| Contig-U15493-1 |
| Contig ID |
Contig-U15493-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
878 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
4576516 |
| End point |
4575705 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
27 |
| Number of EST |
28 |
| Link to clone list |
U15493 |
| List of clone(s) |
est1=VHI491F,1,579
est2=VSD483E,10,820
est3=VSH273E,11,822
est4=VSH302E,12,823
est5=VSF551E,17,803
est6=FC-BP19E,25,832
est7=VSG151E,43,790
est8=VHJ738Z,47,808
est9=FC-BO14Z,95,832
est10=FC-BS20Z,175,831
est11=VSE883Z,193,840
est12=SLC245Z,222,818
est13=FC-BJ04Z,232,823
est14=SLB815Z,247,818
est15=SLB881Z,257,818
est16=VSC263Z,267,853
est17=FC-BE22Z,270,827
est18=VSB214Z,276,878
est19=VSE183Z,284,840
est20=VSE252Z,300,854
est21=FC-AG09E,365,821
est22=VSJ689F,385,832
est23=VSJ689Z,385,812
est24=FC-AK06Z,395,825
est25=SLC722Z,402,824
est26=VSE735Z,407,822
est27=VSC196Z,412,824
est28=SLK850Z,542,826
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1.29 |
| Homology vs DNA |
Query= Contig-U15493-1 (Contig-U15493-1Q) /CSM_Contig/Contig-U15493-1Q.Seq.d
(878 letters)
Database: ddbj_B
98,226,423 sequences; 98,766,808,389 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 1542 0.0 1
(AU284886) Dictyostelium discoideum gamete cDNA clone:FC-BO1... 1400 0.0 1
(BJ442602) Dictyostelium discoideum cDNA clone:ddv50l09, 3' ... 1392 0.0 2
(AU267178) Dictyostelium discoideum vegetative cDNA clone:VS... 1370 0.0 2
(AU264111) Dictyostelium discoideum vegetative cDNA clone:VS... 1328 0.0 1
(AU284999) Dictyostelium discoideum gamete cDNA clone:FC-BS2... 1273 0.0 1
(AU263455) Dictyostelium discoideum vegetative cDNA clone:VS... 1245 0.0 1
(AU284916) Dictyostelium discoideum gamete cDNA clone:FC-BP1... 1227 0.0 2
(AU034196) Dictyostelium discoideum slug cDNA, clone SLC245. 1183 0.0 1
(AU034022) Dictyostelium discoideum slug cDNA, clone SLB815. 1134 0.0 1
(AU265407) Dictyostelium discoideum vegetative cDNA clone:VS... 1130 0.0 3
(AU034070) Dictyostelium discoideum slug cDNA, clone SLB881. 1114 0.0 1
(BJ423022) Dictyostelium discoideum cDNA clone:ddv47f24, 5' ... 1110 0.0 1
(AU262438) Dictyostelium discoideum vegetative cDNA clone:VS... 1092 0.0 1
(AU261895) Dictyostelium discoideum vegetative cDNA clone:VS... 1082 0.0 1
(AU267224) Dictyostelium discoideum vegetative cDNA clone:VS... 1068 0.0 3
(AU284737) Dictyostelium discoideum gamete cDNA clone:FC-BJ0... 973 0.0 2
(X15710) Dictyostelium discoideum mRNA for ribosomal protein... 864 0.0 5
(AU262928) Dictyostelium discoideum vegetative cDNA clone:VS... 1066 0.0 1
(AU262974) Dictyostelium discoideum vegetative cDNA clone:VS... 1037 0.0 1
(AU265406) Dictyostelium discoideum vegetative cDNA clone:VS... 1027 0.0 1
(AU267177) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 1
(AU264110) Dictyostelium discoideum vegetative cDNA clone:VS... 918 0.0 2
(AU284611) Dictyostelium discoideum gamete cDNA clone:FC-BE2... 1003 0.0 1
(AU267223) Dictyostelium discoideum vegetative cDNA clone:VS... 636 0.0 2
(AU266044) Dictyostelium discoideum vegetative cDNA clone:VS... 940 0.0 2
(C23650) Dictyostelium discoideum gamete cDNA, clone FC-AG09. 902 0.0 1
(AU270322) Dictyostelium discoideum vegetative cDNA clone:VS... 868 0.0 1
(AU270323) Dictyostelium discoideum vegetative cDNA clone:VS... 846 0.0 1
(AU034343) Dictyostelium discoideum slug cDNA, clone SLC722. 831 0.0 1
(AU262388) Dictyostelium discoideum vegetative cDNA clone:VS... 817 0.0 1
(AU263332) Dictyostelium discoideum vegetative cDNA clone:VS... 813 0.0 1
(AU266043) Dictyostelium discoideum vegetative cDNA clone:VS... 801 0.0 1
(AU284309) Dictyostelium discoideum gamete cDNA clone:FC-AK0... 460 0.0 4
(AU054167) Dictyostelium discoideum slug cDNA, clone SLK850. 547 e-151 1
(FG071110) UI-FF-IF0-aah-p-10-0-UI.r1 Ceratitis capitata emb... 68 2e-53 7
(FG074941) UI-FF-IF0-abk-i-07-0-UI.r1 Ceratitis capitata emb... 68 1e-52 7
(FG083755) UI-FF-IH0-aap-n-19-0-UI.r1 Ceratitis capitata adu... 68 1e-52 7
(FG076244) UI-FF-IF0-abo-e-15-0-UI.r1 Ceratitis capitata emb... 68 4e-51 7
(FG072359) UI-FF-IF0-aal-j-02-0-UI.r1 Ceratitis capitata emb... 68 4e-51 7
(FG077405) UI-FF-IF0-abn-c-18-0-UI.r1 Ceratitis capitata emb... 68 4e-51 7
(FG073347) UI-FF-IF0-abf-j-07-0-UI.r1 Ceratitis capitata emb... 68 4e-51 7
(FG069646) UI-FF-IF0-aad-n-19-0-UI.r1 Ceratitis capitata emb... 68 5e-51 7
(FG072560) UI-FF-IF0-aam-k-18-0-UI.r1 Ceratitis capitata emb... 68 5e-51 7
(FG072863) UI-FF-IF0-aan-a-14-0-UI.r1 Ceratitis capitata emb... 68 6e-51 7
(FG077822) UI-FF-IF0-abs-j-14-0-UI.r1 Ceratitis capitata emb... 68 7e-51 7
(FG080995) UI-FF-IH0-aav-i-18-0-UI.r1 Ceratitis capitata adu... 68 7e-51 7
(FG073673) UI-FF-IF0-abg-d-09-0-UI.r1 Ceratitis capitata emb... 68 7e-51 7
(FG069291) UI-FF-IF0-aac-p-17-0-UI.r1 Ceratitis capitata emb... 68 7e-51 7
(FG071959) UI-FF-IF0-aaj-b-17-0-UI.r1 Ceratitis capitata emb... 68 7e-51 7
(FG069589) UI-FF-IF0-aad-d-21-0-UI.r1 Ceratitis capitata emb... 68 7e-51 7
(FG072931) UI-FF-IF0-aan-m-18-0-UI.r1 Ceratitis capitata emb... 68 7e-51 7
(FG073106) UI-FF-IF0-aan-n-18-0-UI.r1 Ceratitis capitata emb... 68 1e-48 7
(DT491972) WS02549.C21_F03 PT-MB-N-A-15 Populus trichocarpa ... 90 4e-48 5
(FG080012) UI-FF-IH0-aat-k-24-0-UI.r1 Ceratitis capitata adu... 68 4e-48 7
(FG077459) UI-FF-IF0-abn-m-06-0-UI.r1 Ceratitis capitata emb... 68 8e-47 6
(FG076426) UI-FF-IF0-abo-h-03-0-UI.r1 Ceratitis capitata emb... 68 8e-47 6
(FG074632) UI-FF-IF0-abj-c-14-0-UI.r1 Ceratitis capitata emb... 68 8e-47 6
(FG070199) UI-FF-IF0-aae-h-01-0-UI.r1 Ceratitis capitata emb... 68 8e-47 6
(FG089335) CMRC-FF-IH0-acn-d-11-0-CMRC.r1 Ceratitis capitata... 68 8e-47 6
(FG071721) UI-FF-IF0-aai-h-12-0-UI.r1 Ceratitis capitata emb... 68 8e-47 6
(FG068534) UI-FF-IF0-aaa-j-03-0-UI.r1 Ceratitis capitata emb... 68 8e-47 6
(FG087016) CMRC-FF-IH0-acf-b-06-0-CMRC.r1 Ceratitis capitata... 68 9e-47 6
(FG078402) UI-FF-IF0-abu-d-17-0-UI.r1 Ceratitis capitata emb... 68 9e-47 6
(FG071877) UI-FF-IF0-aaj-c-10-0-UI.r1 Ceratitis capitata emb... 68 1e-46 6
(FG072958) UI-FF-IF0-aan-d-03-0-UI.r1 Ceratitis capitata emb... 68 1e-46 6
(FG072254) UI-FF-IF0-aal-f-17-0-UI.r1 Ceratitis capitata emb... 68 1e-46 6
(FG075302) UI-FF-IF0-abl-k-19-0-UI.r1 Ceratitis capitata emb... 68 1e-46 6
(FG086960) CMRC-FF-IH0-acf-f-05-0-CMRC.r1 Ceratitis capitata... 68 4e-45 6
(EV466093) MDEST1225 Hessian fly salivary gland cDNA Library... 101 5e-45 5
(DN952731) G12-SC-P2 Adult salivary gland cDNA library XWJRA... 80 7e-45 6
(EV466852) MDEST464 Hessian fly salivary gland cDNA Library ... 101 9e-45 5
(FG073680) UI-FF-IF0-abg-d-23-0-UI.r1 Ceratitis capitata emb... 68 1e-44 8
(FG068619) UI-FF-IF0-aaa-h-18-0-UI.r1 Ceratitis capitata emb... 68 3e-44 6
(FG077015) UI-FF-IF0-abq-i-20-0-UI.r1 Ceratitis capitata emb... 68 4e-44 7
(FG073220) UI-FF-IF0-abf-c-04-0-UI.r1 Ceratitis capitata emb... 62 6e-44 6
(FG075279) UI-FF-IF0-abl-g-21-0-UI.r1 Ceratitis capitata emb... 68 1e-43 8
(FG072565) UI-FF-IF0-aam-m-04-0-UI.r1 Ceratitis capitata emb... 62 2e-43 6
(EC761155) PSE00004390 rw_mgpallid Polysphondylium pallidum ... 188 2e-43 1
(FD463759) LARW138TF Haematobia irritans 1st Instar Larvae H... 78 3e-43 6
(FD459319) LARV834TF Haematobia irritans 1st Instar Larvae H... 78 3e-43 6
(FG077330) UI-FF-IF0-abr-d-15-0-UI.r1 Ceratitis capitata emb... 68 5e-43 7
(FD463760) LARW138TR Haematobia irritans 1st Instar Larvae H... 78 5e-43 6
(FD458962) LARV619TF Haematobia irritans 1st Instar Larvae H... 78 5e-43 6
(FD458963) LARV619TR Haematobia irritans 1st Instar Larvae H... 78 5e-43 6
(FD459320) LARV834TR Haematobia irritans 1st Instar Larvae H... 78 6e-43 6
(FD450705) EGGA704TR Haematobia irritans eggs Haematobia irr... 78 6e-43 6
(FD450704) EGGA704TF Haematobia irritans eggs Haematobia irr... 78 6e-43 6
(FD452462) EGGAH65TF Haematobia irritans eggs Haematobia irr... 78 6e-43 6
(FG073974) UI-FF-IF0-abh-i-04-0-UI.r1 Ceratitis capitata emb... 68 8e-43 6
(FG075751) UI-FF-IF0-abm-m-18-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG073361) UI-FF-IF0-abf-l-15-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG075918) UI-FF-IF0-abm-l-14-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG077451) UI-FF-IF0-abn-k-14-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG075913) UI-FF-IF0-abm-l-04-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG075007) UI-FF-IF0-abk-e-12-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG073491) UI-FF-IF0-abg-c-05-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG072978) UI-FF-IF0-aan-f-21-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG069110) UI-FF-IF0-aac-o-13-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG070130) UI-FF-IF0-aae-i-18-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG074215) UI-FF-IF0-abi-g-13-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FD452463) EGGAH65TR Haematobia irritans eggs Haematobia irr... 78 2e-42 6
(FG072515) UI-FF-IF0-aam-c-20-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG070061) UI-FF-IF0-aaf-l-21-0-UI.r1 Ceratitis capitata emb... 68 2e-42 6
(FG073859) UI-FF-IF0-abh-c-19-0-UI.r1 Ceratitis capitata emb... 68 3e-42 6
(EC760379) PSE00003233 rw_mgpallid Polysphondylium pallidum ... 184 4e-42 1
(FG077702) UI-FF-IF0-abs-d-13-0-UI.r1 Ceratitis capitata emb... 68 7e-42 8
(FG073881) UI-FF-IF0-abh-g-19-0-UI.r1 Ceratitis capitata emb... 68 1e-41 6
(FC821820) Sr_TOPOR_020h17_TOPOR S. ratti mixed stage TOPO S... 115 1e-41 2
(FC820797) Sr_TOPOF_19b12_TOPOF S. ratti mixed stage TOPO St... 115 1e-41 2
(FC821207) Sr_TOPOF_20h17_TOPOF S. ratti mixed stage TOPO St... 115 1e-41 2
(FC821755) Sr_TOPOR_020d21_TOPOR S. ratti mixed stage TOPO S... 115 1e-41 2
(FC821141) Sr_TOPOF_20d21_TOPOF S. ratti mixed stage TOPO St... 115 1e-41 2
(BI773231) kt03a04.y1 Strongyloides ratti L1 SL1 Topo1 Chiap... 115 1e-41 2
(BQ479322) ku32g10.y1 Strongyloides ratti PA female naive SL... 115 1e-41 2
(BQ479192) ku28g04.y1 Strongyloides ratti PA female naive SL... 115 1e-41 2
(BQ479234) ku30d08.y1 Strongyloides ratti PA female naive SL... 115 1e-41 2
(BI773235) kt06g12.y1 Strongyloides ratti L3 adult SL1 Topo1... 115 1e-41 2
(BQ479216) ku29e08.y1 Strongyloides ratti PA female naive SL... 115 1e-41 2
(BI704050) kt78f10.y4 Strongyloides ratti L2 SL1 TOPO v2 Str... 115 1e-41 2
(CV240776) WS02510.B21_E22 PT-MB-N-A-15 Populus trichocarpa ... 90 5e-41 4
(CV245900) WS0259.B21_L03 PT-MB-N-A-15 Populus trichocarpa c... 90 5e-41 4
