Contig-U15497-1
Contig ID Contig-U15497-1
Contig update 2004. 6.11
Contig sequence
>Contig-U15497-1 (Contig-U15497-1Q) /CSM_Contig/Contig-U15497-1Q.Seq.d
GGTTACAAAGCACTTGGTAAAGCTACTTCTGAAATTTTAGGTTCATTAAC
TCCAGTTGCAACTTGTGGTACTCTTCCTTTGGTTCGTGATCTCCAAGATA
GTGGTTTCGATATTCAAATTACTGGTTTTGGTAAAGAAGAAACTTATCAT
GCTGATAATGAATATGCTTTATTATCTGATTTTAAAAATGCTATTAAAAT
TTTATCTAATTTTTATAGCAGAATTTAACAACAACAAAATGTCAGATAAC
GAAGCTTTAGATGTCGAAGACTACGCCCAAGCCGGTTCAGGTGCTTCATT
AACCTTCCCAATTCAATGTTCAGCATTAAGAAAGAACGGTTTCGTCGTCA
TTAAAGGTTTCCCATGTAAGATTGTTGATATGTCAACTTCCAAAACCGGT
AAACACGGTCACGCCAAAGTTAACATCACTGCTATCGATATCTTCACTGG
TAAGAAATACGAAGAAATTTGCCCATCAACTCACAACATTGATGTACCAA
ATGTCAGCAGAAAGGAATACACCGTTATGGATGTTCAAGATGGTTACTTA
TCACTCTTGGATGCTGGTGGTGAAGTCAAAGAAGATCTTGCCCTCCCAGA
AGATGATATTGGTAAAGAAATTACCCAAATGTTAAAAGAAGGTAAAGAGC
CATTAGTTTCAGTCATCTCTGCTTTAGGTAAAGAAGGTGTCGTCTCTGTT
AAAGTCAGCAACAATTAAATTGTTTAAAATTCTCTTTATAAAAAAAAAAA
AAAAAAAACAAAACTCTTACATGCAAAGACTTTTTTTCTTTTTCTATTTT
TTACCCTCTTTTCAATTTAAATAAATAAACCAAAAAAAAAAAGTTCAATT
TCATTAGAGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Gap no gap
Contig length 900
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 2770015
End point 2770757
Strand (PLUS/MINUS) PLUS
Number of clones 53
Number of EST 61
Link to clone list U15497
List of clone(s)

est1=VHN820Z,1,719
est2=SSD486E,192,744
est3=AHC103F,206,749
est4=AHC103Z,206,649
est5=VHD324F,206,749
est6=VHD324Z,206,643
est7=SFB873F,215,736
est8=VSD201Z,215,715
est9=VSD284Z,215,632
est10=VSJ492Z,215,630
est11=VSJ589Z,215,641
est12=VSJ706E,215,733
est13=VSG552F,218,753
est14=SLC576E,221,743
est15=SLF384Z,221,742
est16=VSE527E,221,869
est17=FC-AH24E,222,864
est18=SLE525E,222,742
est19=SSC438E,223,751
est20=SSL762E,227,746
est21=SSL858E,227,744
est22=VSD284F,227,753
est23=VSF801F,227,681
est24=VSI234F,227,680
est25=VSI234Z,227,632
est26=SSI771E,229,751
est27=SSM537F,229,713
est28=VSD201F,229,682
est29=VSJ589F,229,680
est30=SSF337E,230,870
est31=VSF801Z,231,648
est32=SLC365E,232,742
est33=SSK510E,232,839
est34=SSE381E,233,741
est35=FC-IC0180F,234,866
est36=SLF466F,234,529
est37=VSE475E,235,745
est38=VSA438Z,237,746
est39=VSG407F,241,681
est40=VSG407Z,241,638
est41=VSD448F,245,753
est42=VSD448Z,252,734
est43=SSG493Z,274,746
est44=SLC484Z,279,742
est45=SSB870Z,284,741
est46=SLG263Z,287,859
est47=SSI708E,292,860
est48=VSE750Z,296,900
est49=SLG819E,348,864
est50=VSE691Z,355,866
est51=SSH793Z,367,742
est52=FC-BG24Z,376,870
est53=VSB458Z,392,870
est54=SSH653Z,400,742
est55=VSE736Z,424,900
est56=FC-AJ03Z,442,883
est57=SLD113E,459,747
est58=SSL445Z,479,747
est59=SSG203Z,520,860
est60=FC-BM02Z,546,864
est61=VSD152F,586,753
Translated Amino Acid sequence
vtkhlvklllkf*vh*LQLQLVVLFLWFVISKIVVSIFKLLVLVKKKLIMLIMNMLYYLI
LKMLLKFYLIFIAEFNNNKMSDNEALDVEDYAQAGSGASLTFPIQCSALRKNGFVVIKGF
PCKIVDMSTSKTGKHGHAKVNITAIDIFTGKKYEEICPSTHNIDVPNVSRKEYTVMDVQD
GYLSLLDAGGEVKEDLALPEDDIGKEITQMLKEGKEPLVSVISALGKEGVVSVKVSNN*i
v*nslykkkkkktkllhaktfflflfftlfsi*inkpkkkssisleikkkkkkkkkkkk


Translated Amino Acid sequence (All Frames)
Frame A:
gykalgkatseilgsltpvatcgtlplvrdlqdsgfdiqitgfgkeetyhadneyallsd
fknaikilsnfysri*qqqnvr*rsfrcrrlrpsrfrcfinlpnsmfsikkerfrrh*rf
pm*dc*yvnfqnr*trsrqs*hhcyrylhw*eirrnlpinsqh*ctkcqqkgihrygcsr
wllitlgcww*sqrrscpprr*yw*rnypnvkrr*raisfshlcfr*rrcrlc*sqqqln
clkfsl*kkkkknktltckdffsfsifyplfnlnk*tkkkkfnfirdkkkkkkkkkkkkk


Frame B:
vtkhlvklllkf*vh*LQLQLVVLFLWFVISKIVVSIFKLLVLVKKKLIMLIMNMLYYLI
LKMLLKFYLIFIAEFNNNKMSDNEALDVEDYAQAGSGASLTFPIQCSALRKNGFVVIKGF
PCKIVDMSTSKTGKHGHAKVNITAIDIFTGKKYEEICPSTHNIDVPNVSRKEYTVMDVQD
GYLSLLDAGGEVKEDLALPEDDIGKEITQMLKEGKEPLVSVISALGKEGVVSVKVSNN*i
v*nslykkkkkktkllhaktfflflfftlfsi*inkpkkkssisleikkkkkkkkkkkk


Frame C:
lqstw*syf*nfrfinsscnlwyssfgs*spr*wfrysnywfw*rrnlsc***icfii*f
*kcy*nfi*fl*qnltttkcqitkl*mskttpkpvqvlh*psqfnvqh*ertvssslkvs
hvrllicqlpkpvntvtpkltsllsisslvrntkkfahqlttlmyqmsaerntplwmfkm
vtyhswmlvvkskkilpsqkmilvkklpkc*kkvksh*fqssll*vkkvssllksatikl
fkilfikkkkkkqnsymqrlffffyflpsfqfk*inqkkkvqfh*r*kkkkkkkkkkkk


own update 2004. 6.23
Homology vs CSM-cDNA
Query= Contig-U15497-1 (Contig-U15497-1Q)
/CSM_Contig/Contig-U15497-1Q.Seq.d
(900 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U15497-1 (Contig-U15497-1Q) /CSM_Contig/Conti... 1465 0.0
Contig-U16279-1 (Contig-U16279-1Q) /CSM_Contig/Conti... 410 e-114
Contig-U11376-1 (Contig-U11376-1Q) /CSM_Contig/Conti... 40 0.006
Contig-U15283-1 (Contig-U15283-1Q) /CSM_Contig/Conti... 34 0.36
Contig-U15081-1 (Contig-U15081-1Q) /CSM_Contig/Conti... 34 0.36
Contig-U14310-1 (Contig-U14310-1Q) /CSM_Contig/Conti... 34 0.36
Contig-U13460-1 (Contig-U13460-1Q) /CSM_Contig/Conti... 34 0.36
Contig-U12561-1 (Contig-U12561-1Q) /CSM_Contig/Conti... 34 0.36
Contig-U11392-1 (Contig-U11392-1Q) /CSM_Contig/Conti... 34 0.36
Contig-U06368-1 (Contig-U06368-1Q) /CSM_Contig/Conti... 34 0.36

>Contig-U15497-1 (Contig-U15497-1Q) /CSM_Contig/Contig-U15497-1Q.Seq.d
Length = 900

Score = 1465 bits (739), Expect = 0.0
Identities = 739/739 (100%)
Strand = Plus / Plus


Query: 1 ggttacaaagcacttggtaaagctacttctgaaattttaggttcattaactccagttgca 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ggttacaaagcacttggtaaagctacttctgaaattttaggttcattaactccagttgca 60


Query: 61 acttgtggtactcttcctttggttcgtgatctccaagatagtggtttcgatattcaaatt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 acttgtggtactcttcctttggttcgtgatctccaagatagtggtttcgatattcaaatt 120


Query: 121 actggttttggtaaagaagaaacttatcatgctgataatgaatatgctttattatctgat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 actggttttggtaaagaagaaacttatcatgctgataatgaatatgctttattatctgat 180


Query: 181 tttaaaaatgctattaaaattttatctaatttttatagcagaatttaacaacaacaaaat 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tttaaaaatgctattaaaattttatctaatttttatagcagaatttaacaacaacaaaat 240


Query: 241 gtcagataacgaagctttagatgtcgaagactacgcccaagccggttcaggtgcttcatt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gtcagataacgaagctttagatgtcgaagactacgcccaagccggttcaggtgcttcatt 300


Query: 301 aaccttcccaattcaatgttcagcattaagaaagaacggtttcgtcgtcattaaaggttt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 aaccttcccaattcaatgttcagcattaagaaagaacggtttcgtcgtcattaaaggttt 360


Query: 361 cccatgtaagattgttgatatgtcaacttccaaaaccggtaaacacggtcacgccaaagt 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 cccatgtaagattgttgatatgtcaacttccaaaaccggtaaacacggtcacgccaaagt 420


Query: 421 taacatcactgctatcgatatcttcactggtaagaaatacgaagaaatttgcccatcaac 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 taacatcactgctatcgatatcttcactggtaagaaatacgaagaaatttgcccatcaac 480


Query: 481 tcacaacattgatgtaccaaatgtcagcagaaaggaatacaccgttatggatgttcaaga 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tcacaacattgatgtaccaaatgtcagcagaaaggaatacaccgttatggatgttcaaga 540


Query: 541 tggttacttatcactcttggatgctggtggtgaagtcaaagaagatcttgccctcccaga 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 tggttacttatcactcttggatgctggtggtgaagtcaaagaagatcttgccctcccaga 600


Query: 601 agatgatattggtaaagaaattacccaaatgttaaaagaaggtaaagagccattagtttc 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 agatgatattggtaaagaaattacccaaatgttaaaagaaggtaaagagccattagtttc 660


Query: 661 agtcatctctgctttaggtaaagaaggtgtcgtctctgttaaagtcagcaacaattaaat 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 agtcatctctgctttaggtaaagaaggtgtcgtctctgttaaagtcagcaacaattaaat 720


Query: 721 tgtttaaaattctctttat 739
|||||||||||||||||||
Sbjct: 721 tgtttaaaattctctttat 739


Score = 58.0 bits (29), Expect = 2e-08
Identities = 29/29 (100%)
Strand = Plus / Plus


