaccatatagtggcagtactgctaattttgctgctttcactggtttattaaaa 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aatgtacaaccatatagtggcagtactgctaattttgctgctttcactggtttattaaaa 480


Query: 481 ccacatgatcgtataatgggtttagatttaccatctggtggtcatttaacacatggttat 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 ccacatgatcgtataatgggtttagatttaccatctggtggtcatttaacacatggttat 540


Query: 541 caaacagatnnnnnnnnnnttagtgcaactagtattttctttgaatcaatgccatatcaa 600
||||||||| |||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 caaacagataaaaaaaaaattagtgcaactagtattttctttgaatcaatgccatatcaa 600


Query: 601 gttaatgaaacaggttatgtagattataataagatggaggcaaatgcagcattatttaga 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 gttaatgaaacaggttatgtagattataataagatggaggcaaatgcagcattatttaga 660


Query: 661 ccaaaactttnnnnnnnnnnctttgtgatatggcacatattagtggtatggtcgcaggta 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 ccaaaactttnnnnnnnnnnctttgtgatatggcacatattagtggtatggtcgcaggta 720


Query: 721 aacaagcaatttcacctttccttttctgtgatgttgtaaccacaaccacccataaaactt 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 aacaagcaatttcacctttccttttctgtgatgttgtaaccacaaccacccataaaactt 780


Query: 781 taagaggtccacgtgctggtcttatctttttcagaaagactaaacgtagagatgccaaag 840
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 781 taagaggtccacgtgctggtcttatctttttcagaaagactaaacgtagagatgccaaag 840


Query: 841 gtaacatcatcgatgatgacctcgaaaatagaattaactttgcagttttcccatcttgtc 900
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 841 gtaacatcatcgatgatgacctcgaaaatagaattaactttgcagttttcccatcttgtc 900


Query: 901 aaggtggtccacacgaaaatactatcgctggtattgctgtcgctttgaaggaagcctcat 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 901 aaggtggtccacacgaaaatactatcgctggtattgctgtcgctttgaaggaagcctcat 960


Query: 961 ctccagatttccaagaatatactaaacaagtcagaagaaactctcaaaccatgggcgaag 1020
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 961 ctccagatttccaagaatatactaaacaagtcagaagaaactctcaaaccatgggcgaag 1020


Query: 1021 aactcaaaaagagaggttattcactcgtaaccgaaggtaccgataatcatttagttcttt 1080
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1021 aactcaaaaagagaggttattcactcgtaaccgaaggtaccgataatcatttagttcttt 1080


Query: 1081 gggatcttagaccacaaggtatcactggcagtaaaattgaaaaggcttgtgacgaagctc 1140
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1081 gggatcttagaccacaaggtatcactggcagtaaaattgaaaaggcttgtgacgaagctc 1140


Query: 1141 atatcactgtaaataaaaatgctgtctatggtgatacaaatgcaatcgctcctggtggtg 1200
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1141 atatcactgtaaataaaaatgctgtctatggtgatacaaatgcaatcgctcctggtggtg 1200


Query: 1201 tacgtttaggtgctcctgctctcacaagcagaggtctcaaagaacaagactttgttaaag 1260
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1201 tacgtttaggtgctcctgctctcacaagcagaggtctcaaagaacaagactttgttaaag 1260


Query: 1261 tcgtcgatttcttagatcgtgtcgttaaaatctctttagatatccaatcaaaagttggta 1320
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1261 tcgtcgatttcttagatcgtgtcgttaaaatctctttagatatccaatcaaaagttggta 1320


Query: 1321 agaaaatgccagatttccaaagagcaatcgctgataatcaagatttaaaacaaattagac 1380
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1321 agaaaatgccagatttccaaagagcaatcgctgataatcaagatttaaaacaaattagac 1380


Query: 1381 aagaagttaaagaattctctactaaatttggtatgccaggtgaattataaaataaaataa 1440
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1381 aagaagttaaagaattctctactaaatttggtatgccaggtgaattataaaataaaataa 1440


Query: 1441 t 1441
|
Sbjct: 1441 t 1441


>Contig-U14919-1 (Contig-U14919-1Q) /CSM_Contig/Contig-U14919-1Q.Seq.d
Length = 1539

Score = 182 bits (92), Expect = 1e-45
Identities = 137/152 (90%)
Strand = Plus / Plus


Query: 208 agacaatttacaggtttagaattaattgcttctgaaaattttacatctagagcagttatg 267
|||||||||| |||||||||||||||||| ||||||||||||||||| ||||||||||||
Sbjct: 148 agacaatttaaaggtttagaattaattgcctctgaaaattttacatcaagagcagttatg 207


Query: 268 gaatcaattggatcatgttttacaaataaatatgcagagggtttaccaggtgcaagatat 327
||| || | |||||| ||||||||||||||||||||| |||| |||||| ||||||||
Sbjct: 208 gaagcattaggatcacattttacaaataaatatgcagaaggttatccaggttcaagatat 267


Query: 328 tatggtggtaatgaagttgttgatcaattaga 359
|||||||||| |||||||||||| |||||||
Sbjct: 268 tatggtggtacagaagttgttgatgaattaga 299


Score = 127 bits (64), Expect = 5e-29
Identities = 118/136 (86%)
Strand = Plus / Plus


Query: 410 aatggggtgtaaatgtacaaccatatagtggcagtactgctaattttgctgctttcactg 469
|||||||||| ||||| |||||||| ||||| ||| | || ||||| || | || ||| |
Sbjct: 350 aatggggtgttaatgttcaaccatacagtggtagtccagccaatttcgcagtttacacag 409


Query: 470 gtttattaaaaccacatgatcgtataatgggtttagatttaccatctggtggtcatttaa 529
||||||| |||||| ||||||||||||||||||||||||||||| |||||||||||||
Sbjct: 410 cattattaagaccacacgatcgtataatgggtttagatttaccatcaggtggtcatttaa 469


Query: 530 cacatggttatcaaac 545
| ||||||||||||||
Sbjct: 470 ctcatggttatcaaac 485


Score = 54.0 bits (27), Expect = 6e-07
Identities = 78/95 (82%)
Strand = Plus / Plus


Query: 1141 atatcactgtaaataaaaatgctgtctatggtgatacaaatgcaatcgctcctggtggtg 1200
||||||| || ||||||||||| ||| |||||||||| |||||||| | || ||||||
Sbjct: 1159 atatcaccgtcaataaaaatgccgtccatggtgataccaatgcaatttcaccaggtggta 1218


Query: 1201 tacgtttaggtgctcctgctctcacaagcagaggt 1235
| ||| | ||| | ||||||||||||| ||||||
Sbjct: 1219 ttcgtattggttcatctgctctcacaagtagaggt 1253


Score = 48.1 bits (24), Expect = 4e-05
Identities = 42/48 (87%)
Strand = Plus / Plus


Query: 747 tgtgatgttgtaaccacaaccacccataaaactttaagaggtccacgt 794
||||||||||| |||| ||||| |||||||| |||||||| ||||||
Sbjct: 761 tgtgatgttgtcaccagtaccactcataaaaccttaagaggaccacgt 808


Score = 46.1 bits (23), Expect = 2e-04
Identities = 50/59 (84%)
Strand = Plus / Plus


Query: 882 gcagttttcccatcttgtcaaggtggtccacacgaaaatactatcgctggtattgctgt 940
|||||||||||||| |||||||||||||| |||||| ||| |||||| |||||||
Sbjct: 900 gcagttttcccatcactccaaggtggtccacatgaaaatgttattgctggtgttgctgt 958


Score = 36.2 bits (18), Expect = 0.15
Identities = 18/18 (100%)
Strand = Plus / Plus


Query: 583 gaatcaatgccatatcaa 600
||||||||||||||||||
Sbjct: 523 gaatcaatgccatatcaa 540


Score = 32.2 bits (16), Expect = 2.3
Identities = 19/20 (95%)
Strand = Plus / Plus


Query: 1381 aagaagttaaagaattctct 1400
|||||||| |||||||||||
Sbjct: 1399 aagaagttgaagaattctct 1418


>Contig-U06445-1 (Contig-U06445-1Q) /CSM_Contig/Contig-U06445-1Q.Seq.d
Length = 243

Score = 40.1 bits (20), Expect = 0.009
Identities = 20/20 (100%)
Strand = Plus / Minus


Query: 1421 tgaattataaaataaaataa 1440
||||||||||||||||||||
Sbjct: 52 tgaattataaaataaaataa 33


Database: CSM
Posted date: Jun 21, 2004 1:35 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 24,883
Number of Sequences: 8402
Number of extensions: 24883
Number of successful extensions: 3447
Number of sequences better than 10.0: 332
length of query: 1454
length of database: 8,075,542
effective HSP length: 16
effective length of query: 1438
effective length of database: 7,941,110
effective search space: 11419316180
effective search space used: 11419316180
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 1.31
Homology vs DNA
Query= Contig-U15526-1 (Contig-U15526-1Q) /CSM_Contig/Contig-U15526-1Q.Seq.d
(1454 letters)

Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ346517) Dictyostelium discoideum cDNA clone:dda24n05, 3' ... 1433 0.0 2
(BJ340493) Dictyostelium discoideum cDNA clone:dda2i12, 3' e... 1417 0.0 3
(BJ346624) Dictyostelium discoideum cDNA clone:dda24c14, 3' ... 1415 0.0 1
(AU284994) Dictyostelium discoideum gamete cDNA clone:FC-BS1... 1388 0.0 1
(BJ342160) Dictyostelium discoideum cDNA clone:dda9b19, 3' e... 1382 0.0 2
(BJ340789) Dictyostelium discoideum cDNA clone:dda3i23, 3' e... 1368 0.0 1
(BJ346290) Dictyostelium discoideum cDNA clone:dda30p09, 3' ... 1296 0.0 1
(BJ355432) Dictyostelium discoideum cDNA clone:dda57f04, 3' ... 1261 0.0 1
(BJ340889) Dictyostelium discoideum cDNA clone:dda4d10, 3' e... 1251 0.0 2
(BJ342692) Dictyostelium discoideum cDNA clone:dda1n01, 3' e... 1152 0.0 1
(BJ337332) Dictyostelium discoideum cDNA clone:dda57f04, 5' ... 1088 0.0 1
(BJ326045) Dictyostelium discoideum cDNA clone:dda3g15, 5' e... 1088 0.0 2
(BJ325804) Dictyostelium discoideum cDNA clone:dda2i12, 5' e... 1088 0.0 2
(BJ361144) Dictyostelium discoideum cDNA clone:ddc9g03, 5' e... 1080 0.0 1
(BJ329307) Dictyostelium discoideum cDNA clone:dda24c14, 5' ... 1080 0.0 1
(BJ329212) Dictyostelium discoideum cDNA clone:dda24n05, 5' ... 1072 0.0 2
(BJ324858) Dictyostelium discoideum cDNA clone:dda8l10, 5' e... 1068 0.0 2
(BJ329014) Dictyostelium discoideum cDNA clone:dda30p09, 5' ... 1066 0.0 2
(BJ414842) Dictyostelium discoideum cDNA clone:ddv20g18, 5' ... 1063 0.0 2
(BJ432562) Dictyostelium discoideum cDNA clone:ddv19f04, 3' ... 1025 0.0 2
(AU284993) Dictyostelium discoideum gamete cDNA clone:FC-BS1... 1017 0.0 2
(BJ344449) Dictyostelium discoideum cDNA clone:dda19h12, 3' ... 963 0.0 2
(BJ340863) Dictyostelium discoideum cDNA clone:dda4n03, 3' e... 904 0.0 3
(BJ341842) Dictyostelium discoideum cDNA clone:dda8l10, 3' e... 876 0.0 3
(BJ433038) Dictyostelium discoideum cDNA clone:ddv20g18, 3' ... 833 0.0 4
(BJ414407) Dictyostelium discoideum cDNA clone:ddv19f04, 5' ... 779 0.0 3
(BJ323978) Dictyostelium discoideum cDNA clone:dda4n03, 5' e... 779 0.0 3
(BJ324001) Dictyostelium discoideum cDNA clone:dda4d10, 5' e... 779 0.0 2
(BJ327148) Dictyostelium discoideum cDNA clone:dda19h12, 5' ... 997 0.0 1
(BJ325112) Dictyostelium discoideum cDNA clone:dda9b19, 5' e... 983 0.0 2
(BJ340729) Dictyostelium discoideum cDNA clone:dda3g15, 3' e... 412 e-110 1
(BJ326782) Dictyostelium discoideum cDNA clone:dda18b03, 5' ... 182 1e-71 3
(BJ389960) Dictyostelium discoideum cDNA clone:dds20n17, 5' ... 182 1e-71 3
(BJ326916) Dictyostelium discoideum cDNA clone:dda18b16, 5' ... 182 1e-71 3
(BJ329796) Dictyostelium discoideum cDNA clone:dda26g11, 5' ... 182 1e-71 3
(BJ387596) Dictyostelium discoideum cDNA clone:dds3j13, 5' e... 182 1e-71 3
(BJ414680) Dictyostelium discoideum cDNA clone:ddv20h01, 5' ... 182 1e-71 3
(BJ388067) Dictyostelium discoideum cDNA clone:dds7a21, 5' e... 182 1e-71 3
(BJ388166) Dictyostelium discoideum cDNA clone:dds8p04, 5' e... 182 1e-71 3
(BJ410417) Dictyostelium discoideum cDNA clone:ddv12p07, 5' ... 182 1e-71 3
(BJ327163) Dictyostelium discoideum cDNA clone:dda19m09, 5' ... 182 1e-71 3
(BJ323434) Dictyostelium discoideum cDNA clone:dda10g14, 5' ... 182 1e-71 3
(BJ363785) Dictyostelium discoideum cDNA clone:ddc28b18, 5' ... 182 1e-71 3
(BJ411315) Dictyostelium discoideum cDNA clone:ddv3j22, 5' e... 182 1e-71 3
(BJ360587) Dictyostelium discoideum cDNA clone:ddc6i22, 5' e... 182 1e-71 3
(BJ324105) Dictyostelium discoideum cDNA clone:dda4e21, 5' e... 182 1e-71 3
(BJ411946) Dictyostelium discoideum cDNA clone:ddv6m09, 5' e... 182 1e-71 3
(BJ362020) Dictyostelium discoideum cDNA clone:ddc19c21, 5' ... 182 1e-71 3
(BJ360433) Dictyostelium discoideum cDNA clone:ddc6h03, 5' e... 182 1e-71 3
(BJ325017) Dictyostelium discoideum cDNA clone:dda9b07, 5' e... 182 1e-71 3
(BJ412796) Dictyostelium discoideum cDNA clone:ddv9l20, 5' e... 182 1e-71 3
(BJ328394) Dictyostelium discoideum cDNA clone:dda28d02, 5' ... 182 1e-71 3
(BJ413198) Dictyostelium discoideum cDNA clone:ddv14f18, 5' ... 182 1e-71 3
(BJ324268) Dictyostelium discoideum cDNA clone:dda5e13, 5' e... 182 1e-71 3
(BJ324557) Dictyostelium discoideum cDNA clone:dda6k20, 5' e... 182 1e-71 3
(BJ324697) Dictyostelium discoideum cDNA clone:dda7d18, 5' e... 182 1e-71 3
(BJ418461) Dictyostelium discoideum cDNA clone:ddv32h20, 5' ... 182 1e-71 3
(BJ359351) Dictyostelium discoideum cDNA clone:ddc14b04, 5' ... 182 1e-71 3
(BJ388020) Dictyostelium discoideum cDNA clone:dds7p11, 5' e... 182 1e-71 3
(BJ387763) Dictyostelium discoideum cDNA clone:dds4c24, 5' e... 182 1e-71 3
(BJ411403) Dictyostelium discoideum cDNA clone:ddv4d11, 5' e... 182 1e-71 3
(BJ325872) Dictyostelium discoideum cDNA clone:dda2a19, 5' e... 182 2e-71 3
(BJ416530) Dictyostelium discoideum cDNA clone:ddv26p15, 5' ... 182 2e-71 3
(BJ417689) Dictyostelium discoideum cDNA clone:ddv28o09, 5' ... 182 2e-71 3
(BJ388557) Dictyostelium discoideum cDNA clone:dds6l06, 5' e... 182 2e-71 3
(BJ386984) Dictyostelium discoideum cDNA clone:dds11p18, 5' ... 182 2e-71 3
(BJ330003) Dictyostelium discoideum cDNA clone:dda27e03, 5' ... 182 2e-71 3
(BJ323389) Dictyostelium discoideum cDNA clone:dda10i08, 5' ... 182 2e-71 3
(BJ417551) Dictyostelium discoideum cDNA clone:ddv28a01, 5' ... 182 2e-71 3
(BJ328071) Dictyostelium discoideum cDNA clone:dda22g21, 5' ... 182 2e-71 3
(C24611) Dictyostelium discoideum slug cDNA, clone SL-X006. 182 2e-71 3
(BJ359446) Dictyostelium discoideum cDNA clone:ddc14a24, 5' ... 182 2e-71 3
(BJ323609) Dictyostelium discoideum cDNA clone:dda11k11, 5' ... 182 2e-71 3
(BJ360603) Dictyostelium discoideum cDNA clone:ddc6n20, 5' e... 182 2e-71 3
(BJ328473) Dictyostelium discoideum cDNA clone:dda28f11, 5' ... 182 2e-71 3
(BJ390177) Dictyostelium discoideum cDNA clone:dds21m09, 5' ... 182 2e-71 3
(BJ358926) Dictyostelium discoideum cDNA clone:ddc11o24, 5' ... 182 2e-71 3
(BJ390153) Dictyostelium discoideum cDNA clone:dds21h08, 5' ... 182 2e-71 3
(BJ414982) Dictyostelium discoideum cDNA clone:ddv21f04, 5' ... 182 2e-71 3
(BJ389474) Dictyostelium discoideum cDNA clone:dds18k22, 5' ... 182 2e-71 3
(BJ328899) Dictyostelium discoideum cDNA clone:dda30c03, 5' ... 182 2e-71 3
(BJ390064) Dictyostelium discoideum cDNA clone:dds21f02, 5' ... 176 7e-70 3
(BJ329944) Dictyostelium discoideum cDNA clone:dda26g21, 5' ... 174 3e-69 3
(BJ410873) Dictyostelium discoideum cDNA clone:ddv2m05, 5' e... 182 3e-69 3
(BJ325565) Dictyostelium discoideum cDNA clone:dda1m11, 5' e... 174 3e-69 3
(BJ387708) Dictyostelium discoideum cDNA clone:dds4i11, 5' e... 174 3e-69 3
(BJ323428) Dictyostelium discoideum cDNA clone:dda10e14, 5' ... 174 3e-69 3
(BJ417033) Dictyostelium discoideum cDNA clone:ddv29n06, 5' ... 182 5e-68 2
(BJ326009) Dictyostelium discoideum cDNA clone:dda3k12, 5' e... 182 5e-68 2
(BJ358522) Dictyostelium discoideum cDNA clone:ddc1o22, 5' e... 167 8e-67 3
(BJ416088) Dictyostelium discoideum cDNA clone:ddv24m21, 5' ... 182 3e-66 2
(BJ325598) Dictyostelium discoideum cDNA clone:dda1f14, 5' e... 115 1e-65 4
(BJ391347) Dictyostelium discoideum cDNA clone:dds13k09, 5' ... 167 3e-63 2
(BJ415618) Dictyostelium discoideum cDNA clone:ddv23l02, 5' ... 182 1e-62 2
(BJ391339) Dictyostelium discoideum cDNA clone:dds13h10, 5' ... 149 1e-61 3
(BJ360113) Dictyostelium discoideum cDNA clone:ddc4i08, 5' e... 182 2e-61 2
(AU264808) Dictyostelium discoideum vegetative cDNA clone:VS... 182 2e-41 1
(BJ389431) Dictyostelium discoideum cDNA clone:dds18a19, 5' ... 182 2e-41 1
(BJ388530) Dictyostelium discoideum cDNA clone:dds6c02, 5' e... 182 2e-41 1
(BJ326184) Dictyostelium discoideum cDNA clone:dda15i18, 5' ... 182 2e-41 1
(AU266606) Dictyostelium discoideum vegetative cDNA clone:VS... 180 1e-40 1
(BJ417299) Dictyostelium discoideum cDNA clone:ddv30k04, 5' ... 115 7e-40 4
(BJ360750) Dictyostelium discoideum cDNA clone:ddc7n15, 5' e... 174 6e-39 1
(BJ325713) Dictyostelium discoideum cDNA clone:dda1j04, 5' e... 170 9e-38 1
(EH012294) USDA-FP_185208 Lysiphlebus testaceipes adult whol... 60 4e-30 5
(EH014367) USDA-FP_187075 Lysiphlebus testaceipes adult whol... 60 4e-30 5
(BJ359449) Dictyostelium discoideum cDNA clone:ddc14b24, 5' ... 145 5e-30 1
(BJ399141) Dictyostelium discoideum cDNA clone:dds4i11, 3' e... 52 1e-28 7
(BJ341178) Dictyostelium discoideum cDNA clone:dda5e13, 3' e... 52 1e-28 7
(BJ340036) Dictyostelium discoideum cDNA clone:dda11k11, 3' ... 52 1e-28 7
(BJ344122) Dictyostelium discoideum cDNA clone:dda18b16, 3' ... 52 1e-28 7
(BJ374234) Dictyostelium discoideum cDNA clone:ddc6h03, 3' e... 52 1e-28 7
(BJ435301) Dictyostelium discoideum cDNA clone:ddv26p15, 3' ... 52 1e-28 7
(BJ430197) Dictyostelium discoideum cDNA clone:ddv6m09, 3' e... 52 1e-28 7
(BJ339830) Dictyostelium discoideum cDNA clone:dda10g14, 3' ... 52 1e-28 7
(BJ344280) Dictyostelium discoideum cDNA clone:dda18b03, 3' ... 52 1e-28 7
(BJ339824) Dictyostelium discoideum cDNA clone:dda10e14, 3' ... 52 1e-28 7
(BJ347174) Dictyostelium discoideum cDNA clone:dda26g11, 3' ... 52 1e-28 7
(BJ343358) Dictyostelium discoideum cDNA clone:dda22g21, 3' ... 52 1e-28 7
(BJ434767) Dictyostelium discoideum cDNA clone:ddv24m21, 3' ... 52 1e-28 7
(BJ399206) Dictyostelium discoideum cDNA clone:dds4c24, 3' e... 52 2e-28 7
(BJ347417) Dictyostelium discoideum cDNA clone:dda27e03, 3' ... 52 2e-28 7
(BJ399781) Dictyostelium discoideum cDNA clone:dds7p11, 3' e... 52 2e-28 7
(BJ374192) Dictyostelium discoideum cDNA clone:ddc6n20, 3' e... 52 2e-28 7
(BJ345543) Dictyostelium discoideum cDNA clone:dda28d02, 3' ... 52 2e-28 7
(BJ431548) Dictyostelium discoideum cDNA clone:ddv14f18, 3' ... 52 2e-28 7
(BJ375733) Dictyostelium discoideum cDNA clone:ddc19c21, 3' ... 52 2e-28 7
(BJ374176) Dictyostelium discoideum cDNA clone:ddc6i22, 3' e... 52 2e-28 7
(BJ372281) Dictyostelium discoideum cDNA clone:ddc11o24, 3' ... 52 2e-28 7
(BJ414672) Dictyostelium discoideum cDNA clone:ddv20f03, 5' ... 107 3e-27 4
(BJ341491) Dictyostelium discoideum cDNA clone:dda6k20, 3' e... 52 4e-27 6
(EJ391531) 1092963940338 Global-Ocean-Sampling_GS-28-01-01-1... 92 4e-26 4
(DY889615) CeleSEQ11548 Cunninghamella elegans pBluescript (... 86 9e-26 4
(BJ340696) Dictyostelium discoideum cDNA clone:dda3k12, 3' e... 52 3e-25 6
(BJ346149) Dictyostelium discoideum cDNA clone:dda30c03, 3' ... 52 3e-25 6
(BJ372761) Dictyostelium discoideum cDNA clone:ddc14b04, 3' ... 52 4e-25 6
(BJ400450) Dictyostelium discoideum cDNA clone:dds13h10, 3' ... 52 4e-25 6
(BJ372882) Dictyostelium discoideum cDNA clone:ddc14a24, 3' ... 52 5e-25 6
(BJ436149) Dictyostelium discoideum cDNA clone:ddv30k04, 3' ... 52 5e-25 6
(BJ429043) Dictyostelium discoideum cDNA clone:ddv2m05, 3' e... 52 5e-25 6
(BJ373210) Dictyostelium discoideum cDNA clone:ddc1o22, 3' e... 52 5e-25 6
(BJ402976) Dictyostelium discoideum cDNA clone:dds18k22, 3' ... 52 5e-25 6
(BJ435971) Dictyostelium discoideum cDNA clone:ddv29n06, 3' ... 52 5e-25 6
(BJ399438) Dictyostelium discoideum cDNA clone:dds6c02, 3' e... 52 5e-25 6
(BJ344469) Dictyostelium discoideum cDNA clone:dda19m09, 3' ... 52 6e-25 6
(BJ432853) Dictyostelium discoideum cDNA clone:ddv20f03, 3' ... 52 7e-25 6
(EC825401) SME00009760 esmbsro2 Sawyeria marylandensis cDNA,... 60 5e-22 5
(EL566201) Physarum14232 Physarum polycephalum starvation st... 46 6e-22 6
(EL572098) Physarum14223 Physarum polycephalum starvation st... 46 9e-22 6
(BJ398267) Dictyostelium discoideum cDNA clone:dds11p18, 3' ... 52 1e-21 5
(EC820661) SME00001968 esmbsro2 Sawyeria marylandensis cDNA,... 60 3e-21 4
(BJ431107) Dictyostelium discoideum cDNA clone:ddv9l20, 3' e... 52 9e-21 6
(BJ428572) Dictyostelium discoideum cDNA clone:ddv12p07, 3' ... 52 9e-21 6
(BJ402929) Dictyostelium discoideum cDNA clone:dds18a19, 3' ... 52 9e-21 6
(AU075918) Dictyostelium discoideum slug cDNA, clone SSA106. 52 9e-21 6
(BJ347341) Dictyostelium discoideum cDNA clone:dda26g21, 3' ... 52 9e-21 6
(BJ402165) Dictyostelium discoideum cDNA clone:dds20n17, 3' ... 52 1e-20 6
(BJ376579) Dictyostelium discoideum cDNA clone:ddc29j05, 3' ... 52 1e-20 6
(BJ345636) Dictyostelium discoideum cDNA clone:dda28f11, 3' ... 52 1e-20 6
(DV160254) KP1B.102L12F.050722T7 KP1B Nicotiana tabacum cDNA... 72 2e-20 5
(BJ436986) Dictyostelium discoideum cDNA clone:ddv32h20, 3' ... 52 2e-20 6
(FC745209) CBBI14782.fwd CBBI Lottia gigantea 26h,37h,61h La... 58 3e-20 5
(FD450065) EGGA313TF Haematobia irritans eggs Haematobia irr... 60 6e-20 3
(EL567230) Physarum14226 Physarum polycephalum starvation st... 46 9e-20 6
(FH322053) CHO_OF4542xm02f1.ab1 CHO_OF4 Nicotiana tabacum ge... 68 1e-19 3
(ET969115) CHO_OF641xk11f1.ab1 CHO_OF Nicotiana tabacum geno... 68 1e-19 3
(FI045417) CHO_OF6474xh01r1.ab1 CHO_OF6 Nicotiana tabacum ge... 68 1e-19 3