(FG075043) UI-FF-IF0-abk-k-20-0-UI.r1 Ceratitis capitata emb... 68 6e-41 7
(FG076080) UI-FF-IF0-abn-h-19-0-UI.r1 Ceratitis capitata emb... 68 7e-41 7
(EE009975) ROE00005661 Rhizopus oryzae Company Rhizopus oryz... 52 4e-40 7
(FG071552) UI-FF-IF0-aak-p-23-0-UI.r1 Ceratitis capitata emb... 68 6e-40 7
(FG074921) UI-FF-IF0-abk-e-15-0-UI.r1 Ceratitis capitata emb... 68 3e-39 7
(FG075765) UI-FF-IF0-abm-b-01-0-UI.r1 Ceratitis capitata emb... 68 3e-39 7
(DT489915) WS02543.B21_I13 PT-MB-N-A-15 Populus trichocarpa ... 90 5e-39 3
(FG074659) UI-FF-IF0-abj-i-02-0-UI.r1 Ceratitis capitata emb... 68 1e-38 7
(EX148837) ZRA439R ZRA Zoophthora radicans cDNA clone ZRA439... 94 1e-38 4
(FG071143) UI-FF-IF0-aai-g-03-0-UI.r1 Ceratitis capitata emb... 68 1e-38 7
(FG075372) UI-FF-IF0-abl-g-20-0-UI.r1 Ceratitis capitata emb... 68 1e-38 7
(BQ479440) ku36f01.y1 Strongyloides ratti PA female naive SL... 88 4e-38 3
(EE008512) ROE00004371 Rhizopus oryzae Company Rhizopus oryz... 50 1e-37 7
(DV217266) cont11 Gigaspora margarita germinated spores Libr... 74 2e-37 6
(AR550486) Sequence 5617 from patent US 6747137. 80 7e-37 6
(FG077163) UI-FF-IF0-abq-j-20-0-UI.r1 Ceratitis capitata emb... 68 9e-37 6
(FG069844) UI-FF-IF0-aaf-c-13-0-UI.r1 Ceratitis capitata emb... 68 9e-37 6
(EX149287) ZRB530F ZRB Zoophthora radicans cDNA clone ZRB530... 94 2e-36 3
(EX148823) ZRA689F ZRA Zoophthora radicans cDNA clone ZRA689... 94 2e-36 3
(BI773230) kt02e09.y1 Strongyloides ratti L1 SL1 Topo1 Chiap... 98 3e-36 2
(EW779690) OoSal116 Asian rice gall midge salivary gland cDN... 76 4e-36 5
(FD933229) OoSal770 Asian rice gall midge salivary gland cDN... 76 6e-36 5
(EE007004) ROE00004237 Rhizopus oryzae Company Rhizopus oryz... 52 1e-35 6
(DY886601) CeleSEQ2322 Cunninghamella elegans pBluescript (E... 68 5e-35 6
(DY885321) CeleSEQ576 Cunninghamella elegans pBluescript (Ec... 68 5e-35 6
(DY888557) CeleSEQ5660 Cunninghamella elegans pBluescript (E... 68 5e-35 6
(DY888128) CeleSEQ3577 Cunninghamella elegans pBluescript (E... 68 5e-35 6
(AY961525) Lysiphlebus testaceipes ribosomal protein L8 (RpL... 88 2e-34 5
(EE008341) ROE00002957 Rhizopus oryzae Company Rhizopus oryz... 50 4e-34 7
(DY890680) CeleSEQ9882 Cunninghamella elegans pBluescript (E... 68 5e-34 6
(AX829386) Sequence 106 from Patent WO03072602. 64 6e-34 7
(AX818356) Sequence 106 from Patent EP1338608. 64 6e-34 7
(DB773274) Apis mellifera head cDNA, RIKEN full-length enric... 94 7e-34 2
(DB774185) Apis mellifera head cDNA, RIKEN full-length enric... 94 7e-34 2
(DB763901) Apis mellifera head cDNA, RIKEN full-length enric... 94 7e-34 2
(DB758461) Apis mellifera head cDNA, RIKEN full-length enric... 94 7e-34 2
(DB779419) Apis mellifera head cDNA, RIKEN full-length enric... 94 7e-34 2
(DY891326) CeleSEQ8050 Cunninghamella elegans pBluescript (E... 68 7e-34 6
(DY450817) PCAA-aaa27g02.g2 UCI-12 Podocoryna carnea cDNA 5'... 80 8e-34 3
(DY451027) PCAA-aaa42b04.g2 UCI-12 Podocoryna carnea cDNA 5'... 80 9e-34 3
(DR540155) WS01032.B21_G17 SS-R-N-A-11 Picea sitchensis cDNA... 68 1e-33 5
(FE851007) CAFP1487.fwd CAFP Pichia stipitis aerobic xylose ... 62 2e-33 7
(FE860273) CAFY547.fwd CAFY Pichia stipitis oxygen limited x... 62 2e-33 7
(FE845691) CAFI1104.fwd CAFI Pichia stipitis aerobic dextros... 62 2e-33 7
(BI704053) kt79f07.y4 Strongyloides ratti L2 SL1 TOPO v2 Str... 100 3e-33 2
(FE846057) CAFI528.fwd CAFI Pichia stipitis aerobic dextrose... 62 3e-33 7
(FE852453) CAFP2254.fwd CAFP Pichia stipitis aerobic xylose ... 62 3e-33 7
(FE852809) CAFP2438.fwd CAFP Pichia stipitis aerobic xylose ... 62 3e-33 7
(FE859871) CAFY1103.fwd CAFY Pichia stipitis oxygen limited ... 62 3e-33 7
(FE851215) CAFP1598.fwd CAFP Pichia stipitis aerobic xylose ... 62 4e-33 7
(FE850871) CAFP1412.fwd CAFP Pichia stipitis aerobic xylose ... 62 4e-33 7
(DW269650) UI-S-GS0-ace-b-24-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 4e-33 4
(FE846715) CAFI881.fwd CAFI Pichia stipitis aerobic dextrose... 62 4e-33 7
(FG074107) UI-FF-IF0-abh-b-20-0-UI.r1 Ceratitis capitata emb... 68 4e-33 5
(FE860615) CAFY725.fwd CAFY Pichia stipitis oxygen limited x... 62 5e-33 7
(FE845514) CAFI1005.fwd CAFI Pichia stipitis aerobic dextros... 62 5e-33 7
(FE850551) CAFP1239.fwd CAFP Pichia stipitis aerobic xylose ... 62 5e-33 7
(FE858574) CAFX425.fwd CAFX Pichia stipitis oxygen limited x... 62 5e-33 7
(ES608250) MDLTEa0001F11f MDLTEa Musca domestica cDNA, mRNA ... 80 5e-33 4
(FE853049) CAFP2562.fwd CAFP Pichia stipitis aerobic xylose ... 62 6e-33 7
(EF059340) Synthetic construct Saccharomyces cerevisiae clon... 64 7e-33 7
(FE852922) CAFP2495.fwd CAFP Pichia stipitis aerobic xylose ... 62 2e-32 6
(EC133290) HVE00010596 Hartmannella vermiformis Normalized l... 74 2e-32 4
(EC133541) HVE00012518 Hartmannella vermiformis Normalized l... 74 2e-32 4
(EE004477) ROE00008423 Rhizopus oryzae Company Rhizopus oryz... 52 2e-32 6
(EE004269) ROE00008327 Rhizopus oryzae Company Rhizopus oryz... 52 2e-32 6
(FE852693) CAFP2378.fwd CAFP Pichia stipitis aerobic xylose ... 62 2e-32 6
(FE856213) CAFU512.fwd CAFU Pichia stipitis oxygen limited d... 62 2e-32 6
(FE846193) CAFI603.fwd CAFI Pichia stipitis aerobic dextrose... 62 2e-32 6
(GE907061) 9545023_P16.ab1_c Past_norm2007 Porites astreoide... 74 2e-32 4
(EC134377) HVE00004907 Hartmannella vermiformis Normalized l... 74 2e-32 4
(FE856126) CAFU465.rev CAFU Pichia stipitis oxygen limited d... 62 2e-32 6
(FE849778) CAFO683.rev CAFO Pichia stipitis aerobic xylose M... 62 3e-32 6
(GE908218) 9551023_E13.ab1_c Past_norm2007 Porites astreoide... 74 3e-32 4
(GE910104) 9557023_L15.ab1_c Past_norm2007 Porites astreoide... 74 3e-32 4
(EC134485) HVE00011773 Hartmannella vermiformis Normalized l... 74 3e-32 4
(GE911984) Past_19_20453_D07.ab1_c Past_norm2007 Porites ast... 74 3e-32 4
(FE845508) CAFI1002.fwd CAFI Pichia stipitis aerobic dextros... 62 3e-32 6
(GE911827) Past_18_20453_L22.ab1_c Past_norm2007 Porites ast... 74 3e-32 4
(FE846898) CAFI976.fwd CAFI Pichia stipitis aerobic dextrose... 62 3e-32 6
(EE006326) ROE00003876 Rhizopus oryzae Company Rhizopus oryz... 52 3e-32 6
(GE915956) Past_30_20453_O02.ab1_c Past_norm2007 Porites ast... 74 3e-32 4
(DW280156) UI-S-GU0-adn-f-08-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 3e-32 4
(FE849779) CAFO683.fwd CAFO Pichia stipitis aerobic xylose M... 62 3e-32 6
(FE856127) CAFU465.fwd CAFU Pichia stipitis oxygen limited d... 62 3e-32 6
(FE852704) CAFP2384.rev CAFP Pichia stipitis aerobic xylose ... 62 3e-32 6
(GE912740) Past_21_20453_G15.ab1_c Past_norm2007 Porites ast... 74 3e-32 4
(FE856286) CAFU550.rev CAFU Pichia stipitis oxygen limited d... 62 3e-32 6
(FE860091) CAFY450.fwd CAFY Pichia stipitis oxygen limited x... 62 3e-32 6
(GE910454) 9558023_L22.ab1_c Past_norm2007 Porites astreoide... 74 3e-32 4
(GE916939) Past_33_20453_M12.ab1_c Past_norm2007 Porites ast... 74 3e-32 4
(FG175557) AGN_RNC122xb02r1.ab1 AGN_RNC Nicotiana tabacum cD... 74 3e-32 4
(EE004620) ROE00008231 Rhizopus oryzae Company Rhizopus oryz... 52 3e-32 5
(EE004525) ROE00008135 Rhizopus oryzae Company Rhizopus oryz... 52 3e-32 5
(FE852705) CAFP2384.fwd CAFP Pichia stipitis aerobic xylose ... 62 3e-32 6
(GE913175) Past_22_20453_L06.ab1_c Past_norm2007 Porites ast... 74 3e-32 4
(FE857012) CAFU937.rev CAFU Pichia stipitis oxygen limited d... 62 3e-32 6
(FE845507) CAFI1002.rev CAFI Pichia stipitis aerobic dextros... 62 3e-32 6
(FE846897) CAFI976.rev CAFI Pichia stipitis aerobic dextrose... 62 3e-32 6
(FG175611) AGN_RNC122xl22r1.ab1 AGN_RNC Nicotiana tabacum cD... 74 3e-32 4
(FE850354) CAFO977.fwd CAFO Pichia stipitis aerobic xylose M... 62 3e-32 6
(FE857013) CAFU937.fwd CAFU Pichia stipitis oxygen limited d... 62 3e-32 6
(FE850437) CAFP1178.fwd CAFP Pichia stipitis aerobic xylose ... 62 3e-32 6
(GE914074) Past_25_20453_F09.ab1_c Past_norm2007 Porites ast... 74 4e-32 4
(FG078516) UI-FF-IF0-abu-h-06-0-UI.r1 Ceratitis capitata emb... 68 4e-32 5
(BG101599) QW69 Apis mellifera larval caste mRNA Apis mellif... 88 4e-32 2
(FE856287) CAFU550.fwd CAFU Pichia stipitis oxygen limited d... 62 4e-32 6
(EX452496) SSHGR24_Contig_5 Gigaspora rosea GR24 treated SSH... 74 4e-32 4
(EE007876) ROE00003500 Rhizopus oryzae Company Rhizopus oryz... 56 5e-32 7
(GE915618) Past_29_20453_N20.ab1_c Past_norm2007 Porites ast... 74 8e-32 4
(CX614041) GABR1_11_E08.g1_A002 GA- or brassinolide-treated ... 68 1e-31 5
(EE007368) ROE00003590 Rhizopus oryzae Company Rhizopus oryz... 60 1e-31 6
(EC129460) HVE00007266 Hartmannella vermiformis Regular Smal... 74 3e-31 3
(FE852692) CAFP2378.rev CAFP Pichia stipitis aerobic xylose ... 60 3e-31 6
(CF771475) DSBF1_20_A06.g1_A010 Drought-stressed before flow... 88 3e-31 4
(EE005768) ROE00013353 Rhizopus oryzae Company Rhizopus oryz... 50 4e-31 6
(DW269555) UI-S-GS0-ace-p-05-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 4e-31 4
(DY886965) CeleSEQ2811 Cunninghamella elegans pBluescript (E... 68 5e-31 5
(DW269957) UI-S-GS0-acf-i-03-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 5e-31 4
(DB655882) Saccharomyces cerevisiae mRNA, clone: Y031_B05_F.... 52 7e-31 7
(FE850353) CAFO977.rev CAFO Pichia stipitis aerobic xylose M... 60 9e-31 6
(EH017320) USDA-FP_182743 Lysiphlebus testaceipes adult whol... 88 1e-30 4
(EE001896) ROE00007602 Rhizopus oryzae Company Rhizopus oryz... 50 2e-30 5
(EE001889) ROE00007698 Rhizopus oryzae Company Rhizopus oryz... 50 2e-30 5
(DB648385) Saccharomyces cerevisiae mRNA, clone: S03052-54_C... 58 2e-30 7
(BQ479362) ku34a06.y1 Strongyloides ratti PA female naive SL... 88 2e-30 3
(BI704051) kt79d07.y4 Strongyloides ratti L2 SL1 TOPO v2 Str... 88 2e-30 3
(BI863822) kx48g09.y1 Parastrongyloides trichosuri FL pAMP1 ... 105 2e-30 2
(BI703757) kx17e04.y3 Parastrongyloides trichosuri FL pAMP1 ... 105 2e-30 2
(BI743333) kx41f08.y1 Parastrongyloides trichosuri FL pAMP1 ... 105 2e-30 2
(FG071638) UI-FF-IF0-aai-j-01-0-UI.r1 Ceratitis capitata emb... 68 2e-30 4
(FG071044) UI-FF-IF0-aah-d-18-0-UI.r1 Ceratitis capitata emb... 68 2e-30 4
(DV205688) HSAA-aaa06g05.g1 UCI-11 Hydra vulgaris cDNA 5' si... 68 2e-30 3
(FG068953) UI-FF-IF0-aab-d-18-0-UI.r1 Ceratitis capitata emb... 68 2e-30 4
(FG078359) UI-FF-IF0-abu-k-24-0-UI.r1 Ceratitis capitata emb... 68 3e-30 4
(FG078224) UI-FF-IF0-abu-e-03-0-UI.r1 Ceratitis capitata emb... 68 3e-30 4
(FG068864) UI-FF-IF0-aab-d-13-0-UI.r1 Ceratitis capitata emb... 68 3e-30 4