Query: 803 accctcttttcaatttaaataaataaacc 831
|||||||||||||||||||||||||||||
Sbjct: 803 accctcttttcaatttaaataaataaacc 831


Score = 44.1 bits (22), Expect = 4e-04
Identities = 22/22 (100%)
Strand = Plus / Plus


Query: 759 caaaactcttacatgcaaagac 780
||||||||||||||||||||||
Sbjct: 759 caaaactcttacatgcaaagac 780


>Contig-U16279-1 (Contig-U16279-1Q) /CSM_Contig/Contig-U16279-1Q.Seq.d
Length = 1511

Score = 410 bits (207), Expect = e-114
Identities = 207/207 (100%)
Strand = Plus / Plus


Query: 1 ggttacaaagcacttggtaaagctacttctgaaattttaggttcattaactccagttgca 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1159 ggttacaaagcacttggtaaagctacttctgaaattttaggttcattaactccagttgca 1218


Query: 61 acttgtggtactcttcctttggttcgtgatctccaagatagtggtttcgatattcaaatt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1219 acttgtggtactcttcctttggttcgtgatctccaagatagtggtttcgatattcaaatt 1278


Query: 121 actggttttggtaaagaagaaacttatcatgctgataatgaatatgctttattatctgat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1279 actggttttggtaaagaagaaacttatcatgctgataatgaatatgctttattatctgat 1338


Query: 181 tttaaaaatgctattaaaattttatct 207
|||||||||||||||||||||||||||
Sbjct: 1339 tttaaaaatgctattaaaattttatct 1365


>Contig-U11376-1 (Contig-U11376-1Q) /CSM_Contig/Contig-U11376-1Q.Seq.d
Length = 2135

Score = 40.1 bits (20), Expect = 0.006
Identities = 20/20 (100%)
Strand = Plus / Minus


Query: 170 tattatctgattttaaaaat 189
||||||||||||||||||||
Sbjct: 2071 tattatctgattttaaaaat 2052


Score = 30.2 bits (15), Expect = 5.6
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 223 atttaacaacaacaa 237
|||||||||||||||
Sbjct: 2084 atttaacaacaacaa 2098


Database: CSM
Posted date: Jun 21, 2004 1:35 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 26,089
Number of Sequences: 8402
Number of extensions: 26089
Number of successful extensions: 2110
Number of sequences better than 10.0: 189
length of query: 900
length of database: 8,075,542
effective HSP length: 16
effective length of query: 884
effective length of database: 7,941,110
effective search space: 7019941240
effective search space used: 7019941240
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 1.29
Homology vs DNA
Query= Contig-U15497-1 (Contig-U15497-1Q) /CSM_Contig/Contig-U15497-1Q.Seq.d
(900 letters)

Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ444992) Dictyostelium discoideum cDNA clone:ddv58h06, 3' ... 1425 0.0 1
(AU263170) Dictyostelium discoideum vegetative cDNA clone:VS... 1029 0.0 4
(AU284284) Dictyostelium discoideum gamete cDNA clone:FC-AH2... 1027 0.0 4
(C92781) Dictyostelium discoideum slug cDNA, clone SSF337. 1011 0.0 4
(C94184) Dictyostelium discoideum slug cDNA, clone SSK510. 1007 0.0 3
(BJ419790) Dictyostelium discoideum cDNA clone:ddv37p05, 5' ... 1057 0.0 1
(AU271395) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 1003 0.0 3
(BJ331364) Dictyostelium discoideum cDNA clone:dda35e01, 5' ... 1043 0.0 1
(AU266617) Dictyostelium discoideum vegetative cDNA clone:VS... 1035 0.0 1
(BJ387759) Dictyostelium discoideum cDNA clone:dds4b20, 5' e... 1031 0.0 1
(AU034805) Dictyostelium discoideum slug cDNA, clone SLE525. 1027 0.0 1
(AU051940) Dictyostelium discoideum slug cDNA, clone SSC438. 1025 0.0 1
(C92101) Dictyostelium discoideum slug cDNA, clone SSD486. 1025 0.0 1
(AU034587) Dictyostelium discoideum slug cDNA, clone SLC576. 1021 0.0 1
(AU263777) Dictyostelium discoideum vegetative cDNA clone:VS... 1017 0.0 1
(C93912) Dictyostelium discoideum slug cDNA, clone SSL858. 1017 0.0 1
(X14970) Dictyostelium discoideum mRNA for translation initi... 1009 0.0 1
(AU034514) Dictyostelium discoideum slug cDNA, clone SLC365. 1007 0.0 1
(C90300) Dictyostelium discoideum slug cDNA, clone SSI771. 1007 0.0 1
(AU037862) Dictyostelium discoideum slug cDNA, clone SSE381. 1005 0.0 1
(AU263135) Dictyostelium discoideum vegetative cDNA clone:VS... 1001 0.0 1
(AU052959) Dictyostelium discoideum slug cDNA, clone SLF384. 1001 0.0 1
(AU261476) Dictyostelium discoideum vegetative cDNA clone:VS... 997 0.0 1
(C93827) Dictyostelium discoideum slug cDNA, clone SSL762. 646 0.0 3
(AU264047) Dictyostelium discoideum vegetative cDNA clone:VS... 969 0.0 1
(AX001144) Sequence 5 from Patent WO9901551. 967 0.0 1
(AR228401) Sequence 5 from patent US 6448040. 967 0.0 1
(AU263346) Dictyostelium discoideum vegetative cDNA clone:VS... 882 0.0 4
(AU039723) Dictyostelium discoideum slug cDNA, clone SLG263. 890 0.0 4
(C90547) Dictyostelium discoideum slug cDNA, clone SSI708. 888 0.0 4
(AU270348) Dictyostelium discoideum vegetative cDNA clone:VS... 924 0.0 2
(AU264048) Dictyostelium discoideum vegetative cDNA clone:VS... 932 0.0 1
(C94171) Dictyostelium discoideum slug cDNA, clone SSG493. 916 0.0 1
(AU034564) Dictyostelium discoideum slug cDNA, clone SLC484. 914 0.0 1
(AU270347) Dictyostelium discoideum vegetative cDNA clone:VS... 898 0.0 1
(AU265810) Dictyostelium discoideum vegetative cDNA clone:VS... 898 0.0 1
(AU268366) Dictyostelium discoideum vegetative cDNA clone:VS... 896 0.0 1
(AU263637) Dictyostelium discoideum vegetative cDNA clone:VS... 896 0.0 1
(AU270165) Dictyostelium discoideum vegetative cDNA clone:VS... 892 0.0 1
(AU266427) Dictyostelium discoideum vegetative cDNA clone:VS... 870 0.0 1
(AU263638) Dictyostelium discoideum vegetative cDNA clone:VS... 801 0.0 4
(BJ348997) Dictyostelium discoideum cDNA clone:dda35e01, 3' ... 864 0.0 1
(AU263300) Dictyostelium discoideum vegetative cDNA clone:VS... 765 0.0 4
(AU039951) Dictyostelium discoideum slug cDNA, clone SLG819. 771 0.0 4
(BJ438538) Dictyostelium discoideum cDNA clone:ddv37p05, 3' ... 839 0.0 1
(AU036956) Dictyostelium discoideum slug cDNA, clone SSB870. 783 0.0 3
(AU268367) Dictyostelium discoideum vegetative cDNA clone:VS... 803 0.0 1
(AU265811) Dictyostelium discoideum vegetative cDNA clone:VS... 773 0.0 2
(AU266428) Dictyostelium discoideum vegetative cDNA clone:VS... 787 0.0 1
(AU263778) Dictyostelium discoideum vegetative cDNA clone:VS... 749 0.0 2
(AU270008) Dictyostelium discoideum vegetative cDNA clone:VS... 745 0.0 2
(AU270166) Dictyostelium discoideum vegetative cDNA clone:VS... 745 0.0 2
(AU262025) Dictyostelium discoideum vegetative cDNA clone:VS... 692 0.0 4
(AU038499) Dictyostelium discoideum slug cDNA, clone SSH793. 741 0.0 1
(AU284676) Dictyostelium discoideum gamete cDNA clone:FC-BG2... 611 0.0 5
(AU263333) Dictyostelium discoideum vegetative cDNA clone:VS... 628 0.0 4
(AU038391) Dictyostelium discoideum slug cDNA, clone SSH653. 676 0.0 1
(AU284297) Dictyostelium discoideum gamete cDNA clone:FC-AJ0... 591 0.0 4
(AU052300) Dictyostelium discoideum slug cDNA, clone SLD113. 561 e-155 1
(AU061697) Dictyostelium discoideum slug cDNA, clone SLF466. 331 e-153 2
(AU038759) Dictyostelium discoideum slug cDNA, clone SSL445. 521 e-143 1
(C89824) Dictyostelium discoideum slug cDNA, clone SSG203. 440 e-137 3
(AU074943) Dictyostelium discoideum slug cDNA, clone SSM537. 476 e-130 1
(EL840657) CBXT2574.g1 NICHD_XGC_trop_25 Xenopus (Silurana) ... 212 e-129 4
(EL840656) CBXT2574.b1 NICHD_XGC_trop_25 Xenopus (Silurana) ... 212 e-129 4
(AU284590) Dictyostelium discoideum gamete cDNA clone:FC-BE0... 410 e-110 1
(AU284501) Dictyostelium discoideum gamete cDNA clone:FC-BA0... 410 e-110 1
(AU270559) Dictyostelium discoideum vegetative cDNA clone:VS... 410 e-110 1
(AU264704) Dictyostelium discoideum vegetative cDNA clone:VS... 410 e-110 1
(AU051824) Dictyostelium discoideum slug cDNA, clone SSA878. 410 e-110 1
(AU040026) Dictyostelium discoideum slug cDNA, clone SLH474. 410 e-110 1
(AU034551) Dictyostelium discoideum slug cDNA, clone SLC458. 410 e-110 1
(AU033606) Dictyostelium discoideum slug cDNA, clone SLB223. 410 e-110 1
(C94423) Dictyostelium discoideum slug cDNA, clone SSK781. 410 e-110 1
(C92765) Dictyostelium discoideum slug cDNA, clone SSF242. 410 e-110 1
(BJ442334) Dictyostelium discoideum cDNA clone:ddv49f13, 3' ... 410 e-110 1
(BJ437786) Dictyostelium discoideum cDNA clone:ddv35j08, 3' ... 410 e-110 1
(BJ436126) Dictyostelium discoideum cDNA clone:ddv30f02, 3' ... 410 e-110 1
(BJ435831) Dictyostelium discoideum cDNA clone:ddv28g17, 3' ... 410 e-110 1
(BJ435793) Dictyostelium discoideum cDNA clone:ddv28m07, 3' ... 410 e-110 1
(BJ435713) Dictyostelium discoideum cDNA clone:ddv28b04, 3' ... 410 e-110 1
(BJ435664) Dictyostelium discoideum cDNA clone:ddv27g22, 3' ... 410 e-110 1
(BJ435649) Dictyostelium discoideum cDNA clone:ddv27e19, 3' ... 410 e-110 1
(BJ435583) Dictyostelium discoideum cDNA clone:ddv27h13, 3' ... 410 e-110 1
(BJ435264) Dictyostelium discoideum cDNA clone:ddv26h16, 3' ... 410 e-110 1
(BJ435217) Dictyostelium discoideum cDNA clone:ddv26o11, 3' ... 410 e-110 1
(BJ435212) Dictyostelium discoideum cDNA clone:ddv26n10, 3' ... 410 e-110 1
(BJ435200) Dictyostelium discoideum cDNA clone:ddv26l07, 3' ... 410 e-110 1
(BJ434899) Dictyostelium discoideum cDNA clone:ddv25j09, 3' ... 410 e-110 1
(BJ434863) Dictyostelium discoideum cDNA clone:ddv25o04, 3' ... 410 e-110 1
(BJ434777) Dictyostelium discoideum cDNA clone:ddv24o20, 3' ... 410 e-110 1
(BJ434769) Dictyostelium discoideum cDNA clone:ddv24m23, 3' ... 410 e-110 1
(BJ434697) Dictyostelium discoideum cDNA clone:ddv24o15, 3' ... 410 e-110 1
(BJ434638) Dictyostelium discoideum cDNA clone:ddv24b17, 3' ... 410 e-110 1
(BJ434576) Dictyostelium discoideum cDNA clone:ddv24f08, 3' ... 410 e-110 1
(BJ434574) Dictyostelium discoideum cDNA clone:ddv24e08, 3' ... 410 e-110 1
(BJ434473) Dictyostelium discoideum cDNA clone:ddv16p23, 3' ... 410 e-110 1
(BJ434309) Dictyostelium discoideum cDNA clone:ddv16b15, 3' ... 410 e-110 1
(BJ434244) Dictyostelium discoideum cDNA clone:ddv16e12, 3' ... 410 e-110 1
(BJ434210) Dictyostelium discoideum cDNA clone:ddv16o06, 3' ... 410 e-110 1
(BJ434174) Dictyostelium discoideum cDNA clone:ddv16i02, 3' ... 410 e-110 1
(BJ434142) Dictyostelium discoideum cDNA clone:ddv16c02, 3' ... 410 e-110 1
(BJ434085) Dictyostelium discoideum cDNA clone:ddv23h23, 3' ... 410 e-110 1
(BJ433867) Dictyostelium discoideum cDNA clone:ddv23n05, 3' ... 410 e-110 1
(BJ433843) Dictyostelium discoideum cDNA clone:ddv23i03, 3' ... 410 e-110 1
(BJ433517) Dictyostelium discoideum cDNA clone:ddv22j05, 3' ... 410 e-110 1
(BJ433515) Dictyostelium discoideum cDNA clone:ddv22j03, 3' ... 410 e-110 1
(BJ433386) Dictyostelium discoideum cDNA clone:ddv21m18, 3' ... 410 e-110 1
(BJ433249) Dictyostelium discoideum cDNA clone:ddv21a08, 3' ... 410 e-110 1
(BJ433004) Dictyostelium discoideum cDNA clone:ddv20a16, 3' ... 410 e-110 1
(BJ432957) Dictyostelium discoideum cDNA clone:ddv20h11, 3' ... 410 e-110 1
(BJ432625) Dictyostelium discoideum cDNA clone:ddv19a12, 3' ... 410 e-110 1
(BJ432279) Dictyostelium discoideum cDNA clone:ddv18a10, 3' ... 410 e-110 1
(BJ432231) Dictyostelium discoideum cDNA clone:ddv18h01, 3' ... 410 e-110 1
(BJ432199) Dictyostelium discoideum cDNA clone:ddv18b02, 3' ... 410 e-110 1
(BJ431984) Dictyostelium discoideum cDNA clone:ddv17b09, 3' ... 410 e-110 1
(BJ431960) Dictyostelium discoideum cDNA clone:ddv17m04, 3' ... 410 e-110 1
(BJ431664) Dictyostelium discoideum cDNA clone:ddv15d03, 3' ... 410 e-110 1
(BJ431586) Dictyostelium discoideum cDNA clone:ddv14o15, 3' ... 410 e-110 1
(BJ431504) Dictyostelium discoideum cDNA clone:ddv14m11, 3' ... 410 e-110 1
(BJ431176) Dictyostelium discoideum cDNA clone:ddv13j04, 3' ... 410 e-110 1
(BJ431118) Dictyostelium discoideum cDNA clone:ddv9n20, 3' e... 410 e-110 1
(BJ430846) Dictyostelium discoideum cDNA clone:ddv9d01, 3' e... 410 e-110 1
(BJ430667) Dictyostelium discoideum cDNA clone:ddv8p05, 3' e... 410 e-110 1
(BJ430593) Dictyostelium discoideum cDNA clone:ddv7i22, 3' e... 410 e-110 1
(BJ430229) Dictyostelium discoideum cDNA clone:ddv6d14, 3' e... 410 e-110 1
(BJ430201) Dictyostelium discoideum cDNA clone:ddv6n09, 3' e... 410 e-110 1
(BJ430113) Dictyostelium discoideum cDNA clone:ddv6k01, 3' e... 410 e-110 1
(BJ429686) Dictyostelium discoideum cDNA clone:ddv4e16, 3' e... 410 e-110 1
(BJ429620) Dictyostelium discoideum cDNA clone:ddv4b09, 3' e... 410 e-110 1
(BJ429290) Dictyostelium discoideum cDNA clone:ddv2p21, 3' e... 410 e-110 1
(BJ429215) Dictyostelium discoideum cDNA clone:ddv2a21, 3' e... 410 e-110 1
(BJ428683) Dictyostelium discoideum cDNA clone:ddv12h23, 3' ... 410 e-110 1
(BJ428651) Dictyostelium discoideum cDNA clone:ddv12p18, 3' ... 410 e-110 1
(BJ428562) Dictyostelium discoideum cDNA clone:ddv12n07, 3' ... 410 e-110 1
(BJ428502) Dictyostelium discoideum cDNA clone:ddv12n06, 3' ... 410 e-110 1
(BJ428245) Dictyostelium discoideum cDNA clone:ddv11b11, 3' ... 410 e-110 1
(BJ428143) Dictyostelium discoideum cDNA clone:ddv10l19, 3' ... 410 e-110 1
(BJ428046) Dictyostelium discoideum cDNA clone:ddv10g15, 3' ... 410 e-110 1
(BJ427955) Dictyostelium discoideum cDNA clone:ddv10o05, 3' ... 410 e-110 1
(BJ402858) Dictyostelium discoideum cDNA clone:dds18b13, 3' ... 410 e-110 1
(BJ402681) Dictyostelium discoideum cDNA clone:dds17n13, 3' ... 410 e-110 1
(BJ398766) Dictyostelium discoideum cDNA clone:dds2j03, 3' e... 410 e-110 1
(BJ372576) Dictyostelium discoideum cDNA clone:ddc13p01, 3' ... 410 e-110 1
(BJ371877) Dictyostelium discoideum cDNA clone:ddc10i03, 3' ... 410 e-110 1
(BJ343938) Dictyostelium discoideum cDNA clone:dda17m18, 3' ... 410 e-110 1
(BJ343347) Dictyostelium discoideum cDNA clone:dda22e20, 3' ... 410 e-110 1
(BJ432650) Dictyostelium discoideum cDNA clone:ddv19f10, 3' ... 406 e-109 1
(BJ431505) Dictyostelium discoideum cDNA clone:ddv14m12, 3' ... 406 e-109 1
(BJ434434) Dictyostelium discoideum cDNA clone:ddv16i20, 3' ... 404 e-108 1
(BJ433636) Dictyostelium discoideum cDNA clone:ddv22a15, 3' ... 404 e-108 1
(BJ433328) Dictyostelium discoideum cDNA clone:ddv21p07, 3' ... 404 e-108 1
(BJ433067) Dictyostelium discoideum cDNA clone:ddv20n14, 3' ... 404 e-108 1
(BJ432817) Dictyostelium discoideum cDNA clone:ddv19n23, 3' ... 404 e-108 1
(BJ432752) Dictyostelium discoideum cDNA clone:ddv19n15, 3' ... 404 e-108 1
(BJ432308) Dictyostelium discoideum cDNA clone:ddv18f10, 3' ... 404 e-108 1
(BJ431220) Dictyostelium discoideum cDNA clone:ddv13d09, 3' ... 404 e-108 1
(BJ430924) Dictyostelium discoideum cDNA clone:ddv9d12, 3' e... 404 e-108 1
(BJ430840) Dictyostelium discoideum cDNA clone:ddv9b04, 3' e... 404 e-108 1
(BJ429217) Dictyostelium discoideum cDNA clone:ddv2a24, 3' e... 404 e-108 1
(BJ429012) Dictyostelium discoideum cDNA clone:ddv2f06, 3' e... 404 e-108 1
(BJ428412) Dictyostelium discoideum cDNA clone:ddv11h20, 3' ... 404 e-108 1
(BJ428235) Dictyostelium discoideum cDNA clone:ddv11p03, 3' ... 404 e-108 1
(BJ402998) Dictyostelium discoideum cDNA clone:dds18a04, 3' ... 404 e-108 1