(FG174283) AGN_RNC124xo20f1.ab1 AGN_RNC Nicotiana tabacum cD... 68 2e-19 3
(FG143594) AGN_RPC018xe10f1.ab1 AGN_RPC Nicotiana tabacum cD... 68 2e-19 3
(FG086706) CMRC-FF-IH0-ace-j-12-0-CMRC.r1 Ceratitis capitata... 72 3e-19 2
(BJ433856) Dictyostelium discoideum cDNA clone:ddv23l02, 3' ... 52 4e-19 6
(EB740747) EST00024 Elicitor-treated opium poppy cell cultur... 64 7e-19 4
(FD456670) EGGB924TR Haematobia irritans eggs Haematobia irr... 60 3e-18 3
(FE967756) PLATE_T3_041_F10_03DEC2004_070 Opium poppy elicit... 64 3e-18 4
(FD456808) EGGBA09TR Haematobia irritans eggs Haematobia irr... 60 4e-18 3
(BJ399010) Dictyostelium discoideum cDNA clone:dds3j13, 3' e... 52 2e-17 5
(BJ432861) Dictyostelium discoideum cDNA clone:ddv20h01, 3' ... 52 2e-17 5
(BJ435707) Dictyostelium discoideum cDNA clone:ddv28a01, 3' ... 52 2e-17 5
(BJ341639) Dictyostelium discoideum cDNA clone:dda7d18, 3' e... 52 2e-17 5
(BJ399847) Dictyostelium discoideum cDNA clone:dds7a21, 3' e... 52 2e-17 5
(BJ342781) Dictyostelium discoideum cDNA clone:dda1f14, 3' e... 52 2e-17 5
(BJ339782) Dictyostelium discoideum cDNA clone:dda10i08, 3' ... 52 2e-17 5
(BJ374411) Dictyostelium discoideum cDNA clone:ddc7n15, 3' e... 52 2e-17 5
(AU264809) Dictyostelium discoideum vegetative cDNA clone:VS... 52 2e-17 5
(BJ373660) Dictyostelium discoideum cDNA clone:ddc4i08, 3' e... 52 2e-17 5
(BJ433195) Dictyostelium discoideum cDNA clone:ddv21f04, 3' ... 52 3e-17 5
(BJ400463) Dictyostelium discoideum cDNA clone:dds13k09, 3' ... 52 3e-17 5
(BJ399477) Dictyostelium discoideum cDNA clone:dds6l06, 3' e... 52 3e-17 5
(BJ341012) Dictyostelium discoideum cDNA clone:dda4e21, 3' e... 52 3e-17 5
(FG184533) AGN_PNL208bf1_d10.trimmed.seq AGN_PNL Nicotiana t... 72 5e-17 4
(FG169386) AGN_RNC004xl16f1.ab1 AGN_RNC Nicotiana tabacum cD... 70 9e-17 4
(FG139524) AGN_ELP024xf13f1.ab1 AGN_ELP Nicotiana tabacum cD... 72 9e-17 4
(BJ429537) Dictyostelium discoideum cDNA clone:ddv3j22, 3' e... 52 9e-17 5
(DT737972) EST1171821 Aquilegia cDNA library Aquilegia formo... 76 2e-16 4
(EJ588667) 1092961036144 Global-Ocean-Sampling_GS-29-01-01-1... 44 3e-16 5
(DR912974) EST1104513 Aquilegia cDNA library Aquilegia formo... 76 3e-16 4
(BJ399965) Dictyostelium discoideum cDNA clone:dds8p04, 3' e... 46 6e-16 5
(AR548230) Sequence 3361 from patent US 6747137. 48 9e-16 6
(EY475951) METAL95TF JCVI-MT3 Medicago truncatula cDNA 5', m... 56 9e-16 4
(BJ342746) Dictyostelium discoideum cDNA clone:dda1m11, 3' e... 52 1e-15 5
(CB892119) EST649088 KV3 Medicago truncatula cDNA clone KV3-... 56 1e-15 4
(CV298075) EST886534 petunia floral post-pollination cDNA li... 82 1e-15 3
(FG142695) AGN_RPC021xb17f1.ab1 AGN_RPC Nicotiana tabacum cD... 66 1e-15 4
(BJ374233) Dictyostelium discoideum cDNA clone:ddc6h02, 3' e... 46 2e-15 5
(FH236243) CHO_OF3432xe09r1.ab1 CHO_OF3 Nicotiana tabacum ge... 68 2e-15 2
(ET969178) CHO_OF641xk11r1.ab1 CHO_OF Nicotiana tabacum geno... 68 2e-15 2
(AF009966) Candida albicans serine hydroxymethyl transferase... 48 3e-15 6
(BG586149) EST487914 MHAM Medicago truncatula/Glomus versifo... 54 4e-15 4
(FG146748) AGN_RPC008xj05f1.ab1 AGN_RPC Nicotiana tabacum cD... 72 4e-15 4
(FG164124) AGN_RNC013xg06f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 5e-15 4
(EL568557) Physarum14235 Physarum polycephalum starvation st... 46 8e-15 5
(EL572861) Physarum04991 Physarum polycephalum starvation st... 46 8e-15 5
(EL573606) Physarum14227 Physarum polycephalum starvation st... 46 9e-15 5
(EL575299) Physarum14228 Physarum polycephalum starvation st... 46 9e-15 5
(EL571419) Physarum14224 Physarum polycephalum starvation st... 46 1e-14 5
(EL574183) Physarum14231 Physarum polycephalum starvation st... 46 1e-14 5
(EB450673) KT7C.108G09F.051219T7 KT7 Nicotiana tabacum cDNA ... 68 2e-14 3
(GE359411) 292280022 Nasonia vitripennis Male Pupae Nasonia ... 36 3e-14 7
(GE358759) 292278339 Nasonia vitripennis Male Pupae Nasonia ... 36 3e-14 7
(GE354968) 289191551 Nasonia vitripennis Male Pupae Nasonia ... 36 4e-14 7
(GE398844) 293784466 Nasonia vitripennis Female Pupae Nasoni... 36 4e-14 7
(FH062597) CHO_OF3594xb22f1.ab1 CHO_OF3 Nicotiana tabacum ge... 72 4e-14 3
(GE449200) 294584436 Nasonia vitripennis Adult Female Nasoni... 36 4e-14 7
(GE383366) 293410000 Nasonia vitripennis Female Pupae Nasoni... 36 4e-14 7
(FG153266) AGN_RNC106xb13f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 4e-14 4
(DT663097) He_wd2a1_82C03_M13R Heliconius erato wing disk 2 ... 50 5e-14 5
(FG136962) AGN_ELP006xh23f1.ab1 AGN_ELP Nicotiana tabacum cD... 64 5e-14 4
(FG136757) AGN_ELP006xa01f1.ab1 AGN_ELP Nicotiana tabacum cD... 72 5e-14 3
(FG142580) AGN_RPC021xm03f1.ab1 AGN_RPC Nicotiana tabacum cD... 64 6e-14 4
(GE354133) 289176191 Nasonia vitripennis Male Pupae Nasonia ... 36 6e-14 7
(FG167665) AGN_RNC007xd08f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 6e-14 4
(FG198379) AGN_PNL227bf1_b12.trimmed.seq AGN_PNL Nicotiana t... 72 7e-14 3
(EB440366) KN6B.106B05F.060104T7 KN6B Nicotiana tabacum cDNA... 72 7e-14 3
(EB427578) KF8C.110H02F.051216T7 KF8 Nicotiana tabacum cDNA ... 72 7e-14 3
(FG149794) AGN_RNC115xn12f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 7e-14 3
(FG196605) AGN_PNL224df1_e5.trimmed.seq AGN_PNL Nicotiana ta... 72 7e-14 3
(FG194766) AGN_PNL222bf1_d7.trimmed.seq AGN_PNL Nicotiana ta... 72 7e-14 3
(EH621130) CHO_SL008xd24f1.ab1 CHO_SL Nicotiana tabacum cDNA... 72 7e-14 3
(EB442233) KN6B.113I03F.060127T7 KN6B Nicotiana tabacum cDNA... 72 8e-14 3
(FG165094) AGN_RNC011xm05f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 8e-14 3
(EB441589) KN6B.109J17F.060106T7 KN6B Nicotiana tabacum cDNA... 72 8e-14 3
(FG197450) AGN_PNL226af1_a7.trimmed.seq AGN_PNL Nicotiana ta... 72 8e-14 3
(FG174871) AGN_RNC123xb11f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 8e-14 3
(EB682857) KP1B.113P17F.060117T7 KP1B Nicotiana tabacum cDNA... 72 8e-14 3
(FG151654) AGN_RNC109xk17f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 8e-14 3
(EB441153) KN6B.108F21F.060106T7 KN6B Nicotiana tabacum cDNA... 72 8e-14 3
(EH615421) EST_FLW001xn23f1.ab1 EST_FLW Nicotiana tabacum cD... 72 8e-14 3
(FG162049) AGN_RNC017xh23f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 8e-14 3
(EB441960) KN6B.110K20F.060106T7 KN6B Nicotiana tabacum cDNA... 72 8e-14 3
(FG136637) AGN_ELP007xh05f1.ab1 AGN_ELP Nicotiana tabacum cD... 72 8e-14 3
(EB681999) KP1B.111D09F.060116T7 KP1B Nicotiana tabacum cDNA... 72 9e-14 3
(FG161608) AGN_RNC018xb14f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 9e-14 3
(EH621136) CHO_SL008xf16f1.ab1 CHO_SL Nicotiana tabacum cDNA... 72 9e-14 3
(FG140946) AGN_RPC027xg07f1.ab1 AGN_RPC Nicotiana tabacum cD... 72 9e-14 3
(EB445040) KR2B.105N20F.051227T7 KR2B Nicotiana tabacum cDNA... 72 9e-14 3
(EB440511) KN6B.106H24F.060104T7 KN6B Nicotiana tabacum cDNA... 72 9e-14 3
(FG139378) AGN_ELP024xi23f1.ab1 AGN_ELP Nicotiana tabacum cD... 72 9e-14 3
(FG161516) AGN_RNC018xn11f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 9e-14 3
(FG164274) AGN_RNC013xj01f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 9e-14 3
(FG161089) AGN_RNC019xl02f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 9e-14 3
(FG147141) AGN_RPC006xi09f1.ab1 AGN_RPC Nicotiana tabacum cD... 72 9e-14 3
(EE118482) G709P555RG8.T0 Acorn worm normalized neurula pExp... 50 9e-14 5
(FG147374) AGN_RPC006xl02f1.ab1 AGN_RPC Nicotiana tabacum cD... 72 9e-14 3
(FG140959) AGN_RPC027xi11f1.ab1 AGN_RPC Nicotiana tabacum cD... 72 9e-14 3
(EB427967) KF8B.100L11F.051010T7 KF8 Nicotiana tabacum cDNA ... 72 9e-14 3
(DV161612) KP1B.108K13F.050726T7 KP1B Nicotiana tabacum cDNA... 72 9e-14 3
(FG160071) AGN_RNC020xm01f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 9e-14 3
(FG159143) AGN_RNC022xa08f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 1e-13 3
(FG163447) AGN_RNC014xi21f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 1e-13 3
(CN554900) tae30d10.y1 Hydra EST Darmstadt I Hydra magnipapi... 48 3e-13 4
(BG456756) NF096C12PL1F1088 Phosphate starved leaf Medicago ... 50 4e-13 4
(FD465329) LARWB04TR Haematobia irritans 1st Instar Larvae H... 60 4e-13 2
(CZ287824) cp54g09.r Candida parapsilosis Random Genomic Lib... 64 1e-12 3
(CK263995) EST710073 potato abiotic stress cDNA library Sola... 62 2e-12 3
(C25508) Dictyostelium discoideum slug cDNA, clone SLA230. 52 2e-12 4
(GE357609) 292274691 Nasonia vitripennis Male Pupae Nasonia ... 36 2e-12 6
(FC753658) CBBI7489.rev CBBI Lottia gigantea 26h,37h,61h Lar... 52 2e-12 4
(CV293674) EST882051 petunia floral post-ethylene cDNA libra... 82 2e-12 2
(GE433116) 294536775 Nasonia vitripennis Adult Male Nasonia ... 36 3e-12 6
(GE397707) 293782126 Nasonia vitripennis Female Pupae Nasoni... 36 3e-12 6
(GE464996) 294761209 Nasonia vitripennis Adult Female Nasoni... 36 3e-12 6
(EK157423) 1095458011341 Global-Ocean-Sampling_GS-31-01-01-1... 52 3e-12 3
(FG142882) AGN_RPC020xe07f1.ab1 AGN_RPC Nicotiana tabacum cD... 54 3e-12 4
(CX832146) ACAC-aaa49h04.g1 Hydra EST UCI 7 Hydra magnipapil... 54 3e-12 3
(EH432083) NPE00000905 Neocallimastix patriciarum ZAP II cDN... 58 3e-12 3
(GE404650) 293793169 Nasonia vitripennis Female Pupae Nasoni... 36 3e-12 6
(FG202415) AGN_PNL232df1_h7.trimmed.seq AGN_PNL Nicotiana ta... 64 3e-12 3
(FG187441) AGN_PNL212bf1_a3.trimmed.seq AGN_PNL Nicotiana ta... 64 3e-12 3
(FG176437) AGN_RNC120xd01f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 4e-12 3
(FG136602) AGN_ELP007xo18f1.ab1 AGN_ELP Nicotiana tabacum cD... 64 4e-12 3
(FG145209) AGN_RPC013xh01f1.ab1 AGN_RPC Nicotiana tabacum cD... 64 5e-12 3
(FG145867) AGN_RPC011xl07f1.ab1 AGN_RPC Nicotiana tabacum cD... 64 5e-12 3
(FG144408) AGN_RPC015xg13f1.ab1 AGN_RPC Nicotiana tabacum cD... 64 5e-12 3
(EL601773) He_pwd_0133C09_M13R Heliconius erato pooled wing ... 50 5e-12 5
(AI960890) sc92a10.y1 Gm-c1019 Glycine max cDNA clone GENOME... 62 6e-12 3
(CZ533583) SRAA-aac86a08.g1 Strongyloides ratti whole genome... 52 6e-12 2
(EC760784) PSE00007663 rw_mgpallid Polysphondylium pallidum ... 78 7e-12 2
(AK285692) Glycine max cDNA, clone: GMFL01-14-M16. 62 7e-12 4
(BI418085) LjNEST24d6r Lotus japonicus nodule library 5 and ... 74 9e-12 2
(CS497744) Sequence 17 from Patent WO2007011736. 62 9e-12 4
(EK259659) 1095462100993 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-11 2
(FG149604) AGN_RNC115xd17f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 1e-11 3
(FG167783) AGN_RNC006xa05f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 1e-11 3
(EL600524) He_pwd_0217H12_M13R Heliconius erato pooled wing ... 48 1e-11 5
(EV265069) GLLAQ07TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 62 2e-11 3
(FG989225) GLLCQ87TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 62 2e-11 3
(BW658612) Glycine max cDNA clone: GMFL01-14-M16, 5'end, sim... 62 2e-11 3
(CK296333) EST759047 Nicotiana benthamiana mixed tissue cDNA... 64 2e-11 3
(EX534144) NBT103_2007-07-12/NBT103_C01_006_1 Nicotiana bent... 64 2e-11 3
(EX533843) NBT098_2007-07-12/NBT098_D06_021_1 Nicotiana bent... 64 2e-11 3
(FG165345) AGN_RNC011xh23f1.ab1 AGN_RNC Nicotiana tabacum cD... 72 3e-11 2
(CV298153) EST886612 petunia floral post-pollination cDNA li... 82 3e-11 2
(BJ376433) Dictyostelium discoideum cDNA clone:ddc28b18, 3' ... 52 3e-11 4
(CV298271) EST886730 petunia floral post-pollination cDNA li... 82 4e-11 2
(CV298704) EST887163 petunia floral post-pollination cDNA li... 82 4e-11 2
(CZ289187) cp62f03.r Candida parapsilosis Random Genomic Lib... 82 4e-11 2
(EJ358506) 1092963676079 Global-Ocean-Sampling_GS-28-01-01-1... 66 5e-11 2
(EH615756) EST_FLW002xl22f1.ab1 EST_FLW Nicotiana tabacum cD... 72 5e-11 3
(FG132690) AGN_ELP019xg17f1.ab1 AGN_ELP Nicotiana tabacum cD... 64 6e-11 3
(FC689346) CAXX20605.fwd CAXX Lottia gigantea from male gona... 58 6e-11 4
(CV293822) EST882199 petunia floral post-ethylene cDNA libra... 82 7e-11 1
(AK244063) Glycine max cDNA, clone: GMFL01-01-P23. 62 8e-11 3
(DV613610) EST1216606 Glossina morsitans morsitans Fat body ... 64 8e-11 3
(DV611222) EST1214218 Glossina morsitans morsitans Fat body ... 64 8e-11 3
(CN552952) tae42d10.y1 Hydra EST Darmstadt I Hydra magnipapi... 48 1e-10 3
(GE379156) 292347418 Nasonia vitripennis Male Pupae Nasonia ... 36 1e-10 6
(BG598873) EST503773 cSTS Solanum tuberosum cDNA clone cSTS2... 48 1e-10 3
(AK244285) Glycine max cDNA, clone: GMFL01-02-J13. 62 1e-10 3
(GE408222) 293802134 Nasonia vitripennis Female Pupae Nasoni... 36 2e-10 6
(EL569472) Physarum14234 Physarum polycephalum starvation st... 46 2e-10 4
(BP906921) Solanum lycopersicum cDNA, clone: LC06AB08, 5' en... 62 3e-10 3
(EX534241) NBT104_2007-07-10/NBT104_H08_025_1 Nicotiana bent... 64 3e-10 3
(EH614868) EST_CSP003xj19f1.ab1 EST_CSP Nicotiana tabacum cD... 72 4e-10 2