(DY890124) CeleSEQ7780 Cunninghamella elegans pBluescript (E... 68 3e-30 5
(FG070699) UI-FF-IF0-aag-d-24-0-UI.r1 Ceratitis capitata emb... 68 3e-30 4
(FE850436) CAFP1178.rev CAFP Pichia stipitis aerobic xylose ... 60 3e-30 6
(BG453553) NF097G12LF1F1097 Developing leaf Medicago truncat... 66 3e-30 5
(DW270734) UI-S-GS0-acg-j-19-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 5e-30 3
(EV220304) 0135412 Brassica napus Root - drought Brassica na... 84 5e-30 5
(DW279368) UI-S-GU0-adl-i-01-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 5e-30 3
(GE383763) 293422616 Nasonia vitripennis Female Pupae Nasoni... 64 5e-30 4
(GE383894) 293425976 Nasonia vitripennis Female Pupae Nasoni... 64 6e-30 4
(DW279072) UI-S-GU0-adk-o-11-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 7e-30 3
(DW281166) UI-S-GU0-adq-b-22-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 7e-30 3
(DW279931) UI-S-GU0-adn-c-19-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 8e-30 3
(DW280696) UI-S-GU0-adp-o-24-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 8e-30 3
(DW280662) UI-S-GU0-adp-i-14-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 9e-30 3
(DB653300) Saccharomyces cerevisiae mRNA, clone: Y011_E10_F.... 48 9e-30 7
(BQ479214) ku29e02.y1 Strongyloides ratti PA female naive SL... 88 9e-30 2
(CV244265) WS0254.B21_C24 PT-MB-N-A-15 Populus trichocarpa c... 90 9e-30 2
(DW279899) UI-S-GU0-adm-n-12-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 9e-30 3
(DW280021) UI-S-GU0-adn-g-02-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 9e-30 3
(DB663550) Saccharomyces cerevisiae mRNA, clone: Y086_L03_F.... 48 9e-30 7
(DW270266) UI-S-GS0-ach-g-11-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 1e-29 3
(DW280562) UI-S-GU0-adp-g-07-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW279272) UI-S-GU0-adk-f-16-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW276552) UI-S-GU0-acz-i-18-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW257415) UI-S-GG0-aat-g-06-0-UI.s1 UI-S-GG0 Euprymna scolo... 82 1e-29 3
(DW257116) UI-S-GG0-aas-k-24-0-UI.s1 UI-S-GG0 Euprymna scolo... 82 1e-29 3
(DW276543) UI-S-GU0-acz-g-20-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW279031) UI-S-GU0-adk-g-07-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW275591) UI-S-GU0-adc-g-06-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW269424) UI-S-GS0-ace-c-20-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 1e-29 3
(DB653315) Saccharomyces cerevisiae mRNA, clone: Y011_G10_F.... 48 1e-29 7
(DW281263) UI-S-GU0-adr-e-07-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW276707) UI-S-GU0-acx-f-22-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW254306) UI-S-GB1-aal-b-12-0-UI.s1 UI-S-GB1 Euprymna scolo... 82 1e-29 3
(DW276564) UI-S-GU0-acz-k-20-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW261702) UI-S-GN0-abi-o-10-0-UI.s1 UI-S-GN0 Euprymna scolo... 82 1e-29 3
(DW269827) UI-S-GS0-aci-n-07-0-UI.s1 UI-S-GS0 Euprymna scolo... 82 1e-29 3
(DW279362) UI-S-GU0-adl-g-11-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW275936) UI-S-GU0-adc-h-03-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(DW280792) UI-S-GU0-adp-d-20-0-UI.s1 UI-S-GU0 Euprymna scolo... 82 1e-29 3
(BQ479183) ku28c11.y1 Strongyloides ratti PA female naive SL... 88 3e-29 3
(BW641390) Dugesia ryukyuensis mRNA, clone: Dr_sW_021_C10, 5... 68 4e-29 6
(EV219625) 0134733 Brassica napus Root - drought Brassica na... 72 4e-29 3
(EC386217) SAAG-aaa03e10.g1 Planaria_Primary_EST Schmidtea m... 86 5e-29 6
(EC386693) SAAG-aaa03e10.b1 Planaria_Primary_EST Schmidtea m... 86 5e-29 6
(EX829087) CBNB1609.fwd CBNB Phycomyces blakesleeanus NRRL15... 48 5e-29 6
(BW643276) Dugesia ryukyuensis mRNA, clone: Dr_sW_026_O11, 5... 68 5e-29 6
(EC386280) SAAG-aaa01b08.b1 Planaria_Primary_EST Schmidtea m... 86 6e-29 6
(EE000709) ROE00008535 Rhizopus oryzae Company Rhizopus oryz... 50 7e-29 5
(BW643459) Dugesia ryukyuensis mRNA, clone: Dr_sW_027_G19, 5... 68 7e-29 6
(BW637133) Dugesia ryukyuensis mRNA, clone: Dr_sW_007_I24, 5... 68 7e-29 6
(BW637746) Dugesia ryukyuensis mRNA, clone: Dr_sW_009_H05, 5... 68 8e-29 6
(FC651402) CAXW11906.rev CAXW Lottia gigantea from female go... 74 1e-28 3
(EE003397) ROE00012007 Rhizopus oryzae Company Rhizopus oryz... 50 1e-28 5
(FD450579) EGGA628TR Haematobia irritans eggs Haematobia irr... 78 1e-28 3
(BI450919) kt79c09.y4 Strongyloides ratti L2 SL1 TOPO v2 Str... 88 1e-28 3
(FD450578) EGGA628TF Haematobia irritans eggs Haematobia irr... 78 1e-28 3
(DB656240) Saccharomyces cerevisiae mRNA, clone: Y033_P03_F.... 46 1e-28 7
(EH634191) EST5299 LK04 Laupala kohalensis cDNA clone 106102... 88 1e-28 4
(EH638664) EST9772 LK04 Laupala kohalensis cDNA clone 106102... 88 1e-28 4
(FF287183) pgsP0017H13 Solea senegalensis Mix of cDNA librar... 66 2e-28 4
(EE004905) ROE00005087 Rhizopus oryzae Company Rhizopus oryz... 50 2e-28 6
(EE005080) ROE00000526 Rhizopus oryzae Company Rhizopus oryz... 50 2e-28 6
(ES506472) BIG_AF_14289 Brine Shrimp diapaused embryos (cyst... 66 2e-28 4
(DV205714) PCAA-aaa07g08.g1 UCI-12 Podocoryna carnea cDNA 5'... 64 3e-28 4
(EE007271) ROE00005491 Rhizopus oryzae Company Rhizopus oryz... 50 3e-28 6
(U17360) Saccharomyces cerevisiae ribosomal protein YL6b mRN... 64 3e-28 6
(EE002833) ROE00000113 Rhizopus oryzae Company Rhizopus oryz... 50 3e-28 5
(EE007663) ROE00004458 Rhizopus oryzae Company Rhizopus oryz... 50 4e-28 5
(FE860614) CAFY725.rev CAFY Pichia stipitis oxygen limited x... 54 4e-28 7
(EX838477) CBNB7468.fwd CBNB Phycomyces blakesleeanus NRRL15... 48 6e-28 6
(FE852921) CAFP2495.rev CAFP Pichia stipitis aerobic xylose ... 60 6e-28 6
(FE846192) CAFI603.rev CAFI Pichia stipitis aerobic dextrose... 60 6e-28 6
(CJ524793) Triticum aestivum cDNA clone rwhdp14i21 3', Y.Ogi... 76 7e-28 3
(EX860188) CBNF5356.fwd CBNF Phycomyces blakesleeanus NRRL15... 48 7e-28 6
(EX837124) CBNB6750.rev CBNB Phycomyces blakesleeanus NRRL15... 48 7e-28 6
(EX838357) CBNB7405.fwd CBNB Phycomyces blakesleeanus NRRL15... 48 8e-28 6
(EX855216) CBNF11236.fwd CBNF Phycomyces blakesleeanus NRRL1... 48 8e-28 6
(ES644300) NVPQK61TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 8e-28 4
(EB079641) EST1230263 Nasonia vitripennis (wasp) pre-pupal E... 64 8e-28 4
(FD933825) SmSal942 Orange wheat blossom midge salivary glan... 74 9e-28 3
(EX854500) CBNF10731.fwd CBNF Phycomyces blakesleeanus NRRL1... 48 9e-28 6
(EE002987) ROE00009586 Rhizopus oryzae Company Rhizopus oryz... 50 9e-28 5
(EE002899) ROE00009490 Rhizopus oryzae Company Rhizopus oryz... 50 9e-28 5
(EX863382) CBNF6948.fwd CBNF Phycomyces blakesleeanus NRRL15... 48 1e-27 6
(EX858901) CBNF4724.fwd CBNF Phycomyces blakesleeanus NRRL15... 48 1e-27 6
(ES639220) NVPDQ11TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(FE850765) CAFP1357.rev CAFP Pichia stipitis aerobic xylose ... 60 1e-27 6
(EB078914) EST1229536 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(EB080801) EST1228548 Nasonia vitripennis (wasp) 0-24h EST l... 64 1e-27 4
(DW280494) UI-S-GU0-ado-h-12-0-UI.s1 UI-S-GU0 Euprymna scolo... 74 1e-27 3
(ES635230) NVPB625TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB078582) EST1229204 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(ES647211) NVPRX48TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES644090) NVPQG60TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB080175) EST1230797 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES647935) NVPS935TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES636647) NVPBX25TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB080064) EST1230686 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078692) EST1229314 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(ES641058) NVPP132TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB079609) EST1230231 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB079109) EST1229731 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EV426805) 210767423 NVP Nasonia vitripennis cDNA clone 209I... 64 1e-27 4
(ES642933) NVPPV71TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES637333) NVPCC92TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB080248) EST1230870 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB079405) EST1230027 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES648448) NVPSH22TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EV432055) 210814403 NVP Nasonia vitripennis cDNA clone 185C... 64 1e-27 4
(ES641100) NVPP165 NVPP Nasonia vitripennis cDNA, mRNA seque... 64 1e-27 4
(ES633229) NVPA512TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB079120) EST1229742 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB080150) EST1230772 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078764) EST1229386 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(EV430789) 210803840 NVP Nasonia vitripennis cDNA clone 216I... 64 1e-27 4
(ES647809) NVPS741TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EV433716) 211382894 NVP Nasonia vitripennis cDNA clone 237E... 64 1e-27 4
(ES643262) NVPQ162TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES639864) NVPE554TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB079462) EST1230084 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078982) EST1229604 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(EB080479) EST1231101 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES650176) NVPTD30TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB080521) EST1231143 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES650407) NVPTH45TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES646771) NVPRQ62TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES637833) NVPCP94TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES634720) NVPAW07TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB078520) EST1229142 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(EB080161) EST1230783 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078372) EST1228994 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(ES647873) NVPS834TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(GE367702) 292295368 Nasonia vitripennis Male Pupae Nasonia ... 64 1e-27 4
(EV427531) 210769076 NVP Nasonia vitripennis cDNA clone 223I... 64 1e-27 4
(EB079996) EST1230618 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EV426620) 210762637 NVP Nasonia vitripennis cDNA clone 223O... 64 1e-27 4