(BJ376201) Dictyostelium discoideum cDNA clone:ddc21h16, 3' ... 404 e-108 1
(AU034465) Dictyostelium discoideum slug cDNA, clone SLC175. 402 e-108 1
(BJ435550) Dictyostelium discoideum cDNA clone:ddv27a16, 3' ... 402 e-108 1
(BJ435421) Dictyostelium discoideum cDNA clone:ddv27g04, 3' ... 402 e-108 1
(BJ433438) Dictyostelium discoideum cDNA clone:ddv21j21, 3' ... 402 e-108 1
(BJ431132) Dictyostelium discoideum cDNA clone:ddv9p24, 3' e... 402 e-108 1
(BJ435778) Dictyostelium discoideum cDNA clone:ddv28g07, 3' ... 400 e-107 1
(BJ431820) Dictyostelium discoideum cDNA clone:ddv15o14, 3' ... 400 e-107 1
(BJ431671) Dictyostelium discoideum cDNA clone:ddv15f02, 3' ... 400 e-107 1
(BJ430794) Dictyostelium discoideum cDNA clone:ddv8f19, 3' e... 400 e-107 1
(BJ435999) Dictyostelium discoideum cDNA clone:ddv29l08, 3' ... 396 e-106 1
(BJ432128) Dictyostelium discoideum cDNA clone:ddv17b19, 3' ... 396 e-106 1
(U23957) Dictyostelium discoideum P52D mRNA, complete cds. 394 e-105 1
(BJ432570) Dictyostelium discoideum cDNA clone:ddv19g06, 3' ... 379 e-104 2
(BJ436035) Dictyostelium discoideum cDNA clone:ddv29i14, 3' ... 389 e-103 1
(BJ428974) Dictyostelium discoideum cDNA clone:ddv1l24, 3' e... 389 e-103 1
(BJ431465) Dictyostelium discoideum cDNA clone:ddv14c09, 3' ... 349 e-102 2
(BJ374016) Dictyostelium discoideum cDNA clone:ddc5k19, 3' e... 349 e-102 2
(BJ429809) Dictyostelium discoideum cDNA clone:ddv4o23, 3' e... 349 e-102 2
(BJ436095) Dictyostelium discoideum cDNA clone:ddv29o21, 3' ... 349 e-102 2
(BJ428332) Dictyostelium discoideum cDNA clone:ddv11f13, 3' ... 349 e-102 2
(AU037602) Dictyostelium discoideum slug cDNA, clone SSD839. 385 e-102 1
(BJ434119) Dictyostelium discoideum cDNA clone:ddv23n24, 3' ... 341 e-101 2
(BJ429774) Dictyostelium discoideum cDNA clone:ddv4g24, 3' e... 341 e-100 2
(BJ436293) Dictyostelium discoideum cDNA clone:ddv30o17, 3' ... 339 e-99 2
(BJ436331) Dictyostelium discoideum cDNA clone:ddv30g21, 3' ... 339 e-99 2
(BJ429077) Dictyostelium discoideum cDNA clone:ddv2e07, 3' e... 339 e-99 2
(BJ428878) Dictyostelium discoideum cDNA clone:ddv1f13, 3' e... 349 e-99 2
(BJ432912) Dictyostelium discoideum cDNA clone:ddv20p05, 3' ... 337 4e-99 2
(BJ433375) Dictyostelium discoideum cDNA clone:ddv21k15, 3' ... 337 4e-99 2
(BJ429388) Dictyostelium discoideum cDNA clone:ddv3f11, 3' e... 337 4e-99 2
(BJ429483) Dictyostelium discoideum cDNA clone:ddv3l15, 3' e... 337 4e-99 2
(BJ429323) Dictyostelium discoideum cDNA clone:ddv3h03, 3' e... 337 4e-99 2
(BJ429459) Dictyostelium discoideum cDNA clone:ddv3f14, 3' e... 337 4e-99 2
(BJ435938) Dictyostelium discoideum cDNA clone:ddv29d04, 3' ... 335 1e-98 2
(BJ433173) Dictyostelium discoideum cDNA clone:ddv21b04, 3' ... 335 1e-98 2
(BJ432973) Dictyostelium discoideum cDNA clone:ddv20k11, 3' ... 335 1e-98 2
(BJ429179) Dictyostelium discoideum cDNA clone:ddv2j14, 3' e... 343 6e-98 2
(BJ344432) Dictyostelium discoideum cDNA clone:dda19d08, 3' ... 337 2e-97 2
(BJ432944) Dictyostelium discoideum cDNA clone:ddv20f09, 3' ... 339 9e-97 2
(BJ433348) Dictyostelium discoideum cDNA clone:ddv21d16, 3' ... 337 4e-96 2
(BJ429093) Dictyostelium discoideum cDNA clone:ddv2h11, 3' e... 335 1e-95 2
(BJ431847) Dictyostelium discoideum cDNA clone:ddv15d24, 3' ... 335 9e-94 2
(BJ432649) Dictyostelium discoideum cDNA clone:ddv19f09, 3' ... 355 2e-93 1
(BJ429011) Dictyostelium discoideum cDNA clone:ddv2f05, 3' e... 343 3e-93 2
(BJ344508) Dictyostelium discoideum cDNA clone:dda19g14, 3' ... 301 4e-91 3
(BJ428895) Dictyostelium discoideum cDNA clone:ddv1j15, 3' e... 301 9e-89 3
(BJ435866) Dictyostelium discoideum cDNA clone:ddv28a20, 3' ... 333 7e-87 1
(BJ434674) Dictyostelium discoideum cDNA clone:ddv24j18, 3' ... 333 7e-87 1
(BJ432549) Dictyostelium discoideum cDNA clone:ddv19c05, 3' ... 293 6e-82 2
(AU263558) Dictyostelium discoideum vegetative cDNA clone:VS... 307 4e-79 1
(BJ431915) Dictyostelium discoideum cDNA clone:ddv17d01, 3' ... 228 2e-66 2
(AU284820) Dictyostelium discoideum gamete cDNA clone:FC-BM0... 172 3e-65 6
(AU269855) Dictyostelium discoideum vegetative cDNA clone:VS... 220 7e-53 1
(AU269854) Dictyostelium discoideum vegetative cDNA clone:VS... 212 2e-50 1
(BJ436172) Dictyostelium discoideum cDNA clone:ddv30a08, 3' ... 198 3e-46 1
(AU060223) Dictyostelium discoideum slug cDNA, clone SLA608. 163 1e-35 1
(AU263559) Dictyostelium discoideum vegetative cDNA clone:VS... 161 6e-35 1
(EC761059) PSE00001404 rw_mgpallid Polysphondylium pallidum ... 143 1e-34 3
(EC762705) PSE00005222 rw_mgpallid Polysphondylium pallidum ... 143 1e-34 3
(EC762548) PSE00003313 rw_mgpallid Polysphondylium pallidum ... 143 2e-34 3
(CR382138) Debaryomyces hansenii strain CBS767 chromosome F ... 72 5e-27 3
(AL424567) T3 end of clone XAZ0AA001B09 of library XAZ0AA fr... 129 2e-25 1
(CR382125) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 82 1e-24 3
(U07366) Candida albicans translation initiation factor eIF-... 78 1e-24 3
(AR550599) Sequence 5730 from patent US 6747137. 78 1e-24 3
(DJ025878) Genome-wide DNA marker of Saccharomyces cerevisiae. 103 7e-24 2
(L36344) Saccharomyces cerevisiae tRNA-Met, tRNA-Ser, tRNA-G... 103 7e-24 2
(X56235) Yeast (S.cerevisiae) HYP1 gene for hypusine contain... 103 7e-24 2
(Z49547) S.cerevisiae chromosome X reading frame ORF YJR047c. 103 7e-24 2
(J05455) S.cerevisiae ANB1 locus encoding protein synthesis ... 103 7e-24 2
(AY557894) Saccharomyces cerevisiae clone FLH003985.01X YJR0... 103 7e-24 2
(DJ209770) Method for identification of useful proteins deri... 103 7e-24 2
(CR380958) Candida glabrata strain CBS138 chromosome L compl... 101 3e-23 2
(CR380955) Candida glabrata strain CBS138 chromosome I compl... 101 3e-23 2
(AC148613) Homo sapiens clone YRM2196, WORKING DRAFT SEQUENC... 103 4e-22 2
(M63542) S.cerevisiae initiation factor 5A (TIF51B) gene, co... 96 2e-21 2
(DB647276) Saccharomyces cerevisiae mRNA, clone: S03052-48_E... 96 2e-21 2
(DB644040) Saccharomyces cerevisiae mRNA, clone: S03052-29_O... 96 2e-21 2
(CV508502) kc72h02.y1 Xiphinema index CSEQDL01 Xiphinema ind... 72 2e-20 2
(CV580490) kd02h09.y2 Xiphinema index CSEQDL01 Xiphinema ind... 72 2e-20 2
(FG619405) PL_EST_PL506 Plectus murrayi desiccated cDNA libr... 72 2e-20 2
(BZ298792) CG4584.r1 Candida glabrata Random Genomic Library... 90 9e-20 2
(AC141230) Homo sapiens chromosome 16 clone ICI-24GH2, WORKI... 54 2e-19 3
(DJ025873) Genome-wide DNA marker of Saccharomyces cerevisiae. 54 2e-19 3
(U18779) Saccharomyces cerevisiae chromosome V cosmid 8199, ... 54 2e-19 3
(X56236) Yeast (S.cerevisiae) HYP2 gene for hypusine contain... 54 2e-19 3
(M63541) S.cerevisiae initiation factor 5A (TIF51A) gene, co... 54 2e-19 3
(AL402298) T7 end of clone AT0AA001B01 of library AT0AA from... 54 2e-19 3
(DB643623) Saccharomyces cerevisiae mRNA, clone: S03052-28_B... 54 2e-19 3
(DB652113) Saccharomyces cerevisiae mRNA, clone: S03052_A07,... 54 2e-19 3
(DB644968) Saccharomyces cerevisiae mRNA, clone: S03052-35_O... 54 2e-19 3
(DB643636) Saccharomyces cerevisiae mRNA, clone: S03052-28_C... 54 2e-19 3
(DB652122) Saccharomyces cerevisiae mRNA, clone: S03052_B12,... 54 2e-19 3
(DB647060) Saccharomyces cerevisiae mRNA, clone: S03052-46_M... 54 2e-19 3
(DB646564) Saccharomyces cerevisiae mRNA, clone: S03052-44_H... 54 2e-19 3
(DB646913) Saccharomyces cerevisiae mRNA, clone: S03052-46_C... 54 2e-19 3
(DB648403) Saccharomyces cerevisiae mRNA, clone: S03052-54_E... 54 2e-19 3
(DB644654) Saccharomyces cerevisiae mRNA, clone: S03052-34_C... 54 2e-19 3
(D83166) Saccharomyces cerevisiae mRNA for eukaryotic transl... 54 2e-19 3
(DB650799) Saccharomyces cerevisiae mRNA, clone: S03052-79_F... 54 2e-19 3
(DB637921) Saccharomyces cerevisiae mRNA, clone: S03052-03_L... 54 2e-19 3
(DB648147) Saccharomyces cerevisiae mRNA, clone: S03052-52_M... 54 2e-19 3
(DB651128) Saccharomyces cerevisiae mRNA, clone: S03052-80_O... 54 2e-19 3
(DB647081) Saccharomyces cerevisiae mRNA, clone: S03052-46_N... 54 2e-19 3
(DB648006) Saccharomyces cerevisiae mRNA, clone: S03052-52_E... 54 2e-19 3
(DB647731) Saccharomyces cerevisiae mRNA, clone: S03052-50_J... 54 2e-19 3
(DB639930) Saccharomyces cerevisiae mRNA, clone: S03052-12_C... 54 2e-19 3
(DB645189) Saccharomyces cerevisiae mRNA, clone: S03052-37_J... 54 2e-19 3
(AQ874131) V103E1 mTn-3xHA/lacZ Insertion Library, strain Y2... 54 2e-19 3
(DB655431) Saccharomyces cerevisiae mRNA, clone: Y028_A21_F.... 54 2e-19 3
(DB660653) Saccharomyces cerevisiae mRNA, clone: Y064_D16_F.... 54 2e-19 3
(DB658365) Saccharomyces cerevisiae mRNA, clone: Y046_K16_F.... 54 2e-19 3
(DB664376) Saccharomyces cerevisiae mRNA, clone: Y092_C22_F.... 54 2e-19 3
(DB643735) Saccharomyces cerevisiae mRNA, clone: S03052-28_J... 54 2e-19 3
(DB647967) Saccharomyces cerevisiae mRNA, clone: S03052-52_B... 54 2e-19 3
(DB642547) Saccharomyces cerevisiae mRNA, clone: S03052-23_E... 54 2e-19 3
(DB641145) Saccharomyces cerevisiae mRNA, clone: S03052-17_E... 54 2e-19 3
(DB647935) Saccharomyces cerevisiae mRNA, clone: S03052-51_O... 54 2e-19 3
(DB661155) Saccharomyces cerevisiae mRNA, clone: Y067_N12_F.... 54 2e-19 3
(DB655853) Saccharomyces cerevisiae mRNA, clone: Y030_N08_F.... 54 2e-19 3
(DB652949) Saccharomyces cerevisiae mRNA, clone: Y006_B13_F.... 54 2e-19 3
(DB664131) Saccharomyces cerevisiae mRNA, clone: Y090_H04_F.... 54 2e-19 3
(DB644474) Saccharomyces cerevisiae mRNA, clone: S03052-32_O... 54 2e-19 3
(DB667424) Saccharomyces cerevisiae mRNA, clone: Y110_I03_F.... 54 2e-19 3
(DB644812) Saccharomyces cerevisiae mRNA, clone: S03052-34_M... 54 2e-19 3
(DB665830) Saccharomyces cerevisiae mRNA, clone: Y101_I11_F.... 54 2e-19 3
(DB658987) Saccharomyces cerevisiae mRNA, clone: Y050_L07_F.... 54 2e-19 3
(DB654627) Saccharomyces cerevisiae mRNA, clone: Y021_G07_F.... 54 2e-19 3
(DB642670) Saccharomyces cerevisiae mRNA, clone: S03052-23_N... 54 2e-19 3
(DB638387) Saccharomyces cerevisiae mRNA, clone: S03052-05_I... 54 2e-19 3
(DB664318) Saccharomyces cerevisiae mRNA, clone: Y091_K11_F.... 54 2e-19 3
(DB653604) Saccharomyces cerevisiae mRNA, clone: Y013_I11_F.... 54 2e-19 3
(DB662121) Saccharomyces cerevisiae mRNA, clone: Y076_G08_F.... 54 2e-19 3
(DB649908) Saccharomyces cerevisiae mRNA, clone: S03052-74_I... 54 2e-19 3
(DB656100) Saccharomyces cerevisiae mRNA, clone: Y032_P06_F.... 54 2e-19 3
(DB640647) Saccharomyces cerevisiae mRNA, clone: S03052-14_N... 54 2e-19 3
(DB642047) Saccharomyces cerevisiae mRNA, clone: S03052-21_B... 54 2e-19 3
(DB640518) Saccharomyces cerevisiae mRNA, clone: S03052-14_F... 54 2e-19 3
(DB658725) Saccharomyces cerevisiae mRNA, clone: Y048_N06_F.... 54 2e-19 3
(DB644751) Saccharomyces cerevisiae mRNA, clone: S03052-34_I... 54 2e-19 3
(DB639325) Saccharomyces cerevisiae mRNA, clone: S03052-09_L... 54 2e-19 3
(DB655121) Saccharomyces cerevisiae mRNA, clone: Y025_E09_F.... 54 2e-19 3
(DB666962) Saccharomyces cerevisiae mRNA, clone: Y108_A20_F.... 54 2e-19 3
(DJ205612) Method for identification of useful proteins deri... 54 2e-19 3
(DB643838) Saccharomyces cerevisiae mRNA, clone: S03052-29_B... 54 2e-19 3
(DB641693) Saccharomyces cerevisiae mRNA, clone: S03052-19_J... 54 2e-19 3
(DB646556) Saccharomyces cerevisiae mRNA, clone: S03052-44_H... 54 2e-19 3
(DB648952) Saccharomyces cerevisiae mRNA, clone: S03052-65_N... 54 2e-19 3
(DB651292) Saccharomyces cerevisiae mRNA, clone: S03052-81_O... 54 2e-19 3
(DB637473) Saccharomyces cerevisiae mRNA, clone: S03052-01_E... 54 2e-19 3
(DB651265) Saccharomyces cerevisiae mRNA, clone: S03052-81_L... 54 2e-19 3
(DB648567) Saccharomyces cerevisiae mRNA, clone: S03052-55_J... 54 2e-19 3
(DB641010) Saccharomyces cerevisiae mRNA, clone: S03052-16_H... 54 2e-19 3
(DB639391) Saccharomyces cerevisiae mRNA, clone: S03052-10_A... 54 2e-19 3
(AQ874776) V114E5 mTn-3xHA/lacZ Insertion Library, strain Y2... 54 2e-19 3
(AQ874796) V114H9 mTn-3xHA/lacZ Insertion Library, strain Y2... 54 2e-19 3
(DJ205613) Method for identification of useful proteins deri... 54 2e-19 3
(AX001142) Sequence 3 from Patent WO9901551. 54 2e-19 3
(AR228400) Sequence 3 from patent US 6448040. 54 2e-19 3
(E03425) DNA encoding cycloheximide sensitivity factor (CHSF). 54 2e-19 3
(DB645538) Saccharomyces cerevisiae mRNA, clone: S03052-39_L... 54 2e-19 3
(DB649890) Saccharomyces cerevisiae mRNA, clone: S03052-74_H... 54 2e-19 3
(DB649344) Saccharomyces cerevisiae mRNA, clone: S03052-71_E... 54 2e-19 3