(BQ091175) ku13g11.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 52 4e-10 2
(AW032773) EST276332 tomato callus, TAMU Solanum lycopersicu... 62 5e-10 3
(CV017773) tbt_009554 Normalized Nicotiana tabacum cDNA libr... 72 5e-10 2
(AW737947) EST339374 tomato flower buds, anthesis, Cornell U... 62 5e-10 3
(FG187499) AGN_PNL212bf1_f2.trimmed.seq AGN_PNL Nicotiana ta... 72 6e-10 2
(EH615749) EST_FLW002xl06f1.ab1 EST_FLW Nicotiana tabacum cD... 72 6e-10 2
(FG182501) AGN_PNL205cf1_a9.trimmed.seq AGN_PNL Nicotiana ta... 72 6e-10 2
(FG199828) AGN_PNL229bf1_b8.trimmed.seq AGN_PNL Nicotiana ta... 60 6e-10 2
(BI931962) EST551851 tomato flower, 8 mm to preanthesis buds... 62 6e-10 3
(BI925792) EST545681 tomato flower, buds 0-3 mm Solanum lyco... 62 6e-10 3
(AW931576) EST357419 tomato fruit mature green, TAMU Solanum... 62 6e-10 3
(BI935304) EST555193 tomato flower, anthesis Solanum lycoper... 62 6e-10 3
(FH138864) CHO_OF3689xd23f1.ab1 CHO_OF3 Nicotiana tabacum ge... 60 7e-10 2
(BI927367) EST547256 tomato flower, 3 - 8 mm buds Solanum ly... 62 7e-10 3
(EH665432) 22B08 Transformed tobacco Lambda Zap II library N... 72 7e-10 2
(BI924147) EST544036 tomato flower, buds 0-3 mm Solanum lyco... 62 7e-10 3
(BW690323) Solanum lycopersicum cDNA, clone: FC18BA11, 5' en... 62 7e-10 3
(EB448955) KT7C.101H13F.051216T7 KT7 Nicotiana tabacum cDNA ... 56 8e-10 3
(EL602746) He_pwd_0130C01_M13R Heliconius erato pooled wing ... 50 8e-10 4
(FE966060) PLATE_T3_023_D02_02DEC2004_010 Opium poppy elicit... 46 1e-09 4
(GE403702) 293791550 Nasonia vitripennis Female Pupae Nasoni... 36 1e-09 5
(EK095995) 1092962035504 Global-Ocean-Sampling_GS-31-01-01-1... 66 1e-09 2
(AC226823) Solanum lycopersicum chromosome 5 clone C05HBa006... 62 2e-09 8
(EV435338) 35013_419 Quinqueloculina sp. cDNA library Quinqu... 62 2e-09 3
(BJ435801) Dictyostelium discoideum cDNA clone:ddv28o09, 3' ... 52 2e-09 3
(EK124829) 1092973801655 Global-Ocean-Sampling_GS-31-01-01-1... 44 2e-09 4
(FG185855) AGN_PNL210af1_g12.trimmed.seq AGN_PNL Nicotiana t... 64 2e-09 2
(FF625033) G825P5312RF1.T0 Acorn worm normalized gastrula pE... 50 2e-09 4
(FG198530) AGN_PNL227br1_g6.trimmed.seq AGN_PNL Nicotiana ta... 64 2e-09 2
(FG200741) AGN_PNL230cf1_b3.trimmed.seq AGN_PNL Nicotiana ta... 64 2e-09 2
(FG151780) AGN_RNC109xm06f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 2e-09 2
(DY446934) HSAA-aaa23b09.g1 UCI-11 Hydra vulgaris cDNA 5' si... 54 2e-09 3
(FG150713) AGN_RNC112xl17f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 2e-09 2
(FG156859) AGN_RNC027xp08f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 2e-09 2
(EH621862) CHO_SL027xm15f1.ab1 CHO_SL Nicotiana tabacum cDNA... 64 2e-09 2
(FG201533) AGN_PNL231cf1_h6.trimmed.seq AGN_PNL Nicotiana ta... 64 2e-09 2
(FG201275) AGN_PNL231bf1_a7.trimmed.seq AGN_PNL Nicotiana ta... 64 2e-09 2
(EE113217) G50P6038RA1.T0 Acorn worm gastrula/neurula pCMVSp... 50 2e-09 4
(FG175037) AGN_RNC123xl16f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 2e-09 2
(EB442132) KN6B.113D08F.060127T7 KN6B Nicotiana tabacum cDNA... 64 3e-09 2
(EB440820) KN6B.107G12F.060106T7 KN6B Nicotiana tabacum cDNA... 64 3e-09 2
(EB448739) KT7B.114N18F.060127T7 KT7 Nicotiana tabacum cDNA ... 64 3e-09 2
(FG170537) AGN_RNC001xa17f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 3e-09 2
(EB681940) KP1B.111A12F.060116T7 KP1B Nicotiana tabacum cDNA... 64 3e-09 2
(EB682095) KP1B.111I05F.060116T7 KP1B Nicotiana tabacum cDNA... 64 3e-09 2
(FG148398) AGN_RPC002xk02f1.ab1 AGN_RPC Nicotiana tabacum cD... 64 3e-09 2
(FG165505) AGN_RNC011xp12f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 3e-09 2
(FG136870) AGN_ELP006xg10f1.ab1 AGN_ELP Nicotiana tabacum cD... 64 3e-09 2
(EB680168) KL4B.106F08F.051125T7 KL4B Nicotiana tabacum cDNA... 64 3e-09 2
(FG167368) AGN_RNC007xa24f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 3e-09 2
(EB438236) KN6B.100D14F.051019T7 KN6B Nicotiana tabacum cDNA... 64 3e-09 2
(DW001023) KL4B.109N06F.051108T7 KL4B Nicotiana tabacum cDNA... 64 3e-09 2
(EB443038) KN6B.115O14F.060127T7 KN6B Nicotiana tabacum cDNA... 64 3e-09 2
(FG143349) AGN_RPC019xf17f1.ab1 AGN_RPC Nicotiana tabacum cD... 64 3e-09 2
(FG158790) AGN_RNC023xj01f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 3e-09 2
(FG133578) AGN_ELP017xj08f1.ab1 AGN_ELP Nicotiana tabacum cD... 64 3e-09 2
(FG159429) AGN_RNC022xh14f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 3e-09 2
(GE397225) 293782006 Nasonia vitripennis Female Pupae Nasoni... 36 3e-09 5
(DN906032) 32539.3 In vitro Root Solanum tuberosum cDNA clon... 48 3e-09 3
(BJ342681) Dictyostelium discoideum cDNA clone:dda1j04, 3' e... 52 3e-09 3
(EE114895) G613P6214RG6.T0 Acorn worm blastula/gastrula pCMV... 50 4e-09 4
(EE119100) G710P5209RC9.T0 Acorn worm normalized juvenile pE... 50 4e-09 4
(BJ429629) Dictyostelium discoideum cDNA clone:ddv4d11, 3' e... 52 4e-09 3
(DV620811) EST1223807 Glossina morsitans morsitans Fat body ... 64 4e-09 3
(EE120526) G710P5322RE2.T0 Acorn worm normalized juvenile pE... 50 4e-09 4
(BG097070) EST461589 potato leaves and petioles Solanum tube... 62 5e-09 2
(BP897268) Solanum lycopersicum cDNA, clone: LA13AB04, 5' en... 62 6e-09 2
(BG351004) 099G08 Mature tuber lambda ZAP Solanum tuberosum ... 62 8e-09 2
(BI932842) EST552731 tomato flower, 8 mm to preanthesis buds... 62 8e-09 3
(DB682375) Solanum lycopersicum cDNA, clone: LEFL1013BE01, 5... 62 9e-09 2
(EB698493) NecGex_349A11 Ornamental tobacco (LxS8) post-fert... 64 9e-09 2
(BG599311) EST504211 cSTS Solanum tuberosum cDNA clone cSTS2... 62 9e-09 2
(CK275996) EST722074 potato abiotic stress cDNA library Sola... 62 1e-08 2
(GE407420) 293798945 Nasonia vitripennis Female Pupae Nasoni... 36 1e-08 5
(CK272831) EST718909 potato abiotic stress cDNA library Sola... 62 1e-08 2
(CK269870) EST715948 potato abiotic stress cDNA library Sola... 62 1e-08 2
(EX534067) NBT102_2007-07-10/NBT102_A03_016_1 Nicotiana bent... 64 1e-08 2
(CK241453) rx29g02.y1 Meloidogyne paranaensis egg SL1 pGEM M... 34 1e-08 6
(BW626191) Lotus japonicus cDNA, clone: LjFL2-014-BF11, 5' e... 74 2e-08 1
(EL426326) CHCM5781.b1_I05.ab1 CHC(LMS) Texas blueweed Helia... 34 2e-08 5
(CJ369225) Molgula tectiformis cDNA, gastrula/neurula clone:... 44 2e-08 3
(DY965552) CLSM16779.b1_E20.ab1 CLS(LMS) lettuce sativa Lact... 40 2e-08 4
(DY984548) CLSS7823.b1_N11.ab1 CLS(LMS) lettuce sativa Lactu... 40 2e-08 4
(EJ200133) 1092344291154 Global-Ocean-Sampling_GS-27-01-01-1... 36 2e-08 5
(EA072755) Sequence 113 from patent US 7183083. 42 2e-08 5
(CS497838) Sequence 111 from Patent WO2007011736. 42 2e-08 5
(AR886452) Sequence 113 from patent US 7060458. 42 2e-08 5
(CJ334758) Molgula tectiformis cDNA, embryo just before hatc... 44 2e-08 3
(AF009965) Candida albicans serine hydroxymethyl-transferase... 44 3e-08 4
(EH431589) NPE00000165 Neocallimastix patriciarum ZAP II cDN... 58 3e-08 2
(CJ397135) Molgula tectiformis cDNA, gonad clone:mtgd030f14,... 46 3e-08 3
(FG183982) AGN_PNL207cf1_c9.trimmed.seq AGN_PNL Nicotiana ta... 64 3e-08 2
(FC812488) Sr_pASP6_011a11_SP6 S. ratti mixed stage pAMP Str... 52 3e-08 2
(FG994444) GLLED93TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 62 4e-08 2
(EC754638) PPE00007495 Agencourt Biosciences Agen-0020 Non-n... 46 8e-08 2
(BQ583344) E011980-024-005-N20-SP6 MPIZ-ADIS-024-inflorescen... 52 1e-07 2
(EK376453) 1095469442592 Global-Ocean-Sampling_GS-31-01-01-1... 38 1e-07 4
(FG171228) AGN_RNC101xi10f1.ab1 AGN_RNC Nicotiana tabacum cD... 64 1e-07 2
(BI928362) EST548251 tomato flower, 3 - 8 mm buds Solanum ly... 62 1e-07 3
(BI927966) EST547843 tomato flower, 3 - 8 mm buds Solanum ly... 62 1e-07 3
(BI933138) EST553027 tomato flower, 8 mm to preanthesis buds... 62 1e-07 3
(FH033297) CHO_OF3262xc11r1.ab1 CHO_OF3 Nicotiana tabacum ge... 58 1e-07 2
(CX699391) 85946.1 Stolon Solanum tuberosum cDNA clone 85946... 48 2e-07 3
(DW139058) CLSY6773.b1_I14.ab1 CLS(XYZ) lettuce sativa Lactu... 54 2e-07 3
(DW138606) CLSY6350.b2_K04.ab1 CLS(XYZ) lettuce sativa Lactu... 54 2e-07 3
(DT616789) ACAH-aaa91a08.g1 Hydra_EST_UCI-10 Hydra magnipapi... 36 2e-07 5
(CJ347613) Molgula tectiformis cDNA, cleaving embryo clone:m... 42 3e-07 3
(EL566121) Physarum07993 Physarum polycephalum starvation st... 42 4e-07 6
(EF150637) Populus tremuloides serine hydroxymethyltransfera... 38 4e-07 5
(CX634282) taj48f08.y3 Hydra EST UCI 5 Hydra magnipapillata ... 36 4e-07 5
(DT613284) ACAG-aaa85a10.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 5e-07 5
(FC818144) Sr_pAMT7_011a11_T7 S. ratti mixed stage pAMP Stro... 52 5e-07 2
(DT616240) ACAH-aaa64c12.g1 Hydra_EST_UCI-10 Hydra magnipapi... 36 5e-07 5
(DV609463) EST1212459 Glossina morsitans morsitans Fat body ... 64 6e-07 2
(DV607060) EST1210056 Glossina morsitans morsitans Fat body ... 64 6e-07 2
(AF195023) Plasmodium falciparum SHMT (shmt) mRNA, complete ... 48 6e-07 3
(AR548225) Sequence 3356 from patent US 6747137. 44 6e-07 3
(EJ746256) 1092962264911 Global-Ocean-Sampling_GS-30-02-01-1... 46 6e-07 3
(AL408772) T7 end of clone AV0AA010F02 of library AV0AA from... 48 7e-07 2
(EJ776878) 1093006404220 Global-Ocean-Sampling_GS-30-02-01-1... 46 7e-07 3
(DB996483) Quercus mongolica subsp. crispula mRNA, clone: Qm... 68 1e-06 1
(EJ494211) 1095403562447 Global-Ocean-Sampling_GS-28-01-01-1... 62 1e-06 2
(FE671619) mh1_0007_F06 Drought-stressed chickpea leave libr... 66 2e-06 2
(EL598375) He_pwd_0137G01_M13R Heliconius erato pooled wing ... 48 2e-06 3
(ES891339) LET027F7_2005-10-03_1/LET027F7_D08_1 Solanum lyco... 62 2e-06 2
(DB723282) Solanum lycopersicum cDNA, clone: LEFL2043D06, 5'... 62 2e-06 3
(BG595547) EST494225 cSTS Solanum tuberosum cDNA clone cSTS1... 54 2e-06 2
(BG599860) EST504755 cSTS Solanum tuberosum cDNA clone cSTS2... 54 2e-06 2
(CX699451) 86025.1 Stolon Solanum tuberosum cDNA clone 86025... 54 2e-06 2
(BI178701) EST519646 cSTE Solanum tuberosum cDNA clone cSTE1... 54 2e-06 2
(EK438285) 1095521143614 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-06 3
(EJ676100) 1092955081917 Global-Ocean-Sampling_GS-30-02-01-1... 56 2e-06 2
(ES888920) NBT082_2007-03-08/NBT082_F06_019_1 Nicotiana bent... 64 2e-06 2
(ES888308) NBT070_2007-01-30_1/NBT070_D06_021_1 Nicotiana be... 64 2e-06 2
(CK247477) EST731114 potato callus cDNA library, normalized ... 54 2e-06 2
(CK262652) EST708730 potato abiotic stress cDNA library Sola... 54 2e-06 2
(CV301577) MM10_B02 Young roots probed with 3 week old root ... 42 2e-06 3
(CO502376) 59632.1 In vitro Root Solanum tuberosum cDNA clon... 54 2e-06 2
(GE353707) 289173983 Nasonia vitripennis Male Pupae Nasonia ... 36 2e-06 4
(CK265970) EST712048 potato abiotic stress cDNA library Sola... 54 2e-06 2
(ER516743) 1093015522017 Global-Ocean-Sampling_GS-35-01-01-1... 38 3e-06 5
(CV885176) UCRCS04_2_013B02_T7 Ruby Orange Developing Flower... 52 3e-06 3
(DR685326) EST1075403 Normalized pine embryo library, Lib_D ... 38 3e-06 4
(EX935661) li21g02.g7 Ginkgo male leaf (NYBG) Ginkgo biloba ... 38 3e-06 4
(DY281341) IC0AAA53CF12RM1 CitNFL Citrus clementina cDNA 5',... 52 3e-06 3
(DT606321) ACAG-aaa31d07.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 3e-06 5
(DY281584) IC0AAA54BD11RM1 CitNFL Citrus clementina cDNA 5',... 52 3e-06 3
(DY271852) IC0AAA2CB09RM1 CitNFL Citrus clementina cDNA 5', ... 52 3e-06 3
(DY297940) IC0AAA94AG04RM1 CitNFL Citrus clementina cDNA 5',... 52 3e-06 3
(EJ836993) 1093017664432 Global-Ocean-Sampling_GS-30-02-01-1... 42 3e-06 4
(EV425663) 210742422 NVP Nasonia vitripennis cDNA clone 199I... 36 3e-06 4
(DY298753) IC0AAA96BG07RM1 CitNFL Citrus clementina cDNA 5',... 52 3e-06 3
(DY278080) IC0AAA45CE08RM1 CitNFL Citrus clementina cDNA 5',... 52 3e-06 3
(DY299345) IC0AAA98AE04RM1 CitNFL Citrus clementina cDNA 5',... 52 3e-06 3
(AC183923) Medicago truncatula chromosome 2 clone mth2-88a15... 50 4e-06 5
(DY289510) IC0AAA72CB08RM1 CitNFL Citrus clementina cDNA 5',... 52 4e-06 3
(EJ422266) 1093012239183 Global-Ocean-Sampling_GS-28-01-01-1... 66 4e-06 1
(CK852424) 12896 Stolon Solanum tuberosum cDNA, mRNA sequence. 48 4e-06 2
(AW616686) EST323097 L. hirsutum trichome, Cornell Universit... 48 4e-06 2
(BG134770) EST467662 tomato crown gall Solanum lycopersicum ... 48 4e-06 2
(EL573238) Physarum14229 Physarum polycephalum starvation st... 46 4e-06 2
(BE459556) EST414848 tomato developing/immature green fruit ... 42 5e-06 3
(BP185239) Dugesia japonica cDNA, clone: 04149_HH, expressed... 46 5e-06 2
(BI264893) NF109B08PL1F1073 Phosphate starved leaf Medicago ... 50 5e-06 3
(DY277829) IC0AAA44DG09RM1 CitNFL Citrus clementina cDNA 5',... 52 5e-06 3
(DY276370) IC0AAA40DH03RM1 CitNFL Citrus clementina cDNA 5',... 52 5e-06 3
(EJ472299) 1095403417797 Global-Ocean-Sampling_GS-28-01-01-1... 38 5e-06 5