(EV431209) 210804775 NVP Nasonia vitripennis cDNA clone 204O... 64 1e-27 4
(EB078802) EST1229424 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(ES645298) NVPR307TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES637203) NVPC985TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EV431576) 210806867 NVP Nasonia vitripennis cDNA clone 185C... 64 1e-27 4
(ES643709) NVPQ940TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES649062) NVPST02TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES636530) NVPBV08TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB080226) EST1230848 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES648301) NVPSE91TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB079790) EST1230412 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES641599) NVPP713TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB079198) EST1229820 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078754) EST1229376 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(EV427280) 210768171 NVP Nasonia vitripennis cDNA clone 205C... 64 1e-27 4
(EB079552) EST1230174 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB080324) EST1230946 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078683) EST1229305 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(ES642280) NVPPJ57TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES634015) NVPAJ49TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB079299) EST1229921 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(EB078449) EST1229071 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(ES648843) NVPSP54TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(ES638019) NVPCU34TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EB078815) EST1229437 Nasonia vitripennis (wasp) pupal-adult... 64 1e-27 4
(EB080290) EST1230912 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(FC710000) CAXY6109.fwd CAXY Lottia gigantea from male gonad... 74 1e-27 3
(EB080129) EST1230751 Nasonia vitripennis (wasp) pre-pupal E... 64 1e-27 4
(ES647641) NVPS482TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 1e-27 4
(EV426539) 210761287 NVP Nasonia vitripennis cDNA clone 205C... 64 2e-27 4
(ES639233) NVPDQ50TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES641412) NVPP403TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079779) EST1230401 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES645216) NVPR170TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB078917) EST1229539 Nasonia vitripennis (wasp) pupal-adult... 64 2e-27 4
(DW269239) UI-S-GS0-acd-p-20-0-UI.s1 UI-S-GS0 Euprymna scolo... 74 2e-27 3
(EB079167) EST1229789 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB080077) EST1230699 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES647315) NVPRZ29TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES633013) NVPA088TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB078351) EST1228973 Nasonia vitripennis (wasp) pupal-adult... 64 2e-27 4
(ES643673) NVPQ880TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079546) EST1230168 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES650332) NVPTG13TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES641329) NVPP342TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079158) EST1229780 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES642153) NVPPH20TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES637349) NVPCD27TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079794) EST1230416 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB079282) EST1229904 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB078766) EST1229388 Nasonia vitripennis (wasp) pupal-adult... 64 2e-27 4
(ES645328) NVPR352TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079977) EST1230599 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES646614) NVPRO16TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES642087) NVPPF91TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079807) EST1230429 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB079267) EST1229889 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES645433) NVPR532TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES641101) NVPP165TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB080506) EST1231128 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES643070) NVPPY27TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079429) EST1230051 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES643559) NVPQ680TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB080503) EST1231125 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES650321) NVPTF81TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079121) EST1229743 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EV430270) 210796746 NVP Nasonia vitripennis cDNA clone 216I... 64 2e-27 4
(ES643331) NVPQ275TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES643772) NVPQA56TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079519) EST1230141 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(ES636389) NVPBS30TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB078668) EST1229290 Nasonia vitripennis (wasp) pupal-adult... 64 2e-27 4
(ES643235) NVPQ117TR NVPP Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(ES634852) NVPAY61TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB079454) EST1230076 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB078532) EST1229154 Nasonia vitripennis (wasp) pupal-adult... 64 2e-27 4
(EB079477) EST1230099 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB079561) EST1230183 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EB080791) EST1228538 Nasonia vitripennis (wasp) 0-24h EST l... 64 2e-27 4
(ES634628) NVPAU55TR NVPA Nasonia vitripennis cDNA, mRNA seq... 64 2e-27 4
(EB078510) EST1229132 Nasonia vitripennis (wasp) pupal-adult... 64 2e-27 4
(DR987172) JGI_AOSF569.fwd AOSF Montastraea faveolata adult ... 64 2e-27 5
(EB079417) EST1230039 Nasonia vitripennis (wasp) pre-pupal E... 64 2e-27 4
(EH217784) USDA-FP_180580 WHMH (pink hibiscus mealybug) Maco... 60 2e-27 6
(DW262726) UI-S-GN1-abo-l-18-0-UI.s1 UI-S-GN1 Euprymna scolo... 82 3e-27 3
(BW636261) Dugesia ryukyuensis mRNA, clone: Dr_sW_004_O13, 5... 68 3e-27 5
(EF070479) Maconellicoccus hirsutus clone WHMH3454 putative ... 60 3e-27 6
(ES508509) BIG_AF_16326 Brine Shrimp embryos, 10 hours after... 60 3e-27 5
(BW637009) Dugesia ryukyuensis mRNA, clone: Dr_sW_007_D04, 5... 68 4e-27 5
(EV220606) 0135714 Brassica napus Root - drought Brassica na... 84 4e-27 5
(AI778655) EST259534 tomato susceptible, Cornell Solanum lyc... 74 5e-27 6
(FC616617) CAXS8361.fwd CAXS Lottia gigantea from head, foot... 74 6e-27 3
(FC704729) CAXY2743.fwd CAXY Lottia gigantea from male gonad... 74 6e-27 3
(FC638768) CAXU3422.fwd CAXU Lottia gigantea from female gon... 74 6e-27 3
(FC603730) CAXS14912.fwd CAXS Lottia gigantea from head, foo... 74 6e-27 3
(FC616616) CAXS8361.rev CAXS Lottia gigantea from head, foot... 74 6e-27 3
(FC631335) CAXT7608.fwd CAXT Lottia gigantea from mantle Lot... 74 6e-27 3
(FC625609) CAXT4563.fwd CAXT Lottia gigantea from mantle Lot... 74 6e-27 3
(FC607078) CAXS3087.fwd CAXS Lottia gigantea from head, foot... 74 6e-27 3
(FC714304) CAXY8798.fwd CAXY Lottia gigantea from male gonad... 74 6e-27 3
(FC707650) CAXY4801.fwd CAXY Lottia gigantea from male gonad... 74 6e-27 3
(FC613296) CAXS6536.fwd CAXS Lottia gigantea from head, foot... 74 6e-27 3
(FC664734) CAXW3989.fwd CAXW Lottia gigantea from female gon... 74 6e-27 3
(FC602150) CAXS13934.fwd CAXS Lottia gigantea from head, foo... 74 6e-27 3
>(AC116957) Dictyostelium discoideum chromosome 2 map 1685067-2090751
strain AX4, complete sequence.
Length = 405682
Score = 1542 bits (778), Expect = 0.0
Identities = 778/778 (100%)
Strand = Plus / Plus
Query: 43 agctcaaagaaaaggtaaagccggttcagttttcggtgcacacactcaccaccgtaaagg 102
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 63716 agctcaaagaaaaggtaaagccggttcagttttcggtgcacacactcaccaccgtaaagg 63775
Query: 103 taccccacgtttccgtgccttagattatgccgaacgtcaaggttacgttaaaggtgttgt 162
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 63776 taccccacgtttccgtgccttagattatgccgaacgtcaaggttacgttaaaggtgttgt 63835
Query: 163 caaggagatcatccacgatccaggtagaggtgctccattagcccgtgttgttttcaaagg 222
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 63836 caaggagatcatccacgatccaggtagaggtgctccattagcccgtgttgttttcaaagg 63895
Query: 223 cttaacccaattcaaattagacaaacaattattcatcgccccagaaggtatgcacactgg 282
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 63896 cttaacccaattcaaattagacaaacaattattcatcgccccagaaggtatgcacactgg 63955
Query: 283 tcaatttgttttcgctggtaaaaaagccaccctcaccattggtaacatcctcccaattgg 342
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 63956 tcaatttgttttcgctggtaaaaaagccaccctcaccattggtaacatcctcccaattgg 64015
Query: 343 taaactcccagaaggtaccatcatttgcaacgttgaagaaaaactcggtgattgtggtgc 402
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64016 taaactcccagaaggtaccatcatttgcaacgttgaagaaaaactcggtgattgtggtgc 64075
Query: 403 tgttgctcgttgttcaggtaactatgctaccatcgtctcacacaacccagatgaaggtgt 462
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64076 tgttgctcgttgttcaggtaactatgctaccatcgtctcacacaacccagatgaaggtgt 64135
Query: 463 tacccgtatcaaattaccatcaggttcaaagaagaacgtttcttcattagctcgtgctat 522
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64136 tacccgtatcaaattaccatcaggttcaaagaagaacgtttcttcattagctcgtgctat 64195
Query: 523 gatcggtattgttgccggtggtggtcgtatcgataaaccaatgctcaaagctggtcgtgc 582
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64196 gatcggtattgttgccggtggtggtcgtatcgataaaccaatgctcaaagctggtcgtgc 64255
Query: 583 tttccacaaatacagagttaagaagaataactggccaaaggttagaggtgttgctatgaa 642
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64256 tttccacaaatacagagttaagaagaataactggccaaaggttagaggtgttgctatgaa 64315
Query: 643 tccagtagaacatccacacggtggtggtaatcatcaacatgttggtcatgccactacaac 702
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64316 tccagtagaacatccacacggtggtggtaatcatcaacatgttggtcatgccactacaac 64375
Query: 703 caagagagacgatccagctggtaagaaagttggtttaattgctgcccgtcgtactggtcg 762
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64376 caagagagacgatccagctggtaagaaagttggtttaattgctgcccgtcgtactggtcg 64435
Query: 763 tttaagaggaactaaaaacatttcagaataaacagcattcaaaaccttttataaatat 820