(DB665871) Saccharomyces cerevisiae mRNA, clone: Y101_M22_F.... 54 2e-19 3
(AQ492267) V118A12 mTn-3xHA/lacZ Insertion Library Saccharom... 54 8e-19 3
(AQ875692) V128D11 mTn-3xHA/lacZ Insertion Library, strain Y... 54 8e-19 3
(AQ876390) V99C1 mTn-3xHA/lacZ Insertion Library, strain Y22... 54 8e-19 3
(DB641337) Saccharomyces cerevisiae mRNA, clone: S03052-18_B... 52 3e-18 3
(DJ303289) Method for identification of useful proteins deri... 103 1e-17 1
(EE006237) ROE00002794 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(EE008891) ROE00006219 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(EE009870) ROE00005894 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(EE005826) ROE00007488 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(EE001327) ROE00010901 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(EC999145) ROE00008383 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(EC999129) ROE00008479 Rhizopus oryzae Company Rhizopus oryz... 56 1e-17 3
(DB649542) Saccharomyces cerevisiae mRNA, clone: S03052-72_H... 54 1e-17 3
(DB650305) Saccharomyces cerevisiae mRNA, clone: S03052-76_K... 52 1e-17 3
(DB645472) Saccharomyces cerevisiae mRNA, clone: S03052-39_F... 54 4e-17 3
(CR428722) Xenopus tropicalis EST, clone TTbA068l22 3'. 68 8e-17 2
(CR423558) Xenopus tropicalis EST, clone TTbA067l13 5'. 68 8e-17 2
(CR411863) Xenopus tropicalis EST, clone TTbA063e19 5'. 68 8e-17 2
(DJ133306) Method for identification of useful proteins deri... 80 8e-17 2
(DJ130062) Method for identification of useful proteins deri... 80 8e-17 2
(DJ209771) Method for identification of useful proteins deri... 80 8e-17 2
(BC074676) Xenopus tropicalis MGC69396 protein, mRNA (cDNA c... 66 3e-16 2
(CR760910) Xenopus tropicalis finished cDNA, clone TEgg033f08. 66 3e-16 2
(CF378186) AGENCOURT_15350476 NICHD_XGC_Swb1N Xenopus (Silur... 66 3e-16 2
(CF223323) AGENCOURT_15064779 NICHD_XGC_Emb7 Xenopus (Silura... 66 3e-16 2
(CF224253) AGENCOURT_15064638 NICHD_XGC_Emb7 Xenopus (Silura... 66 3e-16 2
(CF224741) AGENCOURT_15064562 NICHD_XGC_Emb7 Xenopus (Silura... 66 3e-16 2
(BX707658) Xenopus tropicalis EST, clone TTpA008l02 5'. 66 3e-16 2
(BX705020) Xenopus tropicalis EST, clone TTpA003j22 5'. 66 3e-16 2
(BX703865) Xenopus tropicalis EST, clone TTpA012i03 5'. 66 3e-16 2
(CR430212) Xenopus tropicalis EST, clone TTbA077c04 3'. 66 3e-16 2
(CR429960) Xenopus tropicalis EST, clone TTbA020b16 5'. 66 3e-16 2
(CF223243) AGENCOURT_15069296 NICHD_XGC_Emb7 Xenopus (Silura... 66 3e-16 2
(CX740614) JGI_XZF1894.rev NIH_XGC_tropGas5 Xenopus (Siluran... 66 3e-16 2
(BX742744) Xenopus tropicalis EST, clone TTpA026h15 5'. 66 3e-16 2
(DN092100) JGI_CABE4610.fwd NIH_XGC_tropOva1 Xenopus (Silura... 66 3e-16 2
(BX739873) Xenopus tropicalis EST, clone TTpA043d20 5'. 66 3e-16 2
(BX706799) Xenopus tropicalis EST, clone TTpA009e18 5'. 66 3e-16 2
(CR440951) Xenopus tropicalis EST, clone TTbA042p12 5'. 66 3e-16 2
(CR438267) Xenopus tropicalis EST, clone TTbA042p11 5'. 66 3e-16 2
(CR581553) Xenopus tropicalis EST, clone THdA029c20 5'. 66 3e-16 2
(CR583766) Xenopus tropicalis EST, clone THdA041m01 5'. 66 3e-16 2
(CR426298) Xenopus tropicalis EST, clone TTbA052g16 5'. 66 3e-16 2
(CR422221) Xenopus tropicalis EST, clone TTbA019b16 5'. 66 3e-16 2
(BX700284) Xenopus tropicalis EST, clone TNeu110l06 3'. 66 3e-16 2
(BX722401) Xenopus tropicalis EST, clone TTpA069m07 5'. 66 3e-16 2
(CR583578) Xenopus tropicalis EST, clone THdA044a16 5'. 66 3e-16 2
(BX743848) Xenopus tropicalis EST, clone TTpA028j18 5'. 66 3e-16 2
(BX749404) Xenopus tropicalis EST, clone TGas091o23 3'. 66 3e-16 2
(BX710189) Xenopus tropicalis EST, clone TTpA007m10 5'. 66 3e-16 2
(CR578335) Xenopus tropicalis EST, clone THdA050c23 5'. 66 3e-16 2
(CR432981) Xenopus tropicalis EST, clone TTbA079m17 5'. 66 3e-16 2
(CR429337) Xenopus tropicalis EST, clone TTbA068c21 5'. 66 3e-16 2
(BX743823) Xenopus tropicalis EST, clone TTpA028h12 5'. 66 3e-16 2
(CX383674) JGI_XZT63704.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(CR572911) Xenopus tropicalis EST, clone THdA021f06 5'. 66 3e-16 2
(CR417708) Xenopus tropicalis EST, clone TTbA021f11 5'. 66 3e-16 2
(BX726974) Xenopus tropicalis EST, clone TTpA064n04 5'. 66 3e-16 2
(CF239657) AGENCOURT_15098088 NICHD_XGC_Emb6 Xenopus (Silura... 66 3e-16 2
(CR424509) Xenopus tropicalis EST, clone TTbA016i01 5'. 66 3e-16 2
(BX764741) Xenopus tropicalis EST, clone TGas141d02 3'. 66 3e-16 2
(BX740106) Xenopus tropicalis EST, clone TTpA034h08 5'. 66 3e-16 2
(BX718403) Xenopus tropicalis EST, clone TTpA027j11 3'. 66 3e-16 2
(CX469685) JGI_XZG3941.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 66 3e-16 2
(CR421062) Xenopus tropicalis EST, clone TTbA017c06 5'. 66 3e-16 2
(CR560890) Xenopus tropicalis EST, clone THdA001o05 5'. 66 3e-16 2
(CF589748) AGENCOURT_15681174 NICHD_XGC_Swb1N Xenopus (Silur... 66 3e-16 2
(CR430008) Xenopus tropicalis EST, clone TTbA020j04 5'. 66 3e-16 2
(BX734532) Xenopus tropicalis EST, clone TTpA058a06 5'. 66 3e-16 2
(BX712178) Xenopus tropicalis EST, clone TTpA020a08 5'. 66 3e-16 2
(CF239151) AGENCOURT_15100443 NICHD_XGC_Emb6 Xenopus (Silura... 66 3e-16 2
(CR579814) Xenopus tropicalis EST, clone THdA030l22 5'. 66 3e-16 2
(CR579153) Xenopus tropicalis EST, clone THdA042g01 5'. 66 3e-16 2
(DT450701) JGI_CABK9166.rev NIH_XGC_tropSpl1 Xenopus (Silura... 66 3e-16 2
(DT443808) JGI_CABK5033.rev NIH_XGC_tropSpl1 Xenopus (Silura... 66 3e-16 2
(CR587618) Xenopus tropicalis EST, clone THdA053i14 5'. 66 3e-16 2
(DR850607) JGI_CABE13095.fwd NIH_XGC_tropOva1 Xenopus (Silur... 66 3e-16 2
(DN073923) JGI_CABD8013.fwd NIH_XGC_tropLun1 Xenopus (Silura... 66 3e-16 2
(BX745504) Xenopus tropicalis EST, clone TTpA046o22 5'. 66 3e-16 2
(CR422338) Xenopus tropicalis EST, clone TTbA053o16 5'. 66 3e-16 2
(CX389594) JGI_XZT37691.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(CR412420) Xenopus tropicalis EST, clone TTbA012j02 5'. 66 3e-16 2
(BX741524) Xenopus tropicalis EST, clone TTpA042d07 5'. 66 3e-16 2
(CR442368) Xenopus tropicalis EST, clone TTbA057a16 5'. 66 3e-16 2
(CF591129) AGENCOURT_15681253 NICHD_XGC_Swb1N Xenopus (Silur... 66 3e-16 2
(CX315541) JGI_XZT65716.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(DN016201) JGI_CAAQ12492.fwd NIH_XGC_tropHrt1 Xenopus (Silur... 66 3e-16 2
(CX398431) JGI_XZT57822.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(BX715544) Xenopus tropicalis EST, clone TTpA040a22 5'. 66 3e-16 2
(CR440506) Xenopus tropicalis EST, clone TTbA078l18 5'. 66 3e-16 2
(DN076386) JGI_CABD9745.fwd NIH_XGC_tropLun1 Xenopus (Silura... 66 3e-16 2
(CR407857) Xenopus tropicalis EST, clone TTbA001d01 5'. 66 3e-16 2
(BX716260) Xenopus tropicalis EST, clone TTpA068h06 5'. 66 3e-16 2
(DT428916) JGI_CABJ7713.fwd NIH_XGC_tropSki1 Xenopus (Silura... 66 3e-16 2
(BX736127) Xenopus tropicalis EST, clone TTpA078o12 5'. 66 3e-16 2
(CX400670) JGI_XZT4591.fwd NIH_XGC_tropTad5 Xenopus (Siluran... 66 3e-16 2
(CR588373) Xenopus tropicalis EST, clone THdA037e17 5'. 66 3e-16 2
(CR440520) Xenopus tropicalis EST, clone TTbA078n18 5'. 66 3e-16 2
(CR439249) Xenopus tropicalis EST, clone TTbA039a22 5'. 66 3e-16 2
(BX735529) Xenopus tropicalis EST, clone TTpA067l19 5'. 66 3e-16 2
(BX716264) Xenopus tropicalis EST, clone TTpA068h10 5'. 66 3e-16 2
(DR846741) JGI_CABE11068.fwd NIH_XGC_tropOva1 Xenopus (Silur... 66 3e-16 2
(BX733956) Xenopus tropicalis EST, clone TTpA073m01 5'. 66 3e-16 2
(CR448699) Xenopus tropicalis EST, clone TTbA009p07 5'. 66 3e-16 2
(BX742696) Xenopus tropicalis EST, clone TTpA026d01 5'. 66 3e-16 2
(BX709859) Xenopus tropicalis EST, clone TTpA024i17 5'. 66 3e-16 2
(CR587857) Xenopus tropicalis EST, clone THdA049b02 5'. 66 3e-16 2
(BX717558) Xenopus tropicalis EST, clone TTpA036a14 5'. 66 3e-16 2
(CX439497) JGI_XZG7242.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 66 3e-16 2
(DN022634) JGI_CAAR3698.fwd NIH_XGC_tropLiv1 Xenopus (Silura... 66 3e-16 2
(CF591085) AGENCOURT_15703450 NICHD_XGC_Swb1N Xenopus (Silur... 66 3e-16 2
(CR444565) Xenopus tropicalis EST, clone TTbA040b17 5'. 66 3e-16 2
(DN075505) JGI_CABD8880.fwd NIH_XGC_tropLun1 Xenopus (Silura... 66 3e-16 2
(CF217405) AGENCOURT_14972142 NICHD_XGC_Emb5 Xenopus (Silura... 66 3e-16 2
(DT448485) JGI_CABK7969.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 66 3e-16 2
(DR846723) JGI_CABE11059.fwd NIH_XGC_tropOva1 Xenopus (Silur... 66 3e-16 2
(CX334538) JGI_XZT70024.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(BX740189) Xenopus tropicalis EST, clone TTpA034p20 5'. 66 3e-16 2
(BX710267) Xenopus tropicalis EST, clone TTpA009f24 5'. 66 3e-16 2
(CR440454) Xenopus tropicalis EST, clone TTbA078d14 3'. 66 3e-16 2
(BX738993) Xenopus tropicalis EST, clone TTpA066b14 5'. 66 3e-16 2
(CR409452) Xenopus tropicalis EST, clone TTbA002i09 5'. 66 3e-16 2
(DR882819) JGI_CABK1412.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 66 3e-16 2
(DN068353) JGI_CABD4779.fwd NIH_XGC_tropLun1 Xenopus (Silura... 66 3e-16 2
(CX932394) JGI_CAAO2303.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 66 3e-16 2
(CX470377) JGI_XZG4345.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 66 3e-16 2
(CX320145) JGI_XZT11993.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(CR415295) Xenopus tropicalis EST, clone TTbA010i08 5'. 66 3e-16 2
(BX721559) Xenopus tropicalis EST, clone TTpA068h09 5'. 66 3e-16 2
(DT396544) JGI_CABH11565.fwd NIH_XGC_tropSkeMus1 Xenopus (Si... 66 3e-16 2
(CR574232) Xenopus tropicalis EST, clone THdA040b05 5'. 66 3e-16 2
(CR422283) Xenopus tropicalis EST, clone TTbA019j04 5'. 66 3e-16 2
(DT402949) JGI_CABI5906.fwd NIH_XGC_tropOvi1 Xenopus (Silura... 66 3e-16 2
(DT451860) JGI_CABK9802.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 66 3e-16 2
(DT427192) JGI_CABJ6774.fwd NIH_XGC_tropSki1 Xenopus (Silura... 66 3e-16 2
(CF592231) AGENCOURT_15663372 NICHD_XGC_Swb1N Xenopus (Silur... 66 3e-16 2
(BX711721) Xenopus tropicalis EST, clone TTpA016i23 5'. 66 3e-16 2
(CR439363) Xenopus tropicalis EST, clone TTbA079a16 5'. 66 3e-16 2
(BX731830) Xenopus tropicalis EST, clone TTpA061o21 5'. 66 3e-16 2
(BX716317) Xenopus tropicalis EST, clone TTpA068n10 5'. 66 3e-16 2
(CX902882) JGI_CAAM13971.fwd NIH_XGC_tropTe3 Xenopus (Silura... 66 3e-16 2
(BX721519) Xenopus tropicalis EST, clone TTpA068d01 5'. 66 3e-16 2
(CF590235) AGENCOURT_15670212 NICHD_XGC_Swb1N Xenopus (Silur... 66 3e-16 2
(CX968729) JGI_CAAP3130.fwd NIH_XGC_tropInt1 Xenopus (Silura... 66 3e-16 2
(CX912042) JGI_CAAN3241.fwd NIH_XGC_tropTe4 Xenopus (Siluran... 66 3e-16 2
(CX843554) JGI_CAAK11133.fwd NIH_XGC_tropBrn3 Xenopus (Silur... 66 3e-16 2
(BX734301) Xenopus tropicalis EST, clone TTpA058i03 5'. 66 3e-16 2
(DT446145) JGI_CABK6317.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 66 3e-16 2
(CX925628) JGI_CAAN10546.fwd NIH_XGC_tropTe4 Xenopus (Silura... 66 3e-16 2
(CX333428) JGI_XZT69185.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(CR445843) Xenopus tropicalis EST, clone TTbA040k14 5'. 66 3e-16 2
(CR415208) Xenopus tropicalis EST, clone TTbA005p17 5'. 66 3e-16 2
(CR411603) Xenopus tropicalis EST, clone TTbA006m01 5'. 66 3e-16 2
(DR851353) JGI_CABE13485.fwd NIH_XGC_tropOva1 Xenopus (Silur... 66 3e-16 2
(CX475559) JGI_XZG50026.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX502347) JGI_XZG40165.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX490323) JGI_XZG33182.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX481947) JGI_XZG50647.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX413987) JGI_XZT5099.fwd NIH_XGC_tropTad5 Xenopus (Siluran... 66 3e-16 2
(BX705885) Xenopus tropicalis EST, clone TTpA004f08 5'. 66 3e-16 2
(CX493147) JGI_XZG39193.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX327645) JGI_XZT67029.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(CR569975) Xenopus tropicalis EST, clone THdA035p06 5'. 66 3e-16 2
(BX763472) Xenopus tropicalis EST, clone TGas088j05 3'. 66 3e-16 2
(CR441642) Xenopus tropicalis EST, clone TTbA070l23 5'. 66 3e-16 2
(EL799314) CBSW4620.b1 NICHD_XGC_tropTail_m Xenopus (Siluran... 66 3e-16 2
(EL717782) CBSS2038.fwd NICHD_XGC_tropSp1 Xenopus (Silurana)... 66 3e-16 2
(CX516050) JGI_XZG45565.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX474325) JGI_XZG49301.fwd NIH_XGC_tropGas7 Xenopus (Silura... 66 3e-16 2
(CX345525) JGI_XZT24304.fwd NIH_XGC_tropTad5 Xenopus (Silura... 66 3e-16 2
(CR441851) Xenopus tropicalis EST, clone TTbA023g06 3'. 66 3e-16 2