>(BJ346517) Dictyostelium discoideum cDNA clone:dda24n05, 3' end,
single read.
Length = 750

Score = 1433 bits (723), Expect(2) = 0.0
Identities = 723/723 (100%)
Strand = Plus / Minus


Query: 686 tgatatggcacatattagtggtatggtcgcaggtaaacaagcaatttcacctttcctttt 745
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 750 tgatatggcacatattagtggtatggtcgcaggtaaacaagcaatttcacctttcctttt 691


Query: 746 ctgtgatgttgtaaccacaaccacccataaaactttaagaggtccacgtgctggtcttat 805
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 690 ctgtgatgttgtaaccacaaccacccataaaactttaagaggtccacgtgctggtcttat 631


Query: 806 ctttttcagaaagactaaacgtagagatgccaaaggtaacatcatcgatgatgacctcga 865
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 630 ctttttcagaaagactaaacgtagagatgccaaaggtaacatcatcgatgatgacctcga 571


Query: 866 aaatagaattaactttgcagttttcccatcttgtcaaggtggtccacacgaaaatactat 925
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 570 aaatagaattaactttgcagttttcccatcttgtcaaggtggtccacacgaaaatactat 511


Query: 926 cgctggtattgctgtcgctttgaaggaagcctcatctccagatttccaagaatatactaa 985
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 510 cgctggtattgctgtcgctttgaaggaagcctcatctccagatttccaagaatatactaa 451


Query: 986 acaagtcagaagaaactctcaaaccatgggcgaagaactcaaaaagagaggttattcact 1045
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 450 acaagtcagaagaaactctcaaaccatgggcgaagaactcaaaaagagaggttattcact 391


Query: 1046 cgtaaccgaaggtaccgataatcatttagttctttgggatcttagaccacaaggtatcac 1105
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 390 cgtaaccgaaggtaccgataatcatttagttctttgggatcttagaccacaaggtatcac 331


Query: 1106 tggcagtaaaattgaaaaggcttgtgacgaagctcatatcactgtaaataaaaatgctgt 1165
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 330 tggcagtaaaattgaaaaggcttgtgacgaagctcatatcactgtaaataaaaatgctgt 271


Query: 1166 ctatggtgatacaaatgcaatcgctcctggtggtgtacgtttaggtgctcctgctctcac 1225
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 270 ctatggtgatacaaatgcaatcgctcctggtggtgtacgtttaggtgctcctgctctcac 211


Query: 1226 aagcagaggtctcaaagaacaagactttgttaaagtcgtcgatttcttagatcgtgtcgt 1285
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 210 aagcagaggtctcaaagaacaagactttgttaaagtcgtcgatttcttagatcgtgtcgt 151


Query: 1286 taaaatctctttagatatccaatcaaaagttggtaagaaaatgccagatttccaaagagc 1345
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 150 taaaatctctttagatatccaatcaaaagttggtaagaaaatgccagatttccaaagagc 91


Query: 1346 aatcgctgataatcaagatttaaaacaaattagacaagaagttaaagaattctctactaa 1405
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 90 aatcgctgataatcaagatttaaaacaaattagacaagaagttaaagaattctctactaa 31


Query: 1406 att 1408
|||
Sbjct: 30 att 28

Score = 30.2 bits (15), Expect(2) = 0.0
Identities = 15/15 (100%)
Strand = Plus / Minus


Query: 1423 aattataaaataaaa 1437
|||||||||||||||
Sbjct: 15 aattataaaataaaa 1

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 1,754,337,221
Number of extensions: 107446851
Number of successful extensions: 9204189
Number of sequences better than 10.0: 1595
Length of query: 1454
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 1430
Effective length of database: 96,409,374,237
Effective search space: 137865405158910
Effective search space used: 137865405158910
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.16
Homology vs Protein
Query= Contig-U15526-1 (Contig-U15526-1Q) /CSM_Contig/Contig-U15526-1Q.Seq.d
(1454 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