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 64436 tttaagaggaactaaaaacatttcagaataaacagcattcaaaaccttttataaatat 64493
Score = 50.1 bits (25), Expect = 0.14
Identities = 25/25 (100%)
Strand = Plus / Plus
Query: 20 cgcgaaatgggtagaataatcagag 44
|||||||||||||||||||||||||
Sbjct: 62971 cgcgaaatgggtagaataatcagag 62995
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 98226423
Number of Hits to DB: 795,067,061
Number of extensions: 40448385
Number of successful extensions: 2856589
Number of sequences better than 10.0: 19071
Length of query: 878
Length of database: 98,766,808,389
Length adjustment: 24
Effective length of query: 854
Effective length of database: 96,409,374,237
Effective search space: 82333605598398
Effective search space used: 82333605598398
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.16 |
| Homology vs Protein |
Query= Contig-U15493-1 (Contig-U15493-1Q) /CSM_Contig/Contig-U15493-1Q.Seq.d
(878 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(P13023) RecName: Full=60S ribosomal protein L8; AltName: Full=6... 521 e-147
R5DO2(S06087) ribosomal protein L8.e - slime mold (Dictyostelium... 399 e-116
DQ252497_1(DQ252497|pid:none) Solanum tuberosum clone 068C11 rib... 385 e-106
EF103429_1(EF103429|pid:none) Haliotis discus discus ribosomal p... 384 e-105
BT078708_1(BT078708|pid:none) Lepeophtheirus salmonis Pacific fo... 383 e-105
DQ440262_1(DQ440262|pid:none) Aedes aegypti clone AET-322 60S ri... 381 e-104
AK168332_1(AK168332|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 381 e-104
(P46286) RecName: Full=60S ribosomal protein L8-1; AltName: Full... 380 e-104
AY890287_1(AY890287|pid:none) Synthetic construct Homo sapiens c... 380 e-104
EF638988_1(EF638988|pid:none) Triatoma infestans clone TI-337 60... 380 e-104
BT070439_1(BT070439|pid:none) Picea sitchensis clone WS0272_A03 ... 380 e-104
(Q5R7Y8) RecName: Full=60S ribosomal protein L8; &CR859970_1(CR... 379 e-104
AK340259_1(AK340259|pid:none) Acyrthosiphon pisum ACYPI008243 mR... 379 e-104
(P41116) RecName: Full=60S ribosomal protein L8; &BC043823_1(BC... 379 e-104
EU934279_1(EU934279|pid:none) TSA: Anopheles darlingi AD-224 60S... 379 e-104
EU176553_1(EU176553|pid:none) Synthetic construct Homo sapiens c... 379 e-104
(Q42064) RecName: Full=60S ribosomal protein L8-3; &AF361610_1(... 379 e-104
EF191793_1(EF191793|pid:none) Taeniopygia guttata clone 0061P002... 378 e-103
BT033852_1(BT033852|pid:none) Zea mays full-length cDNA clone ZM... 377 e-103
(Q90YW1) RecName: Full=60S ribosomal protein L8; &AF401561_1(AF... 377 e-103
EU964195_1(EU964195|pid:none) Zea mays clone 276636 60S ribosoma... 377 e-103
AP008218_1153(AP008218|pid:none) Oryza sativa (japonica cultivar... 377 e-103
AY813786_1(AY813786|pid:none) Schistosoma japonicum SJCHGC01239 ... 376 e-103
DQ213525_1(DQ213525|pid:none) Taeniopygia guttata clone 0058P003... 376 e-103
AM437656_2(AM437656|pid:none) Vitis vinifera contig VV78X022989.... 376 e-103
FN323135_1(FN323135|pid:none) Schistosoma japonicum isolate Anhu... 376 e-103
BT058154_1(BT058154|pid:none) Salmo salar clone Contig1023 60S r... 375 e-102
AF164152_1(AF164152|pid:none) Anopheles gambiae strain M2 riboso... 375 e-102
AM049008_1(AM049008|pid:none) Biphyllus lunatus mRNA for ribosom... 374 e-102
DQ979393_1(DQ979393|pid:none) Oryzias latipes strain Orange Red ... 374 e-102
EU325868_1(EU325868|pid:none) Oncorhynchus masou formosanus ribo... 374 e-102
EF146082_1(EF146082|pid:none) Populus trichocarpa clone WS0115_G... 374 e-102
FN357421_11(FN357421|pid:none) Schistosoma mansoni genome sequen... 373 e-102
BT069444_1(BT069444|pid:none) Zea mays full-length cDNA clone ZM... 373 e-102
AB374942_1(AB374942|pid:none) Solea senegalensis RPL8 mRNA for r... 372 e-102
AB180407_1(AB180407|pid:none) Plutella xylostella mRNA for Ribos... 372 e-101
EF584753_1(EF584753|pid:none) Lateolabrax japonicus ribosomal pr... 370 e-101
AC135311_31(AC135311|pid:none) Medicago truncatula clone mth2-27... 369 e-101
AM049009_1(AM049009|pid:none) Georissus sp. APV-2005 mRNA for ri... 368 e-100
AM049011_1(AM049011|pid:none) Mycetophagus quadripustulatus mRNA... 367 e-100
DQ056619_1(DQ056619|pid:none) Arabidopsis thaliana 60S ribosomal... 366 e-100
(Q4PSL7) RecName: Full=60S ribosomal protein L8-2; &AL132980_23... 365 e-100
AJ404848_1(AJ404848|pid:none) Glycine max mRNA for ribosomal pro... 363 3e-99
AJ414568_1(AJ414568|pid:none) Paracentrotus mRNA for ribosomal p... 363 5e-99
CP000584_187(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 363 5e-99
(Q9XVF7) RecName: Full=60S ribosomal protein L8; &T18676(T18676... 362 1e-98
CR382134_653(CR382134|pid:none) Debaryomyces hansenii strain CBS... 361 2e-98
EF634530_1(EF634530|pid:none) Koerneria sp. RS1982 large subunit... 361 2e-98
(P05736) RecName: Full=60S ribosomal protein L2; AltName: Full=L... 360 3e-98
EF634524_1(EF634524|pid:none) Pristionchus sp. 10 RS5133 large s... 359 6e-98
EF634518_1(EF634518|pid:none) Pristionchus sp. 4 RS5050 large su... 359 6e-98
EF634528_1(EF634528|pid:none) Pristionchus sp. 14 RS5230 large s... 359 6e-98
EF634513_1(EF634513|pid:none) Pristionchus maupasi large subunit... 359 6e-98
CU928169_196(CU928169|pid:none) Kluyveromyces thermotolerans str... 359 8e-98
EF634523_1(EF634523|pid:none) Pristionchus pseudaerivorus large ... 359 8e-98
CR382124_664(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 358 1e-97
EF634516_1(EF634516|pid:none) Pristionchus uniformis large subun... 358 1e-97
AM049010_1(AM049010|pid:none) Meladema coriacea partial mRNA for... 357 2e-97
AY857413_1(AY857413|pid:none) Suberites domuncula L2/L8 mRNA, pa... 357 3e-97
CR940347_174(CR940347|pid:none) Theileria annulata strain Ankara... 355 9e-97
X51659_1(X51659|pid:none) S.pombe DNA for ribosomal protein gene... 353 4e-96
CP001141_198(CP001141|pid:none) Phaeodactylum tricornutum CCAP 1... 353 6e-96
EU574889_1(EU574889|pid:none) Ornithodoros coriaceus clone OC-88... 352 9e-96
AM270388_13(AM270388|pid:none) Aspergillus niger contig An17c006... 348 1e-94
AL844504_166(AL844504|pid:none) Plasmodium falciparum 3D7 chromo... 345 1e-93
EU542915_1(EU542915|pid:none) Squalius pyrenaicus ribosomal prot... 342 7e-93
AM920436_1743(AM920436|pid:none) Penicillium chrysogenum Wiscons... 340 3e-92
EF207977_1(EF207977|pid:none) Heliconius melpomene ribosomal pro... 332 8e-90
BT043518_1(BT043518|pid:none) Salmo salar clone HM4_1115 ribosom... 329 9e-89
DQ421410_1(DQ421410|pid:none) Pseudacris regilla ribosomal prote... 328 1e-88
AB429253_1(AB429253|pid:none) Dicyema japonicum rpl8 gene for 60... 327 4e-88
AY190734_1(AY190734|pid:none) Pagrus major ribosomal protein L8 ... 326 6e-88
AY957563_1(AY957563|pid:none) Oncorhynchus mykiss ribosomal prot... 325 1e-87
FJ376460_1(FJ376460|pid:none) Spea hammondii ribosomal protein L... 324 3e-87
AM502250_442(AM502250|pid:none) Leishmania infantum chromosome 3... 323 4e-87
EU302533_1(EU302533|pid:none) Lineus viridis ribosomal protein r... 316 6e-85
AJ010592_61(AJ010592|pid:none) Guillardia theta DNA for complete... 313 4e-84
EF134338_1(EF134338|pid:none) Oxyrrhis marina isolate Om-5p-17 6... 308 2e-82
BT048773_1(BT048773|pid:none) Salmo salar clone ssal-eve-563-339... 307 3e-82
AB089487_1(AB089487|pid:none) Trichomonas vaginalis gene for rib... 293 5e-78
EZ000355_1(EZ000355|pid:none) TSA: Culex tarsalis Ctar-120 60S r... 288 1e-76
BT022891_1(BT022891|pid:none) Drosophila melanogaster IP12501 fu... 286 5e-76
CR954204_198(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 280 3e-74
U17360_1(U17360|pid:none) Saccharomyces cerevisiae ribosomal pro... 275 1e-72
DQ848874_1(DQ848874|pid:none) Scophthalmus maximus clone kbc113 ... 263 6e-69
AF526246_1(AF526246|pid:none) Chlamys farreri clone iolscfcl152c... 263 8e-69
AF156372_1(AF156372|pid:none) Nicotiana tabacum clone PR60 60S r... 259 8e-68
AY130436_1(AY130436|pid:none) Branchiostoma lanceolatum ribosoma... 259 8e-68
FN316334_1(FN316334|pid:none) Schistosoma japonicum isolate Anhu... 255 2e-66
AX886213_1(AX886213|pid:none) Sequence 2076 from Patent EP1033401. 247 4e-64
AY130438_1(AY130438|pid:none) Petromyzon marinus ribosomal prote... 245 2e-63
AY184410_1(AY184410|pid:none) Brassica juncea ribosomal protein ... 232 1e-59
AY130439_1(AY130439|pid:none) Scyliorhinus canicula ribosomal pr... 229 9e-59
EU004204_1(EU004204|pid:none) Squalus acanthias ribosomal protei... 227 5e-58
AK301073_1(AK301073|pid:none) Homo sapiens cDNA FLJ53750 complet... 224 2e-57
(O26113) RecName: Full=50S ribosomal protein L2P; &AE000666_5(A... 224 3e-57
(Q8U001) RecName: Full=50S ribosomal protein L2P; &AE009950_182... 223 7e-57
AM849512_1(AM849512|pid:none) Pomphorhynchus laevis partial mRNA... 222 1e-56
GM017008_91(GM017008|pid:none) Sequence 1838 from Patent EP19234... 222 1e-56
D64322(D64322)ribosomal protein L2 - Methanococcus jannaschii 221 3e-56
(A4FVX9) RecName: Full=50S ribosomal protein L2P; &CP000609_30(... 220 4e-56
(Q5JDH2) RecName: Full=50S ribosomal protein L2P; &AP006878_154... 220 6e-56
(Q8TY93) RecName: Full=50S ribosomal protein L2P; &AE009439_412... 219 7e-56
(A6VHD5) RecName: Full=50S ribosomal protein L2P; &CP000745_788... 219 1e-55
(Q6LX08) RecName: Full=50S ribosomal protein L2P; &BX950229_154... 219 1e-55
CP001398_2001(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 218 3e-55
(A6UV65) RecName: Full=50S ribosomal protein L2P; &CP000743_794... 215 1e-54
DQ865277_1(DQ865277|pid:none) Gambusia holbrooki ribosomal prote... 214 3e-54
EF589773_1(EF589773|pid:none) Salmo trutta ribosomal protein L8 ... 213 7e-54
(A5UL86) RecName: Full=50S ribosomal protein L2P; &CP000678_759... 212 1e-53
(B1L707) RecName: Full=50S ribosomal protein L2P; &CP000968_147... 211 3e-53
(Q46G98) RecName: Full=50S ribosomal protein L2P; &CP000099_100... 207 4e-52
CP001365_2415(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 207 5e-52
(Q18GF2) RecName: Full=50S ribosomal protein L2P; &AM180088_190... 207 5e-52
(Q9UXA5) RecName: Full=50S ribosomal protein L2P; &AE006641_649... 206 6e-52
DQ206473_1(DQ206473|pid:none) Platynereis dumerilii isolate TOA2... 206 1e-51
BT037364_1(BT037364|pid:none) Zea mays full-length cDNA clone ZM... 206 1e-51
(P20276) RecName: Full=50S ribosomal protein L2P; AltName: Full=... 206 1e-51
(A1RWQ7) RecName: Full=50S ribosomal protein L2P; &CP000505_227... 205 1e-51
(B6YSL6) RecName: Full=50S ribosomal protein L2P; &CP000855_70(... 205 1e-51