>(BJ444992) Dictyostelium discoideum cDNA clone:ddv58h06, 3' end,
single read.
Length = 719

Score = 1425 bits (719), Expect = 0.0
Identities = 719/719 (100%)
Strand = Plus / Minus


Query: 1 ggttacaaagcacttggtaaagctacttctgaaattttaggttcattaactccagttgca 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 719 ggttacaaagcacttggtaaagctacttctgaaattttaggttcattaactccagttgca 660


Query: 61 acttgtggtactcttcctttggttcgtgatctccaagatagtggtttcgatattcaaatt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 659 acttgtggtactcttcctttggttcgtgatctccaagatagtggtttcgatattcaaatt 600


Query: 121 actggttttggtaaagaagaaacttatcatgctgataatgaatatgctttattatctgat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 599 actggttttggtaaagaagaaacttatcatgctgataatgaatatgctttattatctgat 540


Query: 181 tttaaaaatgctattaaaattttatctaatttttatagcagaatttaacaacaacaaaat 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 539 tttaaaaatgctattaaaattttatctaatttttatagcagaatttaacaacaacaaaat 480


Query: 241 gtcagataacgaagctttagatgtcgaagactacgcccaagccggttcaggtgcttcatt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 479 gtcagataacgaagctttagatgtcgaagactacgcccaagccggttcaggtgcttcatt 420


Query: 301 aaccttcccaattcaatgttcagcattaagaaagaacggtttcgtcgtcattaaaggttt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 419 aaccttcccaattcaatgttcagcattaagaaagaacggtttcgtcgtcattaaaggttt 360


Query: 361 cccatgtaagattgttgatatgtcaacttccaaaaccggtaaacacggtcacgccaaagt 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 359 cccatgtaagattgttgatatgtcaacttccaaaaccggtaaacacggtcacgccaaagt 300


Query: 421 taacatcactgctatcgatatcttcactggtaagaaatacgaagaaatttgcccatcaac 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 299 taacatcactgctatcgatatcttcactggtaagaaatacgaagaaatttgcccatcaac 240


Query: 481 tcacaacattgatgtaccaaatgtcagcagaaaggaatacaccgttatggatgttcaaga 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 239 tcacaacattgatgtaccaaatgtcagcagaaaggaatacaccgttatggatgttcaaga 180