EF150637_1(EF150637|pid:none) Populus tremuloides serine hydroxy... 303 e-151
EF150642_1(EF150642|pid:none) Populus tremuloides serine hydroxy... 308 e-150
CS497866_1(CS497866|pid:none) Sequence 139 from Patent WO2007011... 304 e-150
AF361589_1(AF361589|pid:none) Arabidopsis thaliana AT4g13930/dl3... 303 e-149
CS497872_1(CS497872|pid:none) Sequence 145 from Patent WO2007011... 303 e-149
AK101088_1(AK101088|pid:none) Oryza sativa Japonica Group cDNA c... 297 e-149
CS497728_1(CS497728|pid:none) Sequence 1 from Patent WO2007011736. 303 e-149
GN104744_1(GN104744|pid:none) Sequence 9525 from Patent WO200903... 300 e-147
CS497860_1(CS497860|pid:none) Sequence 133 from Patent WO2007011... 300 e-147
GN104742_1(GN104742|pid:none) Sequence 9523 from Patent WO200903... 300 e-147
BT070546_1(BT070546|pid:none) Picea sitchensis clone WS02735_F19... 302 e-147
GN104718_1(GN104718|pid:none) Sequence 9499 from Patent WO200903... 287 e-146
CS497862_1(CS497862|pid:none) Sequence 135 from Patent WO2007011... 294 e-146
AL035528_28(AL035528|pid:none) Arabidopsis thaliana DNA chromoso... 288 e-144
AE017350_40(AE017350|pid:none) Cryptococcus neoformans var. neof... 294 e-143
CR954203_91(CR954203|pid:none) Ostreococcus tauri strain OTTH059... 290 e-142
CP001142_337(CP001142|pid:none) Phaeodactylum tricornutum CCAP 1... 269 e-141
CP000583_93(CP000583|pid:none) Ostreococcus lucimarinus CCE9901 ... 281 e-140
AY669085_1(AY669085|pid:none) Toxoplasma gondii strain RH serine... 261 e-137
BC085331_1(BC085331|pid:none) Rattus norvegicus serine hydroxyme... 259 e-136
BC004825_1(BC004825|pid:none) Mus musculus serine hydroxymethylt... 259 e-136
AK012355_1(AK012355|pid:none) Mus musculus 11 days embryo whole ... 259 e-136
(P34897) RecName: Full=Serine hydroxymethyltransferase, mitochon... 258 e-136
AK315916_1(AK315916|pid:none) Homo sapiens cDNA, FLJ78815 comple... 258 e-136
AK223555_1(AK223555|pid:none) Homo sapiens mRNA for serine hydro... 256 e-135
B46746(B46746) glycine hydroxymethyltransferase (EC 2.1.2.1) pre... 256 e-135
AK296183_1(AK296183|pid:none) Homo sapiens cDNA FLJ58535 complet... 255 e-135
(Q3SZ20) RecName: Full=Serine hydroxymethyltransferase, mitochon... 255 e-134
A33696(A33696)glycine hydroxymethyltransferase (EC 2.1.2.1), mit... 254 e-134
CR954219_30(CR954219|pid:none) Ostreococcus tauri strain OTTH059... 253 e-134
CP001331_74(CP001331|pid:none) Micromonas sp. RCC299 chromosome ... 256 e-134
(P14519) RecName: Full=Serine hydroxymethyltransferase, mitochon... 254 e-133
EF150640_1(EF150640|pid:none) Populus tremuloides serine hydroxy... 270 e-133
CP000600_260(CP000600|pid:none) Ostreococcus lucimarinus CCE9901... 266 e-133
CR857364_1(CR857364|pid:none) Pongo abelii mRNA; cDNA DKFZp469E1... 250 e-133
BC066496_1(BC066496|pid:none) Danio rerio serine hydroxymethyltr... 261 e-132
AY850381_1(AY850381|pid:none) Danio rerio serine hydroxymethyltr... 261 e-132
CP000596_241(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 249 e-132
EF150641_1(EF150641|pid:none) Populus tremuloides serine hydroxy... 262 e-132
BC055527_1(BC055527|pid:none) Danio rerio serine hydroxymethyltr... 261 e-132
EU972551_1(EU972551|pid:none) Zea mays clone 383353 serine hydro... 251 e-131
(Q60V73) RecName: Full=Serine hydroxymethyltransferase; ... 264 e-131
(P50432) RecName: Full=Serine hydroxymethyltransferase; ... 260 e-131
B88483(B88483) protein mel-32 [imported] - Caenorhabditis elegan... 260 e-131
EF085123_1(EF085123|pid:none) Picea sitchensis clone WS02710_L01... 247 e-130
CS497796_1(CS497796|pid:none) Sequence 69 from Patent WO20070117... 249 e-130
BT002738_1(BT002738|pid:none) Arabidopsis thaliana clone C105220... 258 e-130
EF150645_1(EF150645|pid:none) Populus tremuloides serine hydroxy... 259 e-130
AC021199_4(AC021199|pid:none) Arabidopsis thaliana chromosome 1 ... 258 e-130
CP001334_173(CP001334|pid:none) Micromonas sp. RCC299 chromosome... 246 e-130
AM494965_256(AM494965|pid:none) Leishmania braziliensis chromoso... 250 e-130
CS497740_1(CS497740|pid:none) Sequence 13 from Patent WO20070117... 244 e-129
AL034567_22(AL034567|pid:none) Arabidopsis thaliana DNA chromoso... 244 e-129
AF375450_1(AF375450|pid:none) Arabidopsis thaliana AT4g32520/F8B... 244 e-129
DQ311410_1(DQ311410|pid:none) Bombyx mori serine hydroxymethyltr... 253 e-128
CP001325_300(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 290 e-128
AC117988_17(AC117988|pid:none) Oryza sativa chromosome 3 BAC OSJ... 244 e-128
CS497746_1(CS497746|pid:none) Sequence 19 from Patent WO20070117... 245 e-128
CR954214_280(CR954214|pid:none) Ostreococcus tauri strain OTTH05... 249 e-127
EF150643_1(EF150643|pid:none) Populus tremuloides mitochondrial ... 241 e-127
EF148263_1(EF148263|pid:none) Populus trichocarpa x Populus delt... 241 e-127
AK010439_1(AK010439|pid:none) Mus musculus ES cells cDNA, RIKEN ... 250 e-126
AY189738_1(AY189738|pid:none) Leishmania donovani serine hydroxy... 247 e-126
EF148390_1(EF148390|pid:none) Populus trichocarpa x Populus delt... 239 e-126
(P34896) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 251 e-126
AL596215_4(AL596215|pid:none) Mouse DNA sequence from clone RP23... 250 e-126
EF150638_1(EF150638|pid:none) Populus tremuloides mitochondrial ... 239 e-126
(P35623) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 249 e-126
CT005266_244(CT005266|pid:none) Leishmania major strain Friedlin... 247 e-126
(P49358) RecName: Full=Serine hydroxymethyltransferase 2, mitoch... 241 e-125
AK223552_1(AK223552|pid:none) Homo sapiens mRNA for serine hydro... 251 e-125
(P50431) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 246 e-125
CR926419_1(CR926419|pid:none) Xenopus tropicalis finished cDNA, ... 254 e-125
BC112563_1(BC112563|pid:none) Bos taurus serine hydroxymethyltra... 244 e-124
(Q5E9P9) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 244 e-124
CT005253_136(CT005253|pid:none) Leishmania major strain Friedlin... 235 e-124
(Q5RFK5) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 245 e-123
CU928171_776(CU928171|pid:none) Kluyveromyces thermotolerans str... 252 e-122
A42241(A42241) glycine hydroxymethyltransferase (EC 2.1.2.1), cy... 248 e-122
AM920428_501(AM920428|pid:none) Penicillium chrysogenum Wisconsi... 233 e-119
FM992693_343(FM992693|pid:none) Candida dubliniensis CD36 chromo... 243 e-119
GN104288_1(GN104288|pid:none) Sequence 9069 from Patent WO200903... 243 e-118
(O13426) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 243 e-118
GN104276_1(GN104276|pid:none) Sequence 9057 from Patent WO200903... 228 e-117
GN104270_1(GN104270|pid:none) Sequence 9051 from Patent WO200903... 225 e-116
AJ438779_1(AJ438779|pid:none) Eremothecium gossypii SHM2 gene fo... 236 e-116
(Q6FUP6) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 233 e-116
AP006852_308(AP006852|pid:none) Candida albicans genomic DNA, ch... 228 e-116
FN317895_1(FN317895|pid:none) Schistosoma japonicum isolate Anhu... 221 e-116
AM270102_1(AM270102|pid:none) Aspergillus niger contig An05c0020... 224 e-116
CP000500_566(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 224 e-116
CP000497_284(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 235 e-115
EF676750_1(EF676750|pid:none) Picea sitchensis clone WS02750_L18... 233 e-115
CU928178_124(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 233 e-114
BC091501_1(BC091501|pid:none) Homo sapiens serine hydroxymethylt... 258 e-113
BC022874_1(BC022874|pid:none) Homo sapiens serine hydroxymethylt... 251 e-113
CR940347_799(CR940347|pid:none) Theileria annulata strain Ankara... 218 e-113
AM462035_1(AM462035|pid:none) Vitis vinifera contig VV78X021083.... 234 e-112
(Q6CLQ5) RecName: Full=Serine hydroxymethyltransferase, mitochon... 230 e-111
CU928180_430(CU928180|pid:none) Kluyveromyces thermotolerans str... 233 e-111
GN104268_1(GN104268|pid:none) Sequence 9049 from Patent WO200903... 223 e-111
AP007171_779(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 213 e-111
AF451898_72(AF451898|pid:none) Heliothis zea virus 1, complete g... 216 e-110
(Q7S5N8) RecName: Full=Putative serine hydroxymethyltransferase,... 213 e-108
CU633454_78(CU633454|pid:none) Podospora anserina genomic DNA ch... 212 e-108
(Q6FQ44) RecName: Full=Serine hydroxymethyltransferase, mitochon... 229 e-108
(Q758F0) RecName: Full=Serine hydroxymethyltransferase, mitochon... 227 e-108
AE014188_341(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 223 e-105
CS497802_1(CS497802|pid:none) Sequence 75 from Patent WO20070117... 211 e-104
AF439728_1(AF439728|pid:none) Zea mays serine hydroxymethyltrans... 199 e-102
BT039772_1(BT039772|pid:none) Zea mays full-length cDNA clone ZM... 215 e-100
AY387483_1(AY387483|pid:none) Oryza sativa (japonica cultivar-gr... 244 e-100
(O62585) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 195 5e-98
EF082716_1(EF082716|pid:none) Picea sitchensis clone WS0297_A18 ... 295 2e-97
AJ005644_4(AJ005644|pid:none) Encephalitozoon cuniculi dhfr, ts,... 192 3e-97
CS497856_1(CS497856|pid:none) Sequence 129 from Patent WO2007011... 252 5e-89
BT052850_1(BT052850|pid:none) Medicago truncatula clone MTYFL_FM... 247 8e-89
AK301339_1(AK301339|pid:none) Homo sapiens cDNA FLJ58288 complet... 206 5e-88
JC4959(JC4959) serine hydroxymethyltransferase (EC 2.1.2.-) 2 - ... 246 2e-87
(A6Q478) RecName: Full=Serine hydroxymethyltransferase; ... 174 4e-86
(Q2S4G9) RecName: Full=Serine hydroxymethyltransferase; ... 181 8e-86
EF554275_1(EF554275|pid:none) Salinibacter ruber isolate P1 glyc... 181 7e-83
(O66776) RecName: Full=Serine hydroxymethyltransferase; ... 170 3e-82
CP000361_1430(CP000361|pid:none) Arcobacter butzleri RM4018, com... 177 4e-82
(Q98A81) RecName: Full=Serine hydroxymethyltransferase 2; ... 175 5e-82
CP000361_633(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 176 7e-82
AK295941_1(AK295941|pid:none) Homo sapiens cDNA FLJ58534 complet... 240 7e-82
(B5YFZ0) RecName: Full=Serine hydroxymethyltransferase; ... 176 9e-82
CP001337_3355(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 172 3e-81
(B1I6M4) RecName: Full=Serine hydroxymethyltransferase; ... 163 6e-81
CS497732_1(CS497732|pid:none) Sequence 5 from Patent WO2007011736. 242 6e-81
CP000975_1663(CP000975|pid:none) Methylacidiphilum infernorum V4... 172 8e-81
(Q3A934) RecName: Full=Serine hydroxymethyltransferase; ... 179 2e-80
(Q8R887) RecName: Full=Serine hydroxymethyltransferase; ... 169 4e-80
CS497864_1(CS497864|pid:none) Sequence 137 from Patent WO2007011... 301 4e-80
CS497738_1(CS497738|pid:none) Sequence 11 from Patent WO20070117... 301 4e-80
CS497762_1(CS497762|pid:none) Sequence 35 from Patent WO20070117... 301 4e-80
BT062258_1(BT062258|pid:none) Zea mays full-length cDNA clone ZM... 301 4e-80
CS497858_1(CS497858|pid:none) Sequence 131 from Patent WO2007011... 301 4e-80
CS497758_1(CS497758|pid:none) Sequence 31 from Patent WO20070117... 300 7e-80
(Q7VFL1) RecName: Full=Serine hydroxymethyltransferase; ... 162 1e-79
(A0M3N2) RecName: Full=Serine hydroxymethyltransferase; ... 166 1e-79
CS497750_1(CS497750|pid:none) Sequence 23 from Patent WO20070117... 299 1e-79
AE000513_37(AE000513|pid:none) Deinococcus radiodurans R1 chromo... 169 2e-79
(Q9RYB2) RecName: Full=Serine hydroxymethyltransferase; ... 169 2e-79
CP000916_1864(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 171 3e-79
CP000820_2472(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 171 3e-79
(A2C090) RecName: Full=Serine hydroxymethyltransferase; ... 171 5e-79
(Q8KC36) RecName: Full=Serine hydroxymethyltransferase; ... 161 9e-79
(Q1GGA4) RecName: Full=Serine hydroxymethyltransferase; ... 172 9e-79
L23928_3(L23928|pid:none) Homo sapiens serine hydroxymethyltrans... 251 9e-79
(A8GPR4) RecName: Full=Serine hydroxymethyltransferase; ... 172 2e-78
(B5RMF3) RecName: Full=Serine hydroxymethyltransferase; ... 172 2e-78
CP001279_859(CP001279|pid:none) Nautilia profundicola AmH, compl... 170 2e-78
(Q7V4U3) RecName: Full=Serine hydroxymethyltransferase; ... 168 2e-78
(A7I3S9) RecName: Full=Serine hydroxymethyltransferase; ... 166 2e-78
(Q46HB6) RecName: Full=Serine hydroxymethyltransferase; ... 169 2e-78
(Q7VDS8) RecName: Full=Serine hydroxymethyltransferase; ... 167 3e-78
(Q30P60) RecName: Full=Serine hydroxymethyltransferase 2; ... 171 4e-78
(B5RPU9) RecName: Full=Serine hydroxymethyltransferase; ... 170 6e-78
(B2A3H6) RecName: Full=Serine hydroxymethyltransferase; ... 171 6e-78
(Q92QU6) RecName: Full=Serine hydroxymethyltransferase 1; ... 174 8e-78
(Q5SI56) RecName: Full=Serine hydroxymethyltransferase; ... 171 1e-77
(A5CCC4) RecName: Full=Serine hydroxymethyltransferase; ... 165 1e-77
GN104420_1(GN104420|pid:none) Sequence 9201 from Patent WO200903... 159 1e-77
(A9BIK8) RecName: Full=Serine hydroxymethyltransferase; ... 166 1e-77
(B7KD38) RecName: Full=Serine hydroxymethyltransferase; ... 169 2e-77
(A2CCJ3) RecName: Full=Serine hydroxymethyltransferase; ... 167 2e-77
(B3QPR3) RecName: Full=Serine hydroxymethyltransferase; ... 157 2e-77
(Q9WZH9) RecName: Full=Serine hydroxymethyltransferase; ... 167 2e-77
JC4958(JC4958) serine hydroxymethyltransferase (EC 2.1.2.-) 1 - ... 246 3e-77
CP000951_2389(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 168 5e-77
(Q5LD58) RecName: Full=Serine hydroxymethyltransferase; ... 157 5e-77
AM181176_5533(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 171 7e-77
AK071541_1(AK071541|pid:none) Oryza sativa Japonica Group cDNA c... 290 7e-77
(Q7U9J7) RecName: Full=Serine hydroxymethyltransferase; ... 157 9e-77
(Q31RK5) RecName: Full=Serine hydroxymethyltransferase; ... 167 1e-76
(A5GIG4) RecName: Full=Serine hydroxymethyltransferase; ... 159 1e-76
(B7JYG9) RecName: Full=Serine hydroxymethyltransferase; ... 168 1e-76
(B2S0U9) RecName: Full=Serine hydroxymethyltransferase; ... 167 1e-76
CP000680_752(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 166 1e-76
(A0LV49) RecName: Full=Serine hydroxymethyltransferase; ... 162 1e-76
(Q72IH2) RecName: Full=Serine hydroxymethyltransferase; ... 169 1e-76
(Q11NZ7) RecName: Full=Serine hydroxymethyltransferase; ... 164 2e-76
(A7HJ69) RecName: Full=Serine hydroxymethyltransferase; ... 164 2e-76
(Q01QZ0) RecName: Full=Serine hydroxymethyltransferase; ... 160 3e-76
(Q7V335) RecName: Full=Serine hydroxymethyltransferase; ... 158 3e-76
CP000618_3(CP000618|pid:none) Burkholderia vietnamiensis G4 plas... 162 3e-76
(A4VI36) RecName: Full=Serine hydroxymethyltransferase; ... 166 4e-76
(A9KSH6) RecName: Full=Serine hydroxymethyltransferase; ... 158 4e-76
CP000680_1334(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 171 5e-76
(A6Q7H8) RecName: Full=Serine hydroxymethyltransferase; ... 163 5e-76
AM778915_12(AM778915|pid:none) Microcystis aeruginosa PCC 7806 g... 167 7e-76
(B0JPX8) RecName: Full=Serine hydroxymethyltransferase; ... 167 7e-76
CP000738_812(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 169 9e-76
GN104402_1(GN104402|pid:none) Sequence 9183 from Patent WO200903... 166 9e-76
(Q3AW18) RecName: Full=Serine hydroxymethyltransferase; ... 159 9e-76
(Q5LPA8) RecName: Full=Serine hydroxymethyltransferase; ... 169 1e-75
CP001191_1168(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 164 1e-75
CT573326_4793(CT573326|pid:none) Pseudomonas entomophila str. L4... 171 1e-75
EU410957_6(EU410957|pid:none) Candidatus Pelagibacter ubique clo... 172 2e-75
CP001074_1558(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 165 2e-75
(Q1CUX5) RecName: Full=Serine hydroxymethyltransferase; ... 157 2e-75
(Q5FNK4) RecName: Full=Serine hydroxymethyltransferase; ... 164 2e-75
CP001472_2709(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 159 2e-75
(A6LKU9) RecName: Full=Serine hydroxymethyltransferase; ... 164 2e-75
(A6GXG2) RecName: Full=Serine hydroxymethyltransferase; ... 159 2e-75
(A1APU0) RecName: Full=Serine hydroxymethyltransferase; ... 165 2e-75
GN104244_1(GN104244|pid:none) Sequence 9025 from Patent WO200903... 165 3e-75
(Q8UG75) RecName: Full=Serine hydroxymethyltransferase 1; ... 165 3e-75
(Q4UK96) RecName: Full=Serine hydroxymethyltransferase; ... 165 3e-75
(Q3K5K9) RecName: Full=Serine hydroxymethyltransferase 3; ... 169 3e-75
(Q74CR5) RecName: Full=Serine hydroxymethyltransferase; ... 160 3e-75
(Q183G0) RecName: Full=Serine hydroxymethyltransferase; ... 173 3e-75
(B2U7G7) RecName: Full=Serine hydroxymethyltransferase; ... 163 4e-75
(B6JPT2) RecName: Full=Serine hydroxymethyltransferase; ... 157 4e-75
FP312974_16(FP312974|pid:none) uncultured bacterial clone magm95... 157 4e-75
(Q2KA25) RecName: Full=Serine hydroxymethyltransferase; ... 165 5e-75
(A5GWH2) RecName: Full=Serine hydroxymethyltransferase; ... 162 5e-75
(Q8Z2Z9) RecName: Full=Serine hydroxymethyltransferase 2; ... 172 5e-75
CP000249_613(CP000249|pid:none) Frankia sp. CcI3, complete genom... 164 5e-75
(Q88R12) RecName: Full=Serine hydroxymethyltransferase 1; ... 169 5e-75
(B0SEF8) RecName: Full=Serine hydroxymethyltransferase; ... 168 5e-75
(Q1J1W0) RecName: Full=Serine hydroxymethyltransferase; ... 165 5e-75
(Q6MLK1) RecName: Full=Serine hydroxymethyltransferase; ... 160 6e-75
AM933172_3879(AM933172|pid:none) Salmonella enterica subsp. ente... 171 8e-75
CP000386_1629(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 161 8e-75
(Q31CS4) RecName: Full=Serine hydroxymethyltransferase; ... 154 8e-75
(Q8Y1G1) RecName: Full=Serine hydroxymethyltransferase 1; ... 164 8e-75
(B8E008) RecName: Full=Serine hydroxymethyltransferase; ... 177 8e-75
(A5I526) RecName: Full=Serine hydroxymethyltransferase; ... 164 8e-75
(B3QUG2) RecName: Full=Serine hydroxymethyltransferase; ... 159 1e-74
(A8F595) RecName: Full=Serine hydroxymethyltransferase; ... 161 1e-74
CP000744_6118(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 167 1e-74
(Q9HVI7) RecName: Full=Serine hydroxymethyltransferase 3; ... 166 1e-74
(Q17YS0) RecName: Full=Serine hydroxymethyltransferase; ... 155 1e-74
(Q111H1) RecName: Full=Serine hydroxymethyltransferase; ... 161 1e-74
(Q0SMQ5) RecName: Full=Serine hydroxymethyltransferase; ... 169 1e-74
(A7HDY8) RecName: Full=Serine hydroxymethyltransferase; ... 161 1e-74
(A7GGI2) RecName: Full=Serine hydroxymethyltransferase; ... 166 1e-74
CP000744_2771(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 170 2e-74
CP001393_995(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 172 2e-74
(Q1MS11) RecName: Full=Serine hydroxymethyltransferase; ... 168 2e-74
CP001071_1603(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 167 2e-74
(Q1MIU5) RecName: Full=Serine hydroxymethyltransferase; ... 163 2e-74
(B7J2G3) RecName: Full=Serine hydroxymethyltransferase; ... 167 2e-74
(Q9HTE9) RecName: Full=Serine hydroxymethyltransferase 1; ... 167 2e-74