(A0B9W7) RecName: Full=50S ribosomal protein L2P; &CP000477_168... 204 2e-51
(Q3IMY5) RecName: Full=50S ribosomal protein L2P; &CR936257_241... 204 2e-51
DQ206502_1(DQ206502|pid:none) Priapulus caudatus isolate TOA23 r... 203 7e-51
DQ158856_58(DQ158856|pid:none) Bigelowiella natans nucleomorph c... 202 1e-50
(A3MS41) RecName: Full=50S ribosomal protein L2P; &CP000561_18(... 201 2e-50
AF091511_1(AF091511|pid:none) Mus musculus ribosomal protein L8 ... 200 5e-50
(Q4JB43) RecName: Full=50S ribosomal protein L2P; &CP000077_556... 199 8e-50
(A1RTI4) RecName: Full=50S ribosomal protein L2P; &CP000504_108... 199 1e-49
(Q0W1Y6) RecName: Full=50S ribosomal protein L2P; &AM114193_649... 197 3e-49
(A8ME99) RecName: Full=50S ribosomal protein L2P; &CP000852_125... 196 7e-49
AY714865_1(AY714865|pid:none) Uncultured archaeon GZfos35D7 clon... 196 7e-49
(Q8TRU4) RecName: Full=50S ribosomal protein L2P; &AE010299_104... 196 1e-48
BA000023_475(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 195 2e-48
(Q975I4) RecName: Full=50S ribosomal protein L2P; 195 2e-48
(Q12ZU8) RecName: Full=50S ribosomal protein L2P; &CP000300_4(C... 194 4e-48
AY652420_1(AY652420|pid:none) Dasyatis sabina ribosomal protein ... 190 5e-47
AY389975_1(AY389975|pid:none) Protopterus aethiopicus ribosomal ... 189 1e-46
(Q8SSM6) RecName: Full=60S ribosomal protein L8; &AL391737_28(A... 187 4e-46
(A2SPK6) RecName: Full=50S ribosomal protein L2P; &CP000559_84(... 186 9e-46
EU686616_17(EU686616|pid:none) Uncultured marine group II euryar... 184 3e-45
EU686634_14(EU686634|pid:none) Uncultured marine group II euryar... 181 2e-44
EU686610_13(EU686610|pid:none) Uncultured marine group II euryar... 179 8e-44
BT047597_1(BT047597|pid:none) Salmo salar clone ssal-evd-509-184... 177 5e-43
EU686639_4(EU686639|pid:none) Uncultured marine group II euryarc... 176 7e-43
BX545856_5(BX545856|pid:none) Zebrafish DNA sequence from clone ... 173 6e-42
(A3CT00) RecName: Full=50S ribosomal protein L2P; &CP000562_565... 172 1e-41
(A7I5P2) RecName: Full=50S ribosomal protein L2P; &CP000780_529... 172 2e-41
EU116850_1(EU116850|pid:none) Sipunculus nudus putative ribosoma... 170 7e-41
(O15574) RecName: Full=60S ribosomal protein L8; AltName: Full=6... 160 4e-38
AJ563478_1(AJ563478|pid:none) Crassostrea gigas partial mRNA for... 160 7e-38
(Q97BX4) RecName: Full=50S ribosomal protein L2P; &BA000011_331... 159 9e-38
EF576030_1(EF576030|pid:none) Oryza sativa (indica cultivar-grou... 155 1e-36
(Q6L1C4) RecName: Full=50S ribosomal protein L2P; &AE017261_643... 146 1e-33
AF481057_1(AF481057|pid:none) Aplysia californica ribosomal prot... 139 2e-31
EU116895_1(EU116895|pid:none) Barentsia benedeni putative riboso... 132 2e-29
CP000908_2131(CP000908|pid:none) Methylobacterium extorquens PA1... 123 7e-27
CP001510_1978(CP001510|pid:none) Methylobacterium extorquens AM1... 122 1e-26
AP009608_819(AP009608|pid:none) Mycoplasma fermentans PG18 DNA, ... 121 3e-26
CP001349_1848(CP001349|pid:none) Methylobacterium nodulans ORS 2... 121 4e-26
CP001001_2189(CP001001|pid:none) Methylobacterium radiotolerans ... 118 2e-25
CU179680_545(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 117 7e-25
(Q4A8H4) RecName: Full=50S ribosomal protein L2; &(Q601L2) RecN... 115 2e-24
AF440009_1(AF440009|pid:none) Talaromyces emersonii 60S ribosoma... 115 3e-24
(Q057A7) RecName: Full=50S ribosomal protein L2; &AY744382_27(A... 114 6e-24
(A7MWI6) RecName: Full=50S ribosomal protein L2; &CP000789_673(... 114 6e-24
(Q72NG4) RecName: Full=50S ribosomal protein L2; &(Q9XD33) RecN... 114 6e-24
(P55835) RecName: Full=50S ribosomal protein L2; &D64071_4(D640... 113 7e-24
(Q4AAE3) RecName: Full=50S ribosomal protein L2; &AE017243_189(... 113 7e-24
(A9H3Q5) RecName: Full=50S ribosomal protein L2; &AM889285_3401... 113 7e-24
BT069420_1(BT069420|pid:none) Zea mays full-length cDNA clone ZM... 113 1e-23
(Q2NQM5) RecName: Full=50S ribosomal protein L2; &AP008232_2275... 113 1e-23
(Q3SSW3) RecName: Full=50S ribosomal protein L2; &CP000115_1360... 113 1e-23
AF115283_8(AF115283|pid:none) Leptospira interrogans S10-spc-alp... 113 1e-23
(Q87T10) RecName: Full=50S ribosomal protein L2; &BA000031_260(... 112 1e-23
CP000993_454(CP000993|pid:none) Borrelia recurrentis A1, complet... 112 1e-23
(Q28UV7) RecName: Full=50S ribosomal protein L2; &CP000264_588(... 112 1e-23
DQ508200_1(DQ508200|pid:none) Candidatus Arsenophonus triatomina... 112 1e-23
(Q1QN27) RecName: Full=50S ribosomal protein L2; &CP000319_1468... 112 1e-23
CP000976_465(CP000976|pid:none) Borrelia duttonii Ly, complete g... 112 1e-23
(B3CN29) RecName: Full=50S ribosomal protein L2; &AM999887_1168... 112 1e-23
(P57588) RecName: Full=50S ribosomal protein L2; &BA000003_486(... 112 2e-23
(Q7MYF4) RecName: Full=50S ribosomal protein L2; &BX571874_264(... 112 2e-23
(Q98PY4) RecName: Full=50S ribosomal protein L2; &A99585(A99585... 112 2e-23
CP001047_328(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ... 112 2e-23
(Q6G2W8) RecName: Full=50S ribosomal protein L2; &BX897699_1021... 111 3e-23
CP001391_426(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 111 3e-23
AF426457_1(AF426457|pid:none) Sodalis glossinidius ribosomal pro... 111 3e-23
(A9MN51) RecName: Full=50S ribosomal protein L2; &(A9MSZ5) RecN... 111 3e-23
EF082153_1(EF082153|pid:none) Picea sitchensis clone WS0285_P04 ... 111 4e-23
(O62940) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 111 4e-23
(Q73H89) RecName: Full=50S ribosomal protein L2; &AE017196_607(... 111 4e-23
(Q2YM06) RecName: Full=50S ribosomal protein L2; &(Q57CR1) RecN... 111 4e-23
(A9M5P7) RecName: Full=50S ribosomal protein L2; &(B0CH29) RecN... 111 4e-23
(Q89A71) RecName: Full=50S ribosomal protein L2; &AE016826_426(... 111 4e-23
(Q4A5C4) RecName: Full=50S ribosomal protein L2; &AE017245_634(... 111 4e-23
(Q1LTD5) RecName: Full=50S ribosomal protein L2; &CP000238_300(... 111 4e-23
(A9BHA2) RecName: Full=50S ribosomal protein L2; &CP000879_762(... 111 4e-23
(Q85WS5) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 111 4e-23
(A4TGZ5) RecName: Full=50S ribosomal protein L2; &(A7FNN2) RecN... 110 5e-23
CP000783_8(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-89... 110 5e-23
(Q6FZC5) RecName: Full=50S ribosomal protein L2; &BX897700_795(... 110 5e-23
(Q32B34) RecName: Full=50S ribosomal protein L2; &CP000034_3236... 110 5e-23
(A5CCK9) RecName: Full=50S ribosomal protein L2; &AM494475_373(... 110 5e-23
(Q0BUP7) RecName: Full=50S ribosomal protein L2; 110 5e-23
AF481103_20(AF481103|pid:none) Candidatus Tremblaya princeps tra... 110 6e-23
(A8IAR8) RecName: Full=50S ribosomal protein L2; &AP009384_2551... 110 6e-23
(A5ELM4) RecName: Full=50S ribosomal protein L2; &CP000494_4763... 110 6e-23
(A3N361) RecName: Full=50S ribosomal protein L2; &CP000569_1739... 110 6e-23
(Q9CL35) RecName: Full=50S ribosomal protein L2; &AE004439_1412... 110 8e-23
FM864216_127(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T... 110 8e-23
AF426458_1(AF426458|pid:none) Primary endosymbiont of Sitophilus... 110 8e-23
(A1JS34) RecName: Full=50S ribosomal protein L2; &(P49239) RecN... 110 8e-23
(Q5LW59) RecName: Full=50S ribosomal protein L2; &CP000031_473(... 110 8e-23
(Q1GK31) RecName: Full=50S ribosomal protein L2; &CP000377_252(... 110 8e-23
(A4WFC5) RecName: Full=50S ribosomal protein L2; &CP000653_3715... 109 1e-22
(B0UX16) RecName: Full=50S ribosomal protein L2; &CP000947_1914... 109 1e-22
(Q2RFQ0) RecName: Full=50S ribosomal protein L2; &CP000232_2397... 109 1e-22
(Q16AE8) RecName: Full=50S ribosomal protein L2; &CP000362_1308... 109 1e-22
(A6X0C1) RecName: Full=50S ribosomal protein L2; &CP000758_1943... 109 1e-22
(A4YSJ5) RecName: Full=50S ribosomal protein L2; &CU234118_2898... 109 1e-22
(Q493K5) RecName: Full=50S ribosomal protein L2; &CP000016_186(... 109 1e-22
(Q211F1) RecName: Full=50S ribosomal protein L2; &CP000301_3406... 109 1e-22
FJ899578_52(FJ899578|pid:none) Larix occidentalis chloroplast, p... 109 1e-22
(Q8R7V7) RecName: Full=50S ribosomal protein L2; &AE008691_2115... 109 1e-22
(B6YQ82) RecName: Full=50S ribosomal protein L2; &AP010656_91(A... 109 1e-22
(Q8ETX9) RecName: Full=50S ribosomal protein L2; &BA000028_122(... 109 1e-22
(Q8YHN7) RecName: Full=50S ribosomal protein L2; &AB3347(AB3347... 108 2e-22
(A1USL7) RecName: Full=50S ribosomal protein L2; &CP000524_631(... 108 2e-22
(O62954) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 108 2e-22
CP001074_1724(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 108 2e-22
AM942759_3228(AM942759|pid:none) Proteus mirabilis strain HI4320... 108 2e-22
CU468135_3160(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 108 2e-22
(Q5GSU7) RecName: Full=50S ribosomal protein L2; &AE017321_335(... 108 2e-22
(Q9A8V0) RecName: Full=50S ribosomal protein L2; &AE005673_1244... 108 3e-22
(A6KYJ2) RecName: Full=50S ribosomal protein L2; &CP000139_776(... 108 3e-22
AP010820_72(AP010820|pid:none) Keteleeria davidiana chloroplast ... 108 3e-22
(Q3YRL2) RecName: Full=50S ribosomal protein L2; &CP000107_592(... 108 3e-22
CP000916_996(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 108 3e-22
(Q5L8B2) RecName: Full=50S ribosomal protein L2; &(Q64NL1) RecN... 108 3e-22
AY664861_1(AY664861|pid:none) Pseudotsuga menziesii ribosomal pr... 108 3e-22
CP001600_3457(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 107 4e-22
EU754885_1(EU754885|pid:none) Staphylococcus aureus strain Cowan... 107 4e-22
(Q0ANQ3) RecName: Full=50S ribosomal protein L2; &CP000449_1788... 107 4e-22
EU998742_52(EU998742|pid:none) Pinus krempfii chloroplast, compl... 107 4e-22
(A5UDU4) RecName: Full=50S ribosomal protein L2; &(A5UHT3) RecN... 107 4e-22
(A5IV31) RecName: Full=50S ribosomal protein L2; &(A6QJ89) RecN... 107 4e-22
(A6TWH9) RecName: Full=50S ribosomal protein L2; &CP000724_4304... 107 5e-22
(B6EPS8) RecName: Full=50S ribosomal protein L2; &FM178379_323(... 107 5e-22
CP001102_176(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 107 5e-22
Z21677_5(Z21677|pid:none) Thermotoga maritima DNA for spc operon. 107 7e-22
EU998741_52(EU998741|pid:none) Pinus gerardiana chloroplast, com... 107 7e-22
CP000581_424(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 107 7e-22
FJ899570_49(FJ899570|pid:none) Pinus ayacahuite chloroplast, par... 107 7e-22
(P38510) RecName: Full=50S ribosomal protein L2; &A72250(A72250... 107 7e-22