Query: 541 tggttacttatcactcttggatgctggtggtgaagtcaaagaagatcttgccctcccaga 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 179 tggttacttatcactcttggatgctggtggtgaagtcaaagaagatcttgccctcccaga 120


Query: 601 agatgatattggtaaagaaattacccaaatgttaaaagaaggtaaagagccattagtttc 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 119 agatgatattggtaaagaaattacccaaatgttaaaagaaggtaaagagccattagtttc 60


Query: 661 agtcatctctgctttaggtaaagaaggtgtcgtctctgttaaagtcagcaacaattaaa 719
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 59 agtcatctctgctttaggtaaagaaggtgtcgtctctgttaaagtcagcaacaattaaa 1

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 997,549,287
Number of extensions: 66123257
Number of successful extensions: 5548345
Number of sequences better than 10.0: 7230
Length of query: 900
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 876
Effective length of database: 96,409,374,237
Effective search space: 84454611831612
Effective search space used: 84454611831612
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.16
Homology vs Protein
Query= Contig-U15497-1 (Contig-U15497-1Q) /CSM_Contig/Contig-U15497-1Q.Seq.d
(900 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(P10160) RecName: Full=Eukaryotic translation initiation factor ... 199 8e-50
AL596185_11(AL596185|pid:none) Mouse DNA sequence from clone RP2... 198 2e-49
(P63241) RecName: Full=Eukaryotic translation initiation factor ... 198 2e-49
AY129319_1(AY129319|pid:none) Homo sapiens eukaryotic initiation... 198 2e-49
BC070048_1(BC070048|pid:none) Homo sapiens eukaryotic translatio... 196 7e-49
(Q6IS14) RecName: Full=Eukaryotic translation initiation factor ... 196 7e-49
S72024_1(S72024|pid:none) eif-5A=eukaryotic initiation factor 5A... 196 9e-49
BT075853_1(BT075853|pid:none) Caligus rogercresseyi clone crog-e... 194 4e-48
BT082977_1(BT082977|pid:none) Anoplopoma fimbria clone afim-evh-... 194 4e-48
(Q07460) RecName: Full=Eukaryotic translation initiation factor ... 193 6e-48
(Q5R898) RecName: Full=Eukaryotic translation initiation factor ... 191 2e-47
AY892983_1(AY892983|pid:none) Synthetic construct Homo sapiens c... 191 2e-47
EU916931_1(EU916931|pid:none) Ctenopharyngodon idella eukaryotic... 191 2e-47
BC074676_1(BC074676|pid:none) Xenopus tropicalis MGC69396 protei... 189 8e-47
BT080215_1(BT080215|pid:none) Caligus clemensi clone ccle-evs-50... 187 3e-46
(O94083) RecName: Full=Eukaryotic translation initiation factor ... 187 4e-46
FM992693_140(FM992693|pid:none) Candida dubliniensis CD36 chromo... 187 4e-46
BT056332_1(BT056332|pid:none) Salmo salar clone ssal-evf-508-370... 186 7e-46
(Q9UST4) RecName: Full=Eukaryotic translation initiation factor ... 186 9e-46
BT079804_1(BT079804|pid:none) Esox lucius clone eluc-evq-516-152... 186 1e-45
BT081675_1(BT081675|pid:none) Rana catesbeiana clone rcat-evr-51... 185 2e-45
CR382138_545(CR382138|pid:none) Debaryomyces hansenii strain CBS... 184 3e-45
(P56289) RecName: Full=Eukaryotic translation initiation factor ... 184 3e-45
(Q09121) RecName: Full=Eukaryotic translation initiation factor ... 183 8e-45
CP000499_134(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 182 1e-44
AY572977_1(AY572977|pid:none) Branchiostoma belcheri eukaryotic ... 182 2e-44
AE016819_589(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 181 4e-44
(P23301) RecName: Full=Eukaryotic translation initiation factor ... 180 5e-44
CR382129_260(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 180 7e-44
(P62924) RecName: Full=Eukaryotic translation initiation factor ... 179 9e-44
DQ104412_1(DQ104412|pid:none) Bombyx mori eukaryotic initiation ... 179 1e-43
BC152188_1(BC152188|pid:none) Danio rerio eukaryotic translation... 179 1e-43
CR392026_4(CR392026|pid:none) Zebrafish DNA sequence from clone ... 178 3e-43
CR380955_56(CR380955|pid:none) Candida glabrata strain CBS138 ch... 177 3e-43
DQ066276_1(DQ066276|pid:none) Ixodes scapularis isolate is-all-c... 176 7e-43
EF633867_1(EF633867|pid:none) Ornithodoros parkeri clone OP-157 ... 176 7e-43
CU638743_277(CU638743|pid:none) Podospora anserina genomic DNA c... 176 7e-43
AP007155_812(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 176 1e-42
EF638993_1(EF638993|pid:none) Triatoma infestans clone TI-353 tr... 175 2e-42
EF070507_1(EF070507|pid:none) Maconellicoccus hirsutus clone WHM... 175 2e-42
AK340152_1(AK340152|pid:none) Acyrthosiphon pisum ACYPI002632 mR... 175 2e-42
EU979495_1(EU979495|pid:none) Ornithoctonus huwena clone HWEc215... 174 4e-42
EF660911_1(EF660911|pid:none) Artemia franciscana clone 20AF386.... 172 1e-41
BT073565_1(BT073565|pid:none) Oncorhynchus mykiss clone omyk-evn... 171 2e-41
(P38672) RecName: Full=Eukaryotic translation initiation factor ... 170 5e-41
(P34563) RecName: Full=Eukaryotic translation initiation factor ... 168 2e-40
S55278(S55278) translation initiation factor eIF-5A [similarity]... 168 3e-40
AY232071_1(AY232071|pid:none) Drosophila yakuba clone yak-ad_eIF... 167 3e-40
(Q20751) RecName: Full=Eukaryotic translation initiation factor ... 167 6e-40
AY231769_1(AY231769|pid:none) Drosophila yakuba clone yak-em_eIF... 166 8e-40
AJ496759_1(AJ496759|pid:none) Toxoplasma gondii mRNA for putativ... 162 1e-38
AE014188_42(AE014188|pid:none) Plasmodium falciparum 3D7 chromos... 161 2e-38
CR940347_340(CR940347|pid:none) Theileria annulata strain Ankara... 161 2e-38
CP001574_138(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 159 1e-37
(P56335) RecName: Full=Eukaryotic translation initiation factor ... 157 5e-37
(P24922) RecName: Full=Eukaryotic translation initiation factor ... 157 6e-37
(P56336) RecName: Full=Eukaryotic translation initiation factor ... 156 8e-37
DQ200358_1(DQ200358|pid:none) Solanum tuberosum clone 053D09 euk... 155 2e-36
AY484391_1(AY484391|pid:none) Capsicum annuum mary storys protei... 155 2e-36
AY961931_1(AY961931|pid:none) Picea abies eukaryotic translation... 154 3e-36
(P80639) RecName: Full=Eukaryotic translation initiation factor ... 154 4e-36
BT053229_1(BT053229|pid:none) Medicago truncatula clone MTYFP_FQ... 154 5e-36
DQ407749_1(DQ407749|pid:none) Gymnadenia conopsea eukaryotic tra... 153 7e-36
DQ167203_1(DQ167203|pid:none) Triticum aestivum eukaryotic trans... 153 9e-36
AM411618_1(AM411618|pid:none) Phalaenopsis hybrid cultivar mRNA ... 153 9e-36
DQ234392_1(DQ234392|pid:none) Thinopyrum intermedium translation... 153 9e-36
(P56333) RecName: Full=Eukaryotic translation initiation factor ... 153 9e-36
EU284874_1(EU284874|pid:none) TSA: Elaeis guineensis EgEfMPOB000... 152 1e-35
DQ167201_1(DQ167201|pid:none) Triticum aestivum eukaryotic trans... 152 1e-35
EU284833_1(EU284833|pid:none) TSA: Elaeis guineensis EgEfMPOB000... 152 1e-35
DQ345329_1(DQ345329|pid:none) Rosa chinensis eukaryotic translat... 152 1e-35
AM477000_1(AM477000|pid:none) Vitis vinifera contig VV78X073073.... 152 2e-35
AK058206_1(AK058206|pid:none) Oryza sativa Japonica Group cDNA c... 152 2e-35
BT035129_1(BT035129|pid:none) Zea mays full-length cDNA clone ZM... 152 2e-35
DQ167202_1(DQ167202|pid:none) Triticum aestivum eukaryotic trans... 152 2e-35
DQ234394_1(DQ234394|pid:none) Secale sylvestre translation initi... 151 3e-35
EF512315_1(EF512315|pid:none) Carica papaya clone Cp12-1 transla... 151 3e-35
AY961928_1(AY961928|pid:none) Picea abies eukaryotic translation... 150 4e-35
(P56337) RecName: Full=Eukaryotic translation initiation factor ... 150 4e-35
FJ800963_1(FJ800963|pid:none) Musa hybrid cultivar eukaryotic in... 150 6e-35
(Q9AXJ4) RecName: Full=Eukaryotic translation initiation factor ... 150 6e-35
EF145377_1(EF145377|pid:none) Populus trichocarpa clone WS01123_... 150 7e-35
BT070628_1(BT070628|pid:none) Picea sitchensis clone WS02740_C10... 150 7e-35
(P26564) RecName: Full=Eukaryotic translation initiation factor ... 150 7e-35
AY587771_1(AY587771|pid:none) Tamarix androssowii translation in... 149 1e-34
(Q9C505) RecName: Full=Eukaryotic translation initiation factor ... 149 1e-34
AF372933_1(AF372933|pid:none) Arabidopsis thaliana At1g69410/F10... 149 1e-34
S21058(S21058) translation initiation factor eIF-5A.1 [similarit... 149 2e-34
BT051535_1(BT051535|pid:none) Medicago truncatula clone MTYF1_F2... 148 2e-34
AF516357_1(AF516357|pid:none) Hevea brasiliensis eukaryotic tran... 148 2e-34
AF516356_1(AF516356|pid:none) Hevea brasiliensis eukaryotic tran... 148 3e-34
AF516350_1(AF516350|pid:none) Hevea brasiliensis eukaryotic tran... 147 4e-34
CS644578_1(CS644578|pid:none) Sequence 180 from Patent WO2006060... 147 5e-34
AY223436_1(AY223436|pid:none) Schistosoma japonicum clone ZZZ427... 147 5e-34
FN316218_1(FN316218|pid:none) Schistosoma japonicum isolate Anhu... 147 6e-34
EF145531_1(EF145531|pid:none) Populus trichocarpa clone WS01125_... 147 6e-34
(Q9SC12) RecName: Full=Eukaryotic translation initiation factor ... 147 6e-34
FN357387_18(FN357387|pid:none) Schistosoma mansoni genome sequen... 146 8e-34
AY961932_1(AY961932|pid:none) Picea abies eukaryotic translation... 146 8e-34
AC006535_1(AC006535|pid:none) Genomic sequence for Arabidopsis t... 144 4e-33
AM502243_76(AM502243|pid:none) Leishmania infantum chromosome 25. 142 2e-32
AM494962_58(AM494962|pid:none) Leishmania braziliensis chromosom... 140 4e-32
A90085(A90085) translation initiation factor eIF-5A.2 [imported]... 140 4e-32
AJ278539_1(AJ278539|pid:none) Leishmania infantum mRNA for eukar... 140 8e-32
CT005264_74(CT005264|pid:none) Leishmania major strain Friedlin,... 140 8e-32
(P54638) RecName: Full=Acetylornithine deacetylase; EC=... 140 8e-32
CQ871934_1(CQ871934|pid:none) Sequence 11 from Patent WO20040789... 138 3e-31
U23957_1(U23957|pid:none) Dictyostelium discoideum P52D mRNA, co... 137 5e-31
DQ864863_1(DQ864863|pid:none) Pfiesteria piscicida clone ppi-5p-... 136 8e-31
CP000881_41(CP000881|pid:none) Hemiselmis andersenii chromosome ... 136 1e-30
DQ279894_1(DQ279894|pid:none) Lophopyrum elongatum translation i... 127 7e-28
DQ279897_1(DQ279897|pid:none) Secale cereale translation initiat... 125 2e-27
BT062403_1(BT062403|pid:none) Zea mays full-length cDNA clone ZM... 125 3e-27
DQ279895_1(DQ279895|pid:none) Eremopyrum bonaepartis translation... 124 3e-27
DQ279899_1(DQ279899|pid:none) Crithopsis delileana translation i... 124 6e-27
EU966091_1(EU966091|pid:none) Zea mays clone 291629 unknown mRNA. 114 6e-24
CS644580_1(CS644580|pid:none) Sequence 182 from Patent WO2006060... 102 2e-20
EU971797_1(EU971797|pid:none) Zea mays clone 370764 unknown mRNA. 99 2e-19
AC137819_14(AC137819|pid:none) Medicago truncatula clone mth2-21... 97 7e-19
AP007175_345(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 94 8e-18
EU962777_1(EU962777|pid:none) Zea mays clone 245461 unknown mRNA. 91 5e-17
AF379605_1(AF379605|pid:none) Mus musculus eukaryotic translatio... 90 1e-16
AB036420_1(AB036420|pid:none) Citrullus lanatus mRNA for DIP-1, ... 86 1e-15
EU968011_1(EU968011|pid:none) Zea mays clone 312824 unknown mRNA. 86 2e-15
AF385409_1(AF385409|pid:none) Rattus norvegicus eukaryotic trans... 85 3e-15
CP001330_365(CP001330|pid:none) Micromonas sp. RCC299 chromosome... 80 7e-14
AK101568_1(AK101568|pid:none) Oryza sativa Japonica Group cDNA c... 80 1e-13
AF360346_1(AF360346|pid:none) Arabidopsis thaliana putative N-ac... 79 2e-13
AL021889_1(AL021889|pid:none) Arabidopsis thaliana DNA chromosom... 79 2e-13
(A6UVH4) RecName: Full=Translation initiation factor 5A; AltName... 79 3e-13
AF170086_1(AF170086|pid:none) Cucurbita pepo silverleaf whitefly... 79 3e-13
FJ899849_1(FJ899849|pid:none) Populus maximowiczii x Populus nig... 77 1e-12
FJ899850_1(FJ899850|pid:none) Populus maximowiczii x Populus nig... 75 3e-12
(O29612) RecName: Full=Translation initiation factor 5A; AltName... 73 1e-11
(A7I807) RecName: Full=Translation initiation factor 5A; AltName... 73 1e-11
(B1L7A5) RecName: Full=Translation initiation factor 5A; AltName... 72 2e-11
CP001325_366(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 72 2e-11
(Q6LYN8) RecName: Full=Translation initiation factor 5A; AltName... 72 3e-11
(Q9HJB1) RecName: Full=Translation initiation factor 5A; AltName... 72 3e-11
(Q0W941) RecName: Full=Translation initiation factor 5A; AltName... 71 6e-11
CP000582_97(CP000582|pid:none) Ostreococcus lucimarinus CCE9901 ... 71 6e-11
(A8ABK3) RecName: Full=Translation initiation factor 5A; AltName... 70 1e-10
C64453(C64453)translation initiation factor aIF-5A MJ1228 [valid... 69 2e-10
(A4FXY5) RecName: Full=Translation initiation factor 5A; AltName... 69 2e-10
AF516358_1(AF516358|pid:none) Hevea brasiliensis eukaryotic tran... 69 2e-10
(Q58625) RecName: Full=Translation initiation factor 5A; AltName... 69 2e-10
CP000113_250(CP000113|pid:none) Myxococcus xanthus DK 1622, comp... 69 2e-10
S22380(S22380) translation initiation factor aIF-5A [similarity]... 69 3e-10
(Q971T0) RecName: Full=Translation initiation factor 5A; AltName... 69 3e-10
(Q6L150) RecName: Full=Translation initiation factor 5A; AltName... 68 4e-10
CP001398_1036(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 68 4e-10
(A9AAZ2) RecName: Full=Translation initiation factor 5A; AltName... 67 6e-10
(Q8PYE0) RecName: Full=Translation initiation factor 5A; AltName... 67 6e-10
(Q8U1E4) RecName: Full=Translation initiation factor 5A; AltName... 67 6e-10
(Q5JI42) RecName: Full=Translation initiation factor 5A; AltName... 67 6e-10
(Q9YA53) RecName: Full=Translation initiation factor 5A; AltName... 67 1e-09
H72513(H72513)translation initiation factor aIF-5a APE2085 [simi... 67 1e-09
(Q46EL9) RecName: Full=Translation initiation factor 5A; AltName... 66 1e-09
(A3CU49) RecName: Full=Translation initiation factor 5A; AltName... 66 1e-09
CP001140_820(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 66 1e-09
(A6VFP3) RecName: Full=Translation initiation factor 5A; AltName... 66 1e-09
(O26955) RecName: Full=Translation initiation factor 5A; AltName... 65 2e-09
(A1RS27) RecName: Full=Translation initiation factor 5A; AltName... 65 2e-09
(A0B9S8) RecName: Full=Translation initiation factor 5A; AltName... 64 5e-09
(A6UNS4) RecName: Full=Translation initiation factor 5A; AltName... 64 7e-09
CP001399_1194(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 64 7e-09
(P56635) RecName: Full=Translation initiation factor 5A; AltName... 64 9e-09
AE009441_2358(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 64 9e-09
(Q97ZE8) RecName: Full=Translation initiation factor 5A; AltName... 63 2e-08
(Q12UU7) RecName: Full=Translation initiation factor 5A; AltName... 63 2e-08
(A4WLN5) RecName: Full=Translation initiation factor 5A; AltName... 62 2e-08
(Q2NEM4) RecName: Full=Translation initiation factor 5A; AltName... 62 3e-08
CP001400_1116(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 61 4e-08
(Q3IN38) RecName: Full=Translation initiation factor 5A; AltName... 59 2e-07
CP000866_525(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 59 3e-07
(Q5V103) RecName: Full=Translation initiation factor 5A; AltName... 57 8e-07
CP000559_424(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 57 1e-06
(P87252) RecName: Full=Woronin body major protein; Flags: Precur... 57 1e-06
AP007169_386(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 55 4e-06
CU633899_286(CU633899|pid:none) Podospora anserina genomic DNA c... 52 2e-05
(Q18F19) RecName: Full=Translation initiation factor 5A; AltName... 52 4e-05
AF170544_1(AF170544|pid:none) Magnaporthe grisea vacuolar-ATPase... 51 5e-05
AB180240_1(AB180240|pid:none) Aspergillus oryzae Aohex1 gene for... 51 6e-05
CP001365_1558(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 51 6e-05
(Q74N24) RecName: Full=Translation initiation factor 5A; AltName... 50 1e-04
AM444003_1(AM444003|pid:none) Vitis vinifera contig VV78X018564.... 50 1e-04
AE017199_385(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 50 1e-04
(Q9P8K9) RecName: Full=Woronin body major protein; &AF239659_1(... 48 5e-04
(B0R6B4) RecName: Full=Translation initiation factor 5A; AltName... 47 7e-04
(Q6MKB4) RecName: Full=Elongation factor P; Short=EF-P;... 43 0.013
AF377869_1(AF377869|pid:none) Mus musculus eukaryotic initiation... 40 0.082
(Q98Q08) RecName: Full=DNA-directed RNA polymerase subunit alpha... 40 0.14
CP000875_1651(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 39 0.18
CP000776_123(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 39 0.24
(Q0ALG8) RecName: Full=Elongation factor P; Short=EF-P;... 37 1.2
CP001358_1188(CP001358|pid:none) Desulfovibrio desulfuricans sub... 36 1.5
CR940347_357(CR940347|pid:none) Theileria annulata strain Ankara... 36 1.5
CR543861_2334(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 35 2.6
(A6VTQ2) RecName: Full=Elongation factor P; Short=EF-P;... 35 4.5
CP000724_1761(CP000724|pid:none) Alkaliphilus metalliredigens QY... 35 4.5
AP004303_19(AP004303|pid:none) Oryza sativa Japonica Group genom... 34 5.8
(Q30S45) RecName: Full=Elongation factor P; Short=EF-P;... 34 5.8
AC122160_1(AC122160|pid:none) Medicago truncatula clone mth2-23d... 34 5.8
S65964_1(S65964|pid:none) ARC: TIF51A...UTR2 [Saccharomyces cere... 34 7.6
AC144738_20(AC144738|pid:none) Oryza sativa (japonica cultivar-g... 33 10.0
(Q6AF92) RecName: Full=Elongation factor P; Short=EF-P;... 33 10.0