CP000438_5735(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 167 2e-74
(A0RQ16) RecName: Full=Serine hydroxymethyltransferase; ... 158 2e-74
CP000362_1079(CP000362|pid:none) Roseobacter denitrificans OCh 1... 167 3e-74
(A5EVR7) RecName: Full=Serine hydroxymethyltransferase; ... 166 3e-74
FM209186_4987(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 165 3e-74
CP000949_4487(CP000949|pid:none) Pseudomonas putida W619, comple... 159 3e-74
(A9NEA9) RecName: Full=Serine hydroxymethyltransferase; ... 165 3e-74
(B2KER5) RecName: Full=Serine hydroxymethyltransferase; ... 162 4e-74
(Q4K5R9) RecName: Full=Serine hydroxymethyltransferase 1; ... 160 4e-74
(B2US14) RecName: Full=Serine hydroxymethyltransferase; ... 157 4e-74
(B5YDB7) RecName: Full=Serine hydroxymethyltransferase; ... 176 4e-74
(B2TN52) RecName: Full=Serine hydroxymethyltransferase; ... 167 4e-74
(B2V398) RecName: Full=Serine hydroxymethyltransferase; ... 166 4e-74
(Q2NIT8) RecName: Full=Serine hydroxymethyltransferase; ... 155 5e-74
CP000680_4104(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 165 7e-74
CP000926_697(CP000926|pid:none) Pseudomonas putida GB-1, complet... 159 7e-74
(P56089) RecName: Full=Serine hydroxymethyltransferase; ... 157 7e-74
(B1IJJ8) RecName: Full=Serine hydroxymethyltransferase; ... 164 7e-74
(Q3IZN2) RecName: Full=Serine hydroxymethyltransferase; ... 167 8e-74
CP000577_2463(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 167 8e-74
GN104424_1(GN104424|pid:none) Sequence 9205 from Patent WO200903... 164 8e-74
CT573213_1091(CT573213|pid:none) Frankia alni str. ACN14A chromo... 162 8e-74
CP000744_5179(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 163 8e-74
(Q4ZM83) RecName: Full=Serine hydroxymethyltransferase 2; ... 166 1e-73
CP001144_4077(CP001144|pid:none) Salmonella enterica subsp. ente... 171 1e-73
CP000830_817(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 167 1e-73
CP001229_1444(CP001229|pid:none) Sulfurihydrogenibium azorense A... 159 1e-73
(Q9I138) RecName: Full=Serine hydroxymethyltransferase 2; ... 169 1e-73
(Q1LU81) RecName: Full=Serine hydroxymethyltransferase; ... 154 1e-73
(A7ZFA4) RecName: Full=Serine hydroxymethyltransferase; ... 157 1e-73
CP000815_487(CP000815|pid:none) Paulinella chromatophora chromat... 154 2e-73
(B3E1Z8) RecName: Full=Serine hydroxymethyltransferase; ... 157 2e-73
CP001087_3090(CP001087|pid:none) Desulfobacterium autotrophicum ... 155 2e-73
CP000932_469(CP000932|pid:none) Campylobacter lari RM2100, compl... 155 2e-73
(Q9A8J6) RecName: Full=Serine hydroxymethyltransferase; ... 167 2e-73
CP001340_1417(CP001340|pid:none) Caulobacter crescentus NA1000, ... 167 2e-73
(Q88AD1) RecName: Full=Serine hydroxymethyltransferase 1; ... 164 2e-73
(A4ITJ9) RecName: Full=Serine hydroxymethyltransferase; ... 156 2e-73
(A8FKI9) RecName: Full=Serine hydroxymethyltransferase; ... 154 2e-73
(B3CM26) RecName: Full=Serine hydroxymethyltransferase; ... 156 3e-73
AM181176_5214(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 159 3e-73
(A7H4X6) RecName: Full=Serine hydroxymethyltransferase; ... 153 3e-73
(A4SFY3) RecName: Full=Serine hydroxymethyltransferase; ... 152 4e-73
(Q4K4P6) RecName: Full=Serine hydroxymethyltransferase 2; ... 165 4e-73
CP001390_2590(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 160 4e-73
(Q391K1) RecName: Full=Serine hydroxymethyltransferase 2; ... 157 4e-73
(A1TYW8) RecName: Full=Serine hydroxymethyltransferase; ... 153 4e-73
(A4SVI6) RecName: Full=Serine hydroxymethyltransferase; ... 162 4e-73
CP000352_2667(CP000352|pid:none) Ralstonia metallidurans CH34, c... 158 5e-73
(Q3Z9B9) RecName: Full=Serine hydroxymethyltransferase; ... 156 5e-73
(B1XTC3) RecName: Full=Serine hydroxymethyltransferase; ... 162 5e-73
CS497830_1(CS497830|pid:none) Sequence 103 from Patent WO2007011... 159 5e-73
(B2IJJ3) RecName: Full=Serine hydroxymethyltransferase; ... 163 7e-73
(Q73GC3) RecName: Full=Serine hydroxymethyltransferase; ... 155 7e-73
(Q031D7) RecName: Full=Serine hydroxymethyltransferase; ... 157 7e-73
(A1VYC2) RecName: Full=Serine hydroxymethyltransferase; ... 153 7e-73
(B3EFN5) RecName: Full=Serine hydroxymethyltransferase; ... 152 9e-73
(Q2IWS4) RecName: Full=Serine hydroxymethyltransferase; ... 160 9e-73
(Q3ZZG3) RecName: Full=Serine hydroxymethyltransferase; ... 154 1e-72
(Q0APF8) RecName: Full=Serine hydroxymethyltransferase; ... 161 2e-72
GN104392_1(GN104392|pid:none) Sequence 9173 from Patent WO200903... 164 2e-72
(B2V9M1) RecName: Full=Serine hydroxymethyltransferase; ... 153 2e-72
(A5FS31) RecName: Full=Serine hydroxymethyltransferase; ... 154 2e-72
CP001189_3279(CP001189|pid:none) Gluconacetobacter diazotrophicu... 161 2e-72
BX571966_561(BX571966|pid:none) Burkholderia pseudomallei strain... 159 2e-72
(Q39A26) RecName: Full=Serine hydroxymethyltransferase 1; ... 160 2e-72
(Q2KV15) RecName: Full=Serine hydroxymethyltransferase; ... 162 2e-72
AB237163_95(AB237163|pid:none) Pseudomonas syringae pv. actinidi... 157 2e-72
(Q48DU7) RecName: Full=Serine hydroxymethyltransferase 1; ... 156 2e-72
(A1TRH1) RecName: Full=Serine hydroxymethyltransferase; ... 158 2e-72
(B1V975) RecName: Full=Serine hydroxymethyltransferase; ... 157 2e-72
AP010904_1492(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 160 3e-72
EU975853_1(EU975853|pid:none) Zea mays clone 503130 serine hydro... 275 3e-72
(Q6G3L3) RecName: Full=Serine hydroxymethyltransferase; ... 162 3e-72
(Q2NAR9) RecName: Full=Serine hydroxymethyltransferase; ... 159 3e-72
(Q7WPH6) RecName: Full=Serine hydroxymethyltransferase 1; ... 155 3e-72
(Q7VUW7) RecName: Full=Serine hydroxymethyltransferase; ... 163 4e-72
CP000459_1905(CP000459|pid:none) Burkholderia cenocepacia HI2424... 160 5e-72
CU466930_717(CU466930|pid:none) Candidatus Cloacamonas acidamino... 158 5e-72
CP001053_1052(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 164 5e-72
CP000959_1988(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 160 5e-72
(Q72PY2) RecName: Full=Serine hydroxymethyltransferase; ... 163 5e-72
(Q8YGG7) RecName: Full=Serine hydroxymethyltransferase; ... 162 6e-72
(B2S513) RecName: Full=Serine hydroxymethyltransferase; ... 162 6e-72
CP000615_627(CP000615|pid:none) Burkholderia vietnamiensis G4 ch... 153 6e-72
(B0S1N3) RecName: Full=Serine hydroxymethyltransferase; ... 155 6e-72
(A7GX48) RecName: Full=Serine hydroxymethyltransferase; ... 154 6e-72
(Q8EM73) RecName: Full=Serine hydroxymethyltransferase; ... 155 6e-72
CP000441_1273(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 160 8e-72
CP001104_548(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 158 8e-72
CP000379_297(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 159 1e-71
(A5EKI3) RecName: Full=Serine hydroxymethyltransferase; ... 158 1e-71
(Q6N693) RecName: Full=Serine hydroxymethyltransferase 1; ... 162 1e-71
CP001275_728(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 154 1e-71
(A6T0T6) RecName: Full=Serine hydroxymethyltransferase; ... 155 1e-71
(Q5KUI2) RecName: Full=Serine hydroxymethyltransferase; ... 154 1e-71
(Q7NYI8) RecName: Full=Serine hydroxymethyltransferase; ... 157 1e-71
(A0LI16) RecName: Full=Serine hydroxymethyltransferase; ... 157 1e-71
AP009384_1261(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 165 2e-71
(B0CL90) RecName: Full=Serine hydroxymethyltransferase; ... 162 2e-71
(Q6LHN7) RecName: Full=Serine hydroxymethyltransferase 2; ... 166 2e-71
(Q5NN85) RecName: Full=Serine hydroxymethyltransferase; ... 164 2e-71
(Q46RR4) RecName: Full=Serine hydroxymethyltransferase 2; ... 159 2e-71
CP000820_1000(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 155 2e-71
(Q129K3) RecName: Full=Serine hydroxymethyltransferase; ... 153 2e-71
CP000271_1411(CP000271|pid:none) Burkholderia xenovorans LB400 c... 160 2e-71
CP001026_1891(CP001026|pid:none) Burkholderia ambifaria MC40-6 c... 158 2e-71
(B3R0G5) RecName: Full=Serine hydroxymethyltransferase; ... 157 2e-71
CT573213_5798(CT573213|pid:none) Frankia alni str. ACN14A chromo... 153 2e-71
CP000884_4937(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 160 2e-71
(B8FJ72) RecName: Full=Serine hydroxymethyltransferase; ... 158 2e-71
BT045792_1(BT045792|pid:none) Salmo salar clone ssal-rgf-531-152... 272 3e-71
CP000378_319(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 154 3e-71
(B4S5Y9) RecName: Full=Serine hydroxymethyltransferase; ... 147 3e-71
(A0PZX4) RecName: Full=Serine hydroxymethyltransferase; ... 155 3e-71
CP000124_3199(CP000124|pid:none) Burkholderia pseudomallei 1710b... 155 4e-71
CP000390_1125(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 156 4e-71
(A5UQB7) RecName: Full=Serine hydroxymethyltransferase; ... 155 4e-71
CP000572_3188(CP000572|pid:none) Burkholderia pseudomallei 1106a... 155 4e-71
(Q7ND67) RecName: Full=Serine hydroxymethyltransferase; ... 156 5e-71
(Q474L3) RecName: Full=Serine hydroxymethyltransferase 1; ... 153 5e-71
(A0B8J6) RecName: Full=Serine hydroxymethyltransferase; ... 166 5e-71
CP001358_1596(CP001358|pid:none) Desulfovibrio desulfuricans sub... 152 5e-71
(B5ELV3) RecName: Full=Serine hydroxymethyltransferase; ... 152 5e-71
(A9MAE5) RecName: Full=Serine hydroxymethyltransferase; ... 158 6e-71
(Q38WJ7) RecName: Full=Serine hydroxymethyltransferase; ... 154 6e-71
AM747720_3203(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 152 6e-71
(Q46A52) RecName: Full=Serine hydroxymethyltransferase; ... 152 6e-71
(Q983B6) RecName: Full=Serine hydroxymethyltransferase 1; ... 155 8e-71
AP008230_4927(AP008230|pid:none) Desulfitobacterium hafniense Y5... 155 8e-71
(Q24MM6) RecName: Full=Serine hydroxymethyltransferase; ... 155 8e-71
CP001336_4751(CP001336|pid:none) Desulfitobacterium hafniense DC... 155 8e-71
(Q39J72) RecName: Full=Serine hydroxymethyltransferase 3; ... 152 8e-71
CS497776_1(CS497776|pid:none) Sequence 49 from Patent WO20070117... 155 8e-71
(Q831F9) RecName: Full=Serine hydroxymethyltransferase; ... 155 8e-71
GN104754_1(GN104754|pid:none) Sequence 9535 from Patent WO200903... 270 1e-70
CP000086_1365(CP000086|pid:none) Burkholderia thailandensis E264... 155 1e-70
AP009385_647(AP009385|pid:none) Burkholderia multivorans ATCC 17... 152 1e-70
(A8ZTV3) RecName: Full=Serine hydroxymethyltransferase; ... 151 1e-70
(Q87I03) RecName: Full=Serine hydroxymethyltransferase 2; ... 161 2e-70
CP000441_1975(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 149 2e-70
CP000774_2892(CP000774|pid:none) Parvibaculum lavamentivorans DS... 161 2e-70
(Q0TP32) RecName: Full=Serine hydroxymethyltransferase; ... 152 2e-70
(A9IVC5) RecName: Full=Serine hydroxymethyltransferase; ... 162 3e-70
AM295250_1607(AM295250|pid:none) Staphylococcus carnosus subsp. ... 158 3e-70
CP000254_20(CP000254|pid:none) Methanospirillum hungatei JF-1, c... 151 4e-70
CP001349_3269(CP001349|pid:none) Methylobacterium nodulans ORS 2... 161 5e-70
CP000440_679(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 150 5e-70
(Q04FR7) RecName: Full=Serine hydroxymethyltransferase; ... 147 5e-70
CP000790_1233(CP000790|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 162 7e-70
(A5G0E0) RecName: Full=Serine hydroxymethyltransferase; ... 154 7e-70
(A1VRC8) RecName: Full=Serine hydroxymethyltransferase; ... 150 7e-70
CP001638_3011(CP001638|pid:none) Geobacillus sp. WCH70, complete... 152 7e-70
AK297173_1(AK297173|pid:none) Homo sapiens cDNA FLJ58585 complet... 258 7e-70
(Q3IRX5) RecName: Full=Serine hydroxymethyltransferase; ... 157 9e-70
(Q0AUC3) RecName: Full=Serine hydroxymethyltransferase; ... 148 9e-70
(Q6G009) RecName: Full=Serine hydroxymethyltransferase; ... 164 1e-69
CP001348_1643(CP001348|pid:none) Clostridium cellulolyticum H10,... 158 1e-69
(Q0SRQ2) RecName: Full=Serine hydroxymethyltransferase; ... 152 1e-69
CP001562_1022(CP001562|pid:none) Bartonella grahamii as4aup, com... 159 2e-69
AP008957_3914(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 148 2e-69
(Q1QMB9) RecName: Full=Serine hydroxymethyltransferase; ... 154 2e-69
(A0L403) RecName: Full=Serine hydroxymethyltransferase; ... 166 2e-69
AE008384_442(AE008384|pid:none) Methanosarcina mazei strain Goe1... 152 2e-69
(Q8PZQ0) RecName: Full=Serine hydroxymethyltransferase; ... 152 2e-69
CT573072_436(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 164 2e-69
BA000038_693(BA000038|pid:none) Vibrio vulnificus YJ016 DNA, chr... 156 3e-69
(B1LZ88) RecName: Full=Serine hydroxymethyltransferase; ... 157 3e-69
(Q7MEH7) RecName: Full=Serine hydroxymethyltransferase 2; ... 156 3e-69
(A3CN08) RecName: Full=Serine hydroxymethyltransferase; ... 145 3e-69
(Q601P7) RecName: Full=Serine hydroxymethyltransferase; ... 145 3e-69
(Q82UP9) RecName: Full=Serine hydroxymethyltransferase; ... 153 3e-69
CP001339_605(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 151 3e-69
(Q6MS85) RecName: Full=Serine hydroxymethyltransferase; ... 151 3e-69
(Q98QM2) RecName: Full=Serine hydroxymethyltransferase; ... 145 3e-69
(Q21V29) RecName: Full=Serine hydroxymethyltransferase; ... 148 5e-69
CP000300_1675(CP000300|pid:none) Methanococcoides burtonii DSM 6... 144 5e-69
(Q2RFW7) RecName: Full=Serine hydroxymethyltransferase; ... 152 6e-69
(Q88UT5) RecName: Full=Serine hydroxymethyltransferase; ... 144 6e-69
(Q3SGX5) RecName: Full=Serine hydroxymethyltransferase; ... 144 6e-69
GN104398_1(GN104398|pid:none) Sequence 9179 from Patent WO200903... 145 8e-69
CP000542_4158(CP000542|pid:none) Verminephrobacter eiseniae EF01... 150 1e-68
CP000920_944(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 145 1e-68
(B7GMG4) RecName: Full=Serine hydroxymethyltransferase; ... 151 1e-68
(A1WQP4) RecName: Full=Serine hydroxymethyltransferase; ... 150 1e-68
AF442558_1(AF442558|pid:none) Chlamydomonas reinhardtii serine h... 263 1e-68
CP000555_2929(CP000555|pid:none) Methylibium petroleiphilum PM1,... 157 1e-68
CP001615_1317(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 152 1e-68
(Q4FLT4) RecName: Full=Serine hydroxymethyltransferase; ... 146 2e-68
(P39148) RecName: Full=Serine hydroxymethyltransferase; ... 146 2e-68
S30382(S30382)glycine hydroxymethyltransferase (EC 2.1.2.1) [sim... 149 2e-68
(A1K9B2) RecName: Full=Serine hydroxymethyltransferase; ... 149 3e-68
(B6IMT0) RecName: Full=Serine hydroxymethyltransferase; ... 147 4e-68
(Q97R16) RecName: Full=Serine hydroxymethyltransferase; ... 144 4e-68
CP001503_660(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 147 4e-68
AC130600_4(AC130600|pid:none) Oryza sativa (japonica cultivar-gr... 261 5e-68
CS497836_1(CS497836|pid:none) Sequence 109 from Patent WO2007011... 145 5e-68
CP001504_287(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 147 6e-68
(A4VUM9) RecName: Full=Serine hydroxymethyltransferase; ... 145 6e-68
(B5E4E3) RecName: Full=Serine hydroxymethyltransferase; ... 141 6e-68
(Q65DW5) RecName: Full=Serine hydroxymethyltransferase; ... 150 6e-68
(Q8Y4B2) RecName: Full=Serine hydroxymethyltransferase; ... 151 6e-68
(Q71WN9) RecName: Full=Serine hydroxymethyltransferase; ... 151 6e-68
(A0ALM4) RecName: Full=Serine hydroxymethyltransferase; ... 150 6e-68
(A7Z9Q9) RecName: Full=Serine hydroxymethyltransferase; ... 148 8e-68
(Q927V4) RecName: Full=Serine hydroxymethyltransferase; ... 151 8e-68
(Q8E5C6) RecName: Full=Serine hydroxymethyltransferase; ... 151 1e-67
(Q3K122) RecName: Full=Serine hydroxymethyltransferase; ... 151 1e-67
(Q5M4W1) RecName: Full=Serine hydroxymethyltransferase; ... 143 1e-67
(O86565) RecName: Full=Serine hydroxymethyltransferase; ... 142 1e-67
CP000780_2177(CP000780|pid:none) Candidatus Methanoregula boonei... 150 1e-67
(Q5HMB0) RecName: Full=Serine hydroxymethyltransferase; ... 147 1e-67
(P78011) RecName: Full=Serine hydroxymethyltransferase; ... 149 1e-67
AP009384_3051(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 149 2e-67
AF373807_1(AF373807|pid:none) Sinorhizobium meliloti serine hydr... 142 2e-67
CP001281_1506(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 145 2e-67
(Q03L77) RecName: Full=Serine hydroxymethyltransferase; ... 143 2e-67
(B8DJF7) RecName: Full=Serine hydroxymethyltransferase; ... 149 2e-67
BC079680_1(BC079680|pid:none) Xenopus laevis MGC79128 protein, m... 258 4e-67
BA000040_5912(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 150 4e-67
CP000918_1006(CP000918|pid:none) Streptococcus pneumoniae 70585,... 140 4e-67
(Q18GK0) RecName: Full=Serine hydroxymethyltransferase; ... 141 7e-67
(Q9K6G4) RecName: Full=Serine hydroxymethyltransferase; ... 152 9e-67
CP000386_462(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 142 1e-66
(Q1GV11) RecName: Full=Serine hydroxymethyltransferase; ... 156 1e-66
CP000781_862(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 147 2e-66
CP000562_1824(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 151 2e-66
CS497834_1(CS497834|pid:none) Sequence 107 from Patent WO2007011... 148 3e-66
(A5IUQ8) RecName: Full=Serine hydroxymethyltransferase; ... 148 3e-66
BA000026_275(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c... 147 5e-66
(Q2YUJ1) RecName: Full=Serine hydroxymethyltransferase; ... 148 5e-66
BC080148_1(BC080148|pid:none) Xenopus tropicalis shmt2 protein, ... 254 7e-66
(B1ZJN1) RecName: Full=Serine hydroxymethyltransferase; ... 147 8e-66
FJ973618_1(FJ973618|pid:none) Methylobacterium sp. MB200 serine ... 147 1e-65
(Q7UQN2) RecName: Full=Serine hydroxymethyltransferase; ... 139 1e-65
(Q49Z60) RecName: Full=Serine hydroxymethyltransferase; ... 142 2e-65
(Q03QY0) RecName: Full=Serine hydroxymethyltransferase; ... 141 2e-65
CS497854_1(CS497854|pid:none) Sequence 127 from Patent WO2007011... 252 2e-65
(P50435) RecName: Full=Serine hydroxymethyltransferase; ... 146 2e-65
CP000442_186(CP000442|pid:none) Burkholderia ambifaria AMMD chro... 152 2e-65
(P07511) RecName: Full=Serine hydroxymethyltransferase, cytosoli... 252 3e-65
AK302834_1(AK302834|pid:none) Homo sapiens cDNA FLJ60988 complet... 251 5e-65
(Q9SZJ5) RecName: Full=Serine hydroxymethyltransferase, mitochon... 251 5e-65
CP000389_152(CP000389|pid:none) Mesorhizobium sp. BNC1 plasmid 1... 148 5e-65
(A8FIC1) RecName: Full=Serine hydroxymethyltransferase; ... 141 6e-65
CP000910_1700(CP000910|pid:none) Renibacterium salmoninarum ATCC... 138 8e-65
(B1MYF5) RecName: Full=Serine hydroxymethyltransferase; ... 140 8e-65
CP001341_531(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 136 2e-64
CP000283_2297(CP000283|pid:none) Rhodopseudomonas palustris BisB... 147 3e-64
(P59953) RecName: Full=Serine hydroxymethyltransferase 1; ... 139 4e-64
(Q5WB66) RecName: Full=Serine hydroxymethyltransferase; ... 147 4e-64
(Q03Y25) RecName: Full=Serine hydroxymethyltransferase; ... 137 5e-64
AY035117_1(AY035117|pid:none) Arabidopsis thaliana putative glyc... 246 1e-63