CP001098_118(CP001098|pid:none) Halothermothrix orenii H 168, co... 107 7e-22
(Q1GPA2) RecName: Full=50S ribosomal protein L2; &CP000356_2794... 106 9e-22
AY372455_3(AY372455|pid:none) Uncultured marine alpha proteobact... 106 9e-22
(Q9TJQ5) RecName: Full=50S ribosomal protein L2, plastid; &AJ24... 106 9e-22
(Q11QB5) RecName: Full=50S ribosomal protein L2; &CP000383_3107... 106 9e-22
CP001280_564(CP001280|pid:none) Methylocella silvestris BL2, com... 106 9e-22
(B5Y985) RecName: Full=50S ribosomal protein L2; &CP001145_960(... 106 9e-22
(A8GPE7) RecName: Full=50S ribosomal protein L2; &CP000847_935(... 106 9e-22
(B7IHU9) RecName: Full=50S ribosomal protein L2; &CP001185_1188... 106 9e-22
(Q2LQ98) RecName: Full=50S ribosomal protein L2; &CP000252_304(... 106 1e-21
FJ899555_53(FJ899555|pid:none) Pinus ponderosa chloroplast, part... 106 1e-21
(Q8K953) RecName: Full=50S ribosomal protein L2; &AE013218_473(... 106 1e-21
CP001562_1162(CP001562|pid:none) Bartonella grahamii as4aup, com... 106 1e-21
(Q9ZCQ8) RecName: Full=50S ribosomal protein L2; &AJ235272_163(... 106 1e-21
(Q2RQW3) RecName: Full=50S ribosomal protein L2; &CP000230_2677... 106 1e-21
(Q8WHY1) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 105 2e-21
(B0C1D6) RecName: Full=50S ribosomal protein L2; &CP000828_4584... 105 2e-21
(Q6KI52) RecName: Full=50S ribosomal protein L2; &AE017308_238(... 105 2e-21
AM946015_69(AM946015|pid:none) Streptococcus uberis 0140J comple... 105 2e-21
CP001337_2928(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 105 2e-21
(A6U862) RecName: Full=50S ribosomal protein L2; &(Q92QG7) RecN... 105 2e-21
(Q7MTL6) RecName: Full=50S ribosomal protein L2; &AE015924_1658... 105 2e-21
(A5FZW2) RecName: Full=50S ribosomal protein L2; &CP000697_1915... 105 2e-21
(Q98N54) RecName: Full=50S ribosomal protein L2; &BA000012_228(... 105 2e-21
(Q4UMS6) RecName: Full=50S ribosomal protein L2; &CP000053_281(... 105 3e-21
(Q9CDW5) RecName: Full=50S ribosomal protein L2; &AE005176_2096... 105 3e-21
(Q8D209) RecName: Full=50S ribosomal protein L2; &BA000021_546(... 105 3e-21
(Q07KM1) RecName: Full=50S ribosomal protein L2; &CP000463_3552... 105 3e-21
(B8FET2) RecName: Full=50S ribosomal protein L2; &CP001322_1899... 105 3e-21
(Q3A6P4) RecName: Full=50S ribosomal protein L2; &CP000142_778(... 104 3e-21
CP001389_1172(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 104 3e-21
(A9WH69) RecName: Full=50S ribosomal protein L2; &CP000909_2323... 104 3e-21
(Q68W81) RecName: Full=50S ribosomal protein L2; &AE017197_621(... 104 3e-21
(A6LEI8) RecName: Full=50S ribosomal protein L2; &CP000140_2307... 104 3e-21
(B5ZYT8) RecName: Full=50S ribosomal protein L2; &(Q1MID8) RecN... 104 3e-21
(A8AZM2) RecName: Full=50S ribosomal protein L2; &CP000725_1910... 104 3e-21
(Q110B0) RecName: Full=50S ribosomal protein L2; &CP000393_2634... 104 3e-21
CP001227_762(CP001227|pid:none) Rickettsia peacockii str. Rustic... 104 3e-21
(B0T2C5) RecName: Full=50S ribosomal protein L2; &CP000927_1608... 104 4e-21
(Q661D9) RecName: Full=50S ribosomal protein L2; &CP000013_473(... 104 4e-21
FJ899559_50(FJ899559|pid:none) Pinus squamata chloroplast, parti... 104 4e-21
(Q5PA61) RecName: Full=50S ribosomal protein L2; &CP000030_630(... 104 4e-21
(Q2JIM4) RecName: Full=50S ribosomal protein L2; &CP000240_2529... 104 4e-21
(A6LLL6) RecName: Full=50S ribosomal protein L2; &CP000716_935(... 104 4e-21
(Q3J8R7) RecName: Full=50S ribosomal protein L2; &CP000127_2225... 104 4e-21
FJ899567_53(FJ899567|pid:none) Pinus aristata chloroplast, parti... 104 4e-21
CP000915_1228(CP000915|pid:none) Francisella tularensis subsp. m... 104 4e-21
CP000607_242(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 103 6e-21
AY774952_1(AY774952|pid:none) Synthetic construct Francisella tu... 103 6e-21
(A5VLK2) RecName: Full=50S ribosomal protein L2; &(B2G8X5) RecN... 103 6e-21
(A0Q4I6) RecName: Full=50S ribosomal protein L2; &(A4IZT1) RecN... 103 6e-21
(Q8UE21) RecName: Full=50S ribosomal protein L2; &AE007869_1902... 103 6e-21
(P60401) RecName: Full=50S ribosomal protein L2; &AE017180_2837... 103 6e-21
(A1BJ31) RecName: Full=50S ribosomal protein L2; 103 6e-21
CP000492_2331(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 103 6e-21
U78193_6(U78193|pid:none) Borrelia burgdorferi tuf-s10 operon: e... 103 8e-21
(Q0ABH2) RecName: Full=50S ribosomal protein L2; &CP000453_456(... 103 8e-21
(B7J246) RecName: Full=50S ribosomal protein L2; &(P94270) RecN... 103 8e-21
CP001083_3619(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 103 8e-21
(B1IGF1) RecName: Full=50S ribosomal protein L2; &CP000939_3492... 103 8e-21
(Q4L8B1) RecName: Full=50S ribosomal protein L2; &AP006716_805(... 103 8e-21
CT573071_727(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 103 1e-20
CP001110_266(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 103 1e-20
(Q49ZG5) RecName: Full=50S ribosomal protein L2; &AP008934_666(... 103 1e-20
(Q15YN6) RecName: Full=50S ribosomal protein L2; &CP000388_469(... 103 1e-20
(A1WVB9) RecName: Full=50S ribosomal protein L2; &CP000544_836(... 103 1e-20
(Q5HM02) RecName: Full=50S ribosomal protein L2; &(Q8CRG3) RecN... 103 1e-20
CP000860_220(CP000860|pid:none) Candidatus Desulforudis audaxvia... 103 1e-20
(B0U0Y6) RecName: Full=50S ribosomal protein L2; &CP000937_579(... 103 1e-20
(Q83FY9) RecName: Full=50S ribosomal protein L2; &(Q83I75) RecN... 103 1e-20
AP010819_59(AP010819|pid:none) Ephedra equisetina chloroplast DN... 103 1e-20
(B0JI00) RecName: Full=50S ribosomal protein L2; &AP009552_5739... 103 1e-20
(B3QBX7) RecName: Full=50S ribosomal protein L2; &(P60403) RecN... 103 1e-20
(A5I7K3) RecName: Full=50S ribosomal protein L2; &(A7FZ66) RecN... 103 1e-20
(Q38UR5) RecName: Full=50S ribosomal protein L2; &CR936503_1763... 103 1e-20
(A5F546) RecName: Full=50S ribosomal protein L2; &(Q9KNY7) RecN... 103 1e-20
(A1S221) RecName: Full=50S ribosomal protein L2; &CP000507_215(... 103 1e-20
(A9M3W3) RecName: Full=50S ribosomal protein L2; &CP000381_1908... 102 1e-20
(A7Y3J3) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 102 1e-20
(Q1WS93) RecName: Full=50S ribosomal protein L2; &CP000233_1413... 102 1e-20
(Q74L86) RecName: Full=50S ribosomal protein L2; &AE017198_348(... 102 1e-20
(Q04MN3) RecName: Full=50S ribosomal protein L2; &(Q8CWV5) RecN... 102 2e-20
(Q5SD13) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 102 2e-20
(Q3IF22) RecName: Full=50S ribosomal protein L2; &CR954246_137(... 102 2e-20
(A7ZG09) RecName: Full=50S ribosomal protein L2; &CP000792_1882... 102 2e-20
CP001108_2005(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 102 2e-20
(P60402) RecName: Full=50S ribosomal protein L2; &AP006628_203(... 102 2e-20
(Q046C2) RecName: Full=50S ribosomal protein L2; &CP000413_283(... 102 2e-20
(Q5QXY0) RecName: Full=50S ribosomal protein L2; &AE017340_1909... 102 2e-20
AE015927_2339(AE015927|pid:none) Clostridium tetani E88, complet... 102 2e-20
(Q0BYB7) RecName: Full=50S ribosomal protein L2; &CP000158_2792... 102 2e-20
(A1KRH6) RecName: Full=50S ribosomal protein L2; &(Q9JX12) RecN... 102 2e-20
(Q1D772) RecName: Full=50S ribosomal protein L2; &CP000113_3215... 102 2e-20
AY596752_1(AY596752|pid:none) Hildebrandtia valo ribosomal prote... 102 2e-20
(A0LIJ3) RecName: Full=50S ribosomal protein L2; &CP000478_1541... 102 2e-20
(O21247) RecName: Full=60S ribosomal protein L2, mitochondrial; ... 102 2e-20
CP000975_681(CP000975|pid:none) Methylacidiphilum infernorum V4,... 102 2e-20
(Q2N9B4) RecName: Full=50S ribosomal protein L2; &CP000157_1635... 102 2e-20
(Q06FM3) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 101 3e-20
AY596753_1(AY596753|pid:none) Seddera hirsuta ribosomal protein ... 101 3e-20
AP009568_21(AP009568|pid:none) Welwitschia mirabilis chloroplast... 101 3e-20
(Q1ACF6) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 101 3e-20
(Q8FS77) RecName: Full=50S ribosomal protein L2; &BA000035_525(... 101 3e-20
(Q03IF4) RecName: Full=50S ribosomal protein L2; &(Q5LXR4) RecN... 101 3e-20
(A9KJJ1) RecName: Full=50S ribosomal protein L2; &CP000885_3620... 101 3e-20
EU016823_1(EU016823|pid:none) Cycas micronesica ribosomal protei... 101 3e-20
AM295250_1723(AM295250|pid:none) Staphylococcus carnosus subsp. ... 101 3e-20
(A6H5M3) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 101 3e-20
(Q5F5T0) RecName: Full=50S ribosomal protein L2; &AE004969_1684... 101 3e-20
CP001129_55(CP001129|pid:none) Streptococcus equi subsp. zooepid... 101 4e-20
CP000875_4896(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 101 4e-20
FJ899565_40(FJ899565|pid:none) Abies firma chloroplast, partial ... 101 4e-20
FJ597983_64(FJ597983|pid:none) Megaleranthis saniculifolia chlor... 101 4e-20
CP001020_389(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 101 4e-20
CP000951_1046(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 101 4e-20
CP001392_271(CP001392|pid:none) Diaphorobacter sp. TPSY, complet... 101 4e-20
(Q32RV7) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 101 4e-20
(B1AIM3) RecName: Full=50S ribosomal protein L2; &(Q9PQQ7) RecN... 101 4e-20
(Q88XY3) RecName: Full=50S ribosomal protein L2; &AL935254_248(... 101 4e-20
(Q11HQ5) RecName: Full=50S ribosomal protein L2; &CP000390_1665... 101 4e-20
CP001056_211(CP001056|pid:none) Clostridium botulinum B str. Ekl... 101 4e-20
(Q0VSK0) RecName: Full=50S ribosomal protein L2; &AM286690_400(... 101 4e-20
CU469464_344(CU469464|pid:none) Candidatus Phytoplasma mali stra... 101 4e-20
FJ899557_52(FJ899557|pid:none) Pinus rzedowskii chloroplast, par... 101 4e-20
(A1W2R0) RecName: Full=50S ribosomal protein L2; &CP000539_279(... 101 4e-20
FJ899577_49(FJ899577|pid:none) Pinus lambertiana chloroplast, pa... 101 4e-20
AF469725_1(AF469725|pid:none) Cycas revoluta ribosomal protein L... 100 5e-20
CP000820_5921(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 100 5e-20
AY664863_1(AY664863|pid:none) Saxegothaea conspicua ribosomal pr... 100 5e-20
AP008955_224(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 100 5e-20
CP000884_393(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 100 5e-20
(Q9Z9L1) RecName: Full=50S ribosomal protein L2; &AB017508_12(A... 100 5e-20
FJ899558_39(FJ899558|pid:none) Pinus sibirica chloroplast, parti... 100 5e-20
(A1VIQ3) RecName: Full=50S ribosomal protein L2; &CP000529_204(... 100 5e-20