>(P10160) RecName: Full=Eukaryotic translation initiation factor
5A-1; Short=eIF-5A-1; Short=eIF-5A1;
AltName: Full=Eukaryotic initiation factor 5A isoform 1;
Short=eIF-5A; AltName: Full=eIF-4D;
&A31486(A31486)
Length = 154

Score = 199 bits (507), Expect = 8e-50
Identities = 92/139 (66%), Positives = 115/139 (82%)
Frame = +2

Query: 269 DYAQAGSGASLTFPIQCSALRKNGFVVIKGFPCKIVDMSTSKTGKHGHAKVNITAIDIFT 448
D+ +GAS TFP+QCSALRKNGFVV+KG PCKIV+MSTSKTGKHGHAKV++ IDIFT
Sbjct: 6 DFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFT 65

Query: 449 GKKYEEICPSTHNIDVPNVSRKEYTVMDVQDGYLSLLDAGGEVKEDLALPEDDIGKEITQ 628
GKKYE+ICPSTHN+DVPN+ R ++ ++ +QDGYLSLL GEV+EDL LPE D+GKEI Q
Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQ 125

Query: 629 MLKEGKEPLVSVISALGKE 685
G+E L++V+SA+ +E
Sbjct: 126 KYDSGEEILITVLSAMTEE 144

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,092,745,432
Number of extensions: 19772811
Number of successful extensions: 87118
Number of sequences better than 10.0: 206
Number of HSP's gapped: 86962
Number of HSP's successfully gapped: 206
Length of query: 300
Length of database: 1,051,180,864
Length adjustment: 128
Effective length of query: 172
Effective length of database: 636,901,312
Effective search space: 109547025664
Effective search space used: 109547025664
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.99 gvh: 0.69 alm: 0.29 top: 0.73 tms: 0.07 mit: 0.25 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.60 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 1.00 tyr: 0.00 leu: 0.03 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 1.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 0.00

32.0 %: extracellular, including cell wall
32.0 %: plasma membrane
24.0 %: endoplasmic reticulum
12.0 %: Golgi

>> prediction for Contig-U15497-1 is exc

VS (DIR, S) 18
VH (FL, L) 2
VF (FL, S) 0
AH (FL, L) 1
AF (FL, S) 0
SL (DIR, L) 9
SS (DIR, S) 16
SH (FL, L) 0
SF (FL, S) 1
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 5
FC-IC (SUB) 1