>EF150637_1(EF150637|pid:none) Populus tremuloides serine
hydroxymethyltransferase (SHMT1) mRNA, complete cds.
Length = 471

Score = 303 bits (777), Expect(2) = e-151
Identities = 142/251 (56%), Positives = 195/251 (77%), Gaps = 2/251 (0%)
Frame = +3

Query: 681 LCDMAHISGMVAGKQAISPFLFCDVVTTTTHKTLRGPRAGLIFFRKTKRRDAKGNIIDD- 857
LCDMAHISG+VA ++A +PF +CD+VTTTTHK+LRGPRAG+IF+RK + KG +
Sbjct: 213 LCDMAHISGLVAAQEAANPFEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPENAV 272

Query: 858 -DLENRINFAVFPSCQGGPHENTIAGIAVALKEASSPDFQEYTKQVRRNSQTMGEELKKR 1034
D E+++NFAVFPS QGGPH + I +AVALK+ +P F+ Y KQV+ N+ +G+ L +
Sbjct: 273 YDFEDKVNFAVFPSLQGGPHNHQIGALAVALKQVQTPGFKAYAKQVKANAVALGKYLMGQ 332

Query: 1035 GYSLVTEGTDNHLVLWDLRPQGITGSKIEKACDEAHITVNKNAVYGDTNAIAPGGVRLGA 1214
GY LVTEGT+NHLVLWDLRP G+TG+K+EK CD A+ITVNKNAV+GD++A+APGGVR+G
Sbjct: 333 GYKLVTEGTENHLVLWDLRPLGLTGNKVEKLCDLANITVNKNAVFGDSSALAPGGVRIGT 392

Query: 1215 PALTSRGLKEQDFVKVVDFLDRVVKISLDIQSKVGKKMPDFQRAIADNQDLKQIRQEVKE 1394
PA+TSRGL E+DF ++ +FL R V I+L IQ + GK + DF + + +N+D++ ++ +V++
Sbjct: 393 PAMTSRGLVEKDFEQIGEFLHRAVTITLSIQKEYGKLLKDFNKGLVNNKDIEALKADVEK 452

Query: 1395 FSTKFGMPGEL 1427
FS F MPG L
Sbjct: 453 FSGSFDMPGFL 463

Score = 255 bits (652), Expect(2) = e-151
Identities = 123/176 (69%), Positives = 149/176 (84%), Gaps = 2/176 (1%)
Frame = +1

Query: 148 NRSVSESDPEIYDLMMKEKQRQFTGLELIASENFTSRAVMESIGSCFTNKYAEGLPGARY 327
N S+ DPEI+DL+ KEK+RQ G+ELIASENFTS AV+E++GS TNKY+EG+PG RY
Sbjct: 9 NTSLESVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRY 68

Query: 328 YGGNEVVDQLENLCIKRALETFNLNPEEWGVNVQPYSGSTANFAAFTGLLKPHDRIMGLD 507
YGGNE +DQ+ENLC RALE F+L+P +WGVNVQPYSGS ANFAA+T +L+PHDRIMGLD
Sbjct: 69 YGGNEYIDQIENLCRSRALEAFHLDPTKWGVNVQPYSGSPANFAAYTAVLQPHDRIMGLD 128

Query: 508 LPSGGHLTHGYQTD-KKKISATSIFFESMPYQVN-ETGYVDYNKMEANAALFRPKL 669
LPSGGHLTHGY T KKISATSI+FES+PY+VN +TGY+DY+++E A FRPKL
Sbjct: 129 LPSGGHLTHGYYTSGGKKISATSIYFESLPYKVNSQTGYIDYDRLEEKALDFRPKL 184

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,446,253,038
Number of extensions: 51044549
Number of successful extensions: 127732
Number of sequences better than 10.0: 854
Number of HSP's gapped: 124752
Number of HSP's successfully gapped: 1658
Length of query: 484
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 351
Effective length of database: 620,718,517
Effective search space: 217872199467
Effective search space used: 217872199467
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.74 gvh: 0.56 alm: 0.41 top: 0.53 tms: 0.00 mit: 0.55 mip: 0.07
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

84.0 %: mitochondrial
12.0 %: nuclear
4.0 %: cytoplasmic

>> prediction for Contig-U15526-1 is mit

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 2
AH (FL, L) 1
AF (FL, S) 10
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 1
FCL (DIR, L) 0
FC (DIR, S) 1
FC-IC (SUB) 0