(Q09FP6) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 100 5e-20
(Q839G1) RecName: Full=50S ribosomal protein L2; &AE016830_193(... 100 5e-20
CP001052_3578(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 100 5e-20
(Q2JV84) RecName: Full=50S ribosomal protein L2; &CP000239_1121... 100 5e-20
(Q2SU30) RecName: Full=50S ribosomal protein L2; &CP000086_3009... 100 6e-20
(Q2GED6) RecName: Full=50S ribosomal protein L2; &CP000237_257(... 100 6e-20
(Q13TH3) RecName: Full=50S ribosomal protein L2; &CP000270_4078... 100 6e-20
CP000934_687(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 100 6e-20
(A2RNQ2) RecName: Full=50S ribosomal protein L2; &(Q02W27) RecN... 100 6e-20
(A4JAP3) RecName: Full=50S ribosomal protein L2; &CP000614_318(... 100 6e-20
CP001344_1079(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 100 6e-20
CP001229_1707(CP001229|pid:none) Sulfurihydrogenibium azorense A... 100 8e-20
CP001037_3957(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 100 8e-20
CP001124_924(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 100 8e-20
AF469730_1(AF469730|pid:none) Stangeria eriopus ribosomal protei... 100 8e-20
(A5WCJ3) RecName: Full=50S ribosomal protein L2; &CP000713_424(... 100 8e-20
(A7M9A4) RecName: Full=50S ribosomal protein L2, plastid; &AM71... 100 1e-19
(B0RZU3) RecName: Full=50S ribosomal protein L2; &AP008971_158(... 100 1e-19
(A1TYK0) RecName: Full=50S ribosomal protein L2; &CP000514_711(... 100 1e-19
(A3M980) RecName: Full=50S ribosomal protein L2; &(B7GW05) RecN... 100 1e-19
AY596756_1(AY596756|pid:none) Wilsonia backhousei ribosomal prot... 100 1e-19
FM204883_56(FM204883|pid:none) Streptococcus equi subsp. equi 40... 100 1e-19
EF207457_1(EF207457|pid:none) Saxifraga stolonifera inverted rep... 100 1e-19
AY596765_1(AY596765|pid:none) Maripa repens ribosomal protein L2... 100 1e-19
(Q2MI59) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 1e-19
AY596746_1(AY596746|pid:none) Merremia vitifolia ribosomal prote... 99 1e-19
(Q589A7) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 1e-19
(Q49KT4) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 1e-19
(A6Q1I1) RecName: Full=50S ribosomal protein L2; &AP009178_226(... 99 1e-19
(A7H108) RecName: Full=50S ribosomal protein L2; &CP000767_1846... 99 1e-19
(Q6MSM8) RecName: Full=50S ribosomal protein L2; &BX293980_707(... 99 1e-19
(A3Q985) RecName: Full=50S ribosomal protein L2; &CP000606_160(... 99 1e-19
(A6GZ96) RecName: Full=50S ribosomal protein L2; &AM398681_1300... 99 1e-19
CP001339_2296(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 99 1e-19
AY596755_1(AY596755|pid:none) Stylisma patens ribosomal protein ... 99 1e-19
(B7HJ51) RecName: Full=50S ribosomal protein L2; &(B7IT22) RecN... 99 1e-19
(Q6LVB3) RecName: Full=50S ribosomal protein L2; &CR378663_307(... 99 2e-19
AY596759_1(AY596759|pid:none) Bonamia media ribosomal protein L2... 99 2e-19
CP001616_102(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 99 2e-19
(A2T375) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 2e-19
(P73317) RecName: Full=50S ribosomal protein L2; &BA000022_768(... 99 2e-19
(A8W3G2) RecName: Full=50S ribosomal protein L2, plastid; &EU18... 99 2e-19
(A1VEB3) RecName: Full=50S ribosomal protein L2; &(Q72CH7) RecN... 99 2e-19
CP000227_112(CP000227|pid:none) Bacillus cereus Q1, complete gen... 99 2e-19
CP001281_3163(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 99 2e-19
CP001131_1921(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 99 2e-19
FJ899564_45(FJ899564|pid:none) Pinus torreyana subsp. torreyana ... 99 2e-19
(Q85FI1) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 2e-19
CP001104_292(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 99 2e-19
(Q03ZP2) RecName: Full=50S ribosomal protein L2; &CP000414_158(... 99 2e-19
(Q2IJ88) RecName: Full=50S ribosomal protein L2; &CP000251_1936... 99 2e-19
(Q85B65) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 2e-19
DQ493868_1(DQ493868|pid:none) Ostrinia furnacalis ribosomal prot... 99 2e-19
(B5YDU6) RecName: Full=50S ribosomal protein L2; &CP001146_817(... 99 2e-19
(A6LPR4) RecName: Full=50S ribosomal protein L2; &CP000721_154(... 99 2e-19
AY664867_1(AY664867|pid:none) Taxus brevifolia ribosomal protein... 99 2e-19
(B8CND6) RecName: Full=50S ribosomal protein L2; &CP000472_1921... 99 2e-19
(Q1XDH7) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 2e-19
(A8G1E5) RecName: Full=50S ribosomal protein L2; &CP000821_4305... 99 2e-19
(Q6EVY5) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 99 2e-19
AY007497_1(AY007497|pid:none) Sagittaria latifolia ribosomal pro... 99 2e-19
(Q250M9) RecName: Full=50S ribosomal protein L2; &AP008230_474(... 99 2e-19
AY596754_1(AY596754|pid:none) Evolvulus glomeratus ribosomal pro... 98 3e-19
EU849487_63(EU849487|pid:none) Trifolium subterraneum chloroplas... 98 3e-19
(A0QL15) RecName: Full=50S ribosomal protein L2; &CP000479_4300... 98 3e-19
(Q2JFH3) RecName: Full=50S ribosomal protein L2; &CP000249_574(... 98 3e-19
AY007498_1(AY007498|pid:none) Schisandra chinensis ribosomal pro... 98 3e-19
(Q50264) RecName: Full=50S ribosomal protein L2; &M74770_2(M747... 98 3e-19
CP001087_3565(CP001087|pid:none) Desulfobacterium autotrophicum ... 98 3e-19
(B1NWJ1) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 98 3e-19
(Q034Y6) RecName: Full=50S ribosomal protein L2; &CP000423_2370... 98 3e-19
(A0JZ81) RecName: Full=50S ribosomal protein L2; &CP000454_2950... 98 3e-19
(A4ST03) RecName: Full=50S ribosomal protein L2; &CP000644_3808... 98 3e-19
(Q5FM87) RecName: Full=50S ribosomal protein L2; &CP000033_279(... 98 3e-19
(Q6ACZ8) RecName: Full=50S ribosomal protein L2; &AE016822_1638... 98 3e-19
(A0KF24) RecName: Full=50S ribosomal protein L2; &CP000462_293(... 98 3e-19
CP001503_251(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 98 4e-19
AY811355_1(AY811355|pid:none) Schistosoma japonicum SJCHGC07017 ... 98 4e-19
(A1XFZ7) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 98 4e-19
CP001277_1678(CP001277|pid:none) Candidatus Hamiltonella defensa... 98 4e-19
CP001032_222(CP001032|pid:none) Opitutus terrae PB90-1, complete... 98 4e-19
(Q06R66) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 98 4e-19
AY147692_1(AY147692|pid:none) Anticlea elegans ribosomal protein... 98 4e-19
CP001614_799(CP001614|pid:none) Teredinibacter turnerae T7901, c... 98 4e-19
(P34768) RecName: Full=50S ribosomal protein L2, plastid; &AJ29... 98 4e-19
(A0ALW5) RecName: Full=50S ribosomal protein L2; &AM263198_2579... 98 4e-19
(Q31IX9) RecName: Full=50S ribosomal protein L2; &CP000109_297(... 98 4e-19
(A1R8U2) RecName: Full=50S ribosomal protein L2; &CP000474_2821... 98 4e-19
CP001175_2869(CP001175|pid:none) Listeria monocytogenes HCC23, c... 98 4e-19
(P17788) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 98 4e-19
DQ915186_1(DQ915186|pid:none) Trithuria submersa voucher J.G. Co... 98 4e-19
AB279615_1(AB279615|pid:none) Ostrinia scapulalis RPL8 mRNA for ... 98 4e-19
AY596769_1(AY596769|pid:none) Dinetus truncatus ribosomal protei... 98 4e-19
(O24692) RecName: Full=50S ribosomal protein L2; &AP008231_1868... 98 4e-19
(Q2EEV8) RecName: Full=50S ribosomal protein L2, plastid; &DQ39... 98 4e-19
AY596767_1(AY596767|pid:none) Erycibe glomerata ribosomal protei... 97 5e-19
CP001334_216(CP001334|pid:none) Micromonas sp. RCC299 chromosome... 97 5e-19
CP001618_3118(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 97 5e-19
(Q09MB2) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 97 5e-19
FJ899568_46(FJ899568|pid:none) Pinus armandii chloroplast, parti... 97 5e-19
EU549769_64(EU549769|pid:none) Guizotia abyssinica chloroplast, ... 97 5e-19
(B7K332) RecName: Full=50S ribosomal protein L2; &CP001287_245(... 97 5e-19
(Q2PMM3) RecName: Full=50S ribosomal protein L2-B, chloroplastic... 97 5e-19
(A0KRM7) RecName: Full=50S ribosomal protein L2; &(Q0HNT4) RecN... 97 5e-19
(A9VP80) RecName: Full=50S ribosomal protein L2; &CP000903_108(... 97 5e-19
EU922069_1(EU922069|pid:none) Erodium chrysanthum ribosomal prot... 97 5e-19
CP001341_2646(CP001341|pid:none) Arthrobacter chlorophenolicus A... 97 5e-19
(A0L5X6) RecName: Full=50S ribosomal protein L2; &CP000471_840(... 97 5e-19
AM285304_105(AM285304|pid:none) Spiroplasma citri GII3-3X chromo... 97 5e-19
(Q332R5) RecName: Full=50S ribosomal protein L2, chloroplastic; ... 97 5e-19
AY147688_1(AY147688|pid:none) Burmannia capitata ribosomal prote... 97 5e-19
(Q67JU6) RecName: Full=50S ribosomal protein L2; &AP006840_3069... 97 5e-19
>(P13023) RecName: Full=60S ribosomal protein L8; AltName: Full=60S
ribosomal protein L2; &AC116957_26(AC116957|pid:none)
Length = 255
Score = 521 bits (1343), Expect = e-147
Identities = 255/255 (100%), Positives = 255/255 (100%)
Frame = +2
Query: 26 MGRIIRAQRKGKAGSVFGAHTHHRKGTPRFRALDYAERQGYVKGVVKEIIHDPGRGAPLA 205
MGRIIRAQRKGKAGSVFGAHTHHRKGTPRFRALDYAERQGYVKGVVKEIIHDPGRGAPLA
Sbjct: 1 MGRIIRAQRKGKAGSVFGAHTHHRKGTPRFRALDYAERQGYVKGVVKEIIHDPGRGAPLA 60
Query: 206 RVVFKGLTQFKLDKQLFIAPEGMHTGQFVFAGKKATLTIGNILPIGKLPEGTIICNVEEK 385
RVVFKGLTQFKLDKQLFIAPEGMHTGQFVFAGKKATLTIGNILPIGKLPEGTIICNVEEK
Sbjct: 61 RVVFKGLTQFKLDKQLFIAPEGMHTGQFVFAGKKATLTIGNILPIGKLPEGTIICNVEEK 120
Query: 386 LGDCGAVARCSGNYATIVSHNPDEGVTRIKLPSGSKKNVSSLARAMIGIVAGGGRIDKPM 565
LGDCGAVARCSGNYATIVSHNPDEGVTRIKLPSGSKKNVSSLARAMIGIVAGGGRIDKPM
Sbjct: 121 LGDCGAVARCSGNYATIVSHNPDEGVTRIKLPSGSKKNVSSLARAMIGIVAGGGRIDKPM 180
Query: 566 LKAGRAFHKYRVKKNNWPKVRGVAMNPVEHPHGGGNHQHVGHATTTKRDDPAGKKVGLIA 745
LKAGRAFHKYRVKKNNWPKVRGVAMNPVEHPHGGGNHQHVGHATTTKRDDPAGKKVGLIA
Sbjct: 181 LKAGRAFHKYRVKKNNWPKVRGVAMNPVEHPHGGGNHQHVGHATTTKRDDPAGKKVGLIA 240
Query: 746 ARRTGRLRGTKNISE 790
ARRTGRLRGTKNISE
Sbjct: 241 ARRTGRLRGTKNISE 255
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,461,806,149
Number of extensions: 30733006
Number of successful extensions: 87599
Number of sequences better than 10.0: 946
Number of HSP's gapped: 86197
Number of HSP's successfully gapped: 949
Length of query: 292
Length of database: 1,051,180,864
Length adjustment: 127
Effective length of query: 165
Effective length of database: 640,137,871
Effective search space: 105622748715
Effective search space used: 105622748715
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
13 |
| VH (FL, L) |
2 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
5 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
7 |
| FC-IC (SUB) |
0 |