NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U02965-1
Contig ID Contig-U02965-1
Contig update 2001. 8.29
Contig sequence 
>Contig-U02965-1 (Contig-U02965-1Q) /CSM_Contig/Contig-U02965-1Q.Seq.d
AAAAAAAAAAAAAAAAAAAAAATGNNNNTTTTTTTTTTTTTAATTCCCCT
TTTTTTTTTTAAAAAAANTTTTTTNATTTTTTTAAGNAAAAAAAAGGAAA
AAAAAAGGAAAAANAAAAATNAAAAAAAAAAGCAAAATAAAATAAAAAAA
TAAAATAAAATAAACAACTGGAATTTTCAAAAGAAAAAGGTTTCAGCTTT
CCTTTTCTTTGGTTTAATCGCCTCTGTTACTATTTCTATGAAAATTGATG
TAAGAACACAAAGTGAACCAAATTTAGGAGATATTCCATTATGTTTGATC
TGTGACTTTGCTGTTGGTAAAATTGAAAAATATTTAGATGATAAAGCAAA
TACAACTGTTATCATTGACAAAGTTGAAAAGGATTGTAATATATTAAGAA
ATAGTTGGATTGGAAAATGTAAAAATATCGTTACTGAATATGGTCCAAAA
ATCATTGACCTTTTGGAAAGTAACGAATCACCAAAAGCAGTTTGTGCTAT
CATCGATTTATGTTAATACCATTAAACAGAATTGAAACATAAAAATAAAA
ATAAAAATAAAAATAAAAATAAAAATAAAAATAGATTAAAAAAAAAAA
Gap no gap
Contig length 598
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 3143581
End point 3144180
Strand (PLUS/MINUS) PLUS
Number of clones 4
Number of EST 5
Link to clone list U02965
List of clone(s) 

est1=AFL220Z,1,533
est2=SSF731E,157,596
est3=VSI182F,159,597
est4=VSI182Z,159,568
est5=SSJ550E,180,599
Translated Amino Acid sequence 
kkkkkkkmxxfffliplfffkkxfxiflxkkkekkrkxknxkkkqnkikk*NKINNWNFQ
KKKVSAFLFFGLIASVTISMKIDVRTQSEPNLGDIPLCLICDFAVGKIEKYLDDKANTTV
IIDKVEKDCNILRNSWIGKCKNIVTEYGPKIIDLLESNESPKAVCAIIDLC*yh*telkh
knknknknknknknrlkkk
Translated Amino Acid sequence (All Frames) 
Frame A:
kkkkkkkmxxfffliplfffkkxfxiflxkkkekkrkxknxkkkqnkikk*NKINNWNFQ
KKKVSAFLFFGLIASVTISMKIDVRTQSEPNLGDIPLCLICDFAVGKIEKYLDDKANTTV
IIDKVEKDCNILRNSWIGKCKNIVTEYGPKIIDLLESNESPKAVCAIIDLC*yh*telkh
knknknknknknknrlkkk


Frame B:
kkkkkkkxxffff*fpffflkkxfxff*xkkrkkkgkxkxkkkskik*knkik*ttgifk
rkrfqlsfslv*splllfl*klm*ehkvnqi*eifhyv*svtlllvklkni*mikqiqll
sltklkriviy*eivglenvkisllnmvqksltfwkvtnhqkqfvlssiyvntikqn*ni
kikikikikikikid*kkk


Frame C:
kkkkkknxxffffnspfff*kxffxffkxkkgkkkekxkxkkkak*nkkik*nkqlefsk
ekgfsfpflwfnrlcyyfyen*ckntk*tkfrrysimfdl*lccw*n*kifr**skyncy
h*qs*kgl*yikk*ldwkm*kyry*iwsknh*pfgk*ritksslcyhrfmliplnriet*
k*k*k*k*k*k*k*ikkk
own update 2004. 6. 9
Homology vs CSM-cDNA 
Query= Contig-U02965-1 (Contig-U02965-1Q)
/CSM_Contig/Contig-U02965-1Q.Seq.d
         (598 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U02965-1 (Contig-U02965-1Q) /CSM_Contig/Conti...   741  0.0
Contig-U09808-1 (Contig-U09808-1Q) /CSM_Contig/Conti...    40  0.003
Contig-U12529-1 (Contig-U12529-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U05105-1 (Contig-U05105-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U02852-1 (Contig-U02852-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U01562-1 (Contig-U01562-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U13836-1 (Contig-U13836-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U12546-1 (Contig-U12546-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U12483-1 (Contig-U12483-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U12241-1 (Contig-U12241-1Q) /CSM_Contig/Conti...    32  0.65

>Contig-U02965-1 (Contig-U02965-1Q) /CSM_Contig/Contig-U02965-1Q.Seq.d
          Length = 598

 Score =  741 bits (374), Expect = 0.0
 Identities = 374/374 (100%)
 Strand = Plus / Plus

                                                                       
Query: 165 caactggaattttcaaaagaaaaaggtttcagctttccttttctttggtttaatcgcctc 224
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 165 caactggaattttcaaaagaaaaaggtttcagctttccttttctttggtttaatcgcctc 224

                                                                       
Query: 225 tgttactatttctatgaaaattgatgtaagaacacaaagtgaaccaaatttaggagatat 284
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 225 tgttactatttctatgaaaattgatgtaagaacacaaagtgaaccaaatttaggagatat 284

                                                                       
Query: 285 tccattatgtttgatctgtgactttgctgttggtaaaattgaaaaatatttagatgataa 344
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 285 tccattatgtttgatctgtgactttgctgttggtaaaattgaaaaatatttagatgataa 344

                                                                       
Query: 345 agcaaatacaactgttatcattgacaaagttgaaaaggattgtaatatattaagaaatag 404
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 345 agcaaatacaactgttatcattgacaaagttgaaaaggattgtaatatattaagaaatag 404

                                                                       
Query: 405 ttggattggaaaatgtaaaaatatcgttactgaatatggtccaaaaatcattgacctttt 464
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 405 ttggattggaaaatgtaaaaatatcgttactgaatatggtccaaaaatcattgacctttt 464

                                                                       
Query: 465 ggaaagtaacgaatcaccaaaagcagtttgtgctatcatcgatttatgttaataccatta 524
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 465 ggaaagtaacgaatcaccaaaagcagtttgtgctatcatcgatttatgttaataccatta 524

                         
Query: 525 aacagaattgaaac 538
           ||||||||||||||
Sbjct: 525 aacagaattgaaac 538


>Contig-U09808-1 (Contig-U09808-1Q) /CSM_Contig/Contig-U09808-1Q.Seq.d
          Length = 492

 Score = 40.1 bits (20), Expect = 0.003
 Identities = 23/24 (95%)
 Strand = Plus / Plus

                                   
Query: 332 atttagatgataaagcaaatacaa 355
           ||||||| ||||||||||||||||
Sbjct: 245 atttagaggataaagcaaatacaa 268


>Contig-U12529-1 (Contig-U12529-1Q) /CSM_Contig/Contig-U12529-1Q.Seq.d
          Length = 1482

 Score = 34.2 bits (17), Expect = 0.16
 Identities = 17/17 (100%)
 Strand = Plus / Plus

                             
Query: 172  aattttcaaaagaaaaa 188
            |||||||||||||||||
Sbjct: 1130 aattttcaaaagaaaaa 1146


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5656
Number of Sequences: 6905
Number of extensions: 5656
Number of successful extensions: 598
Number of sequences better than 10.0: 54
length of query: 598
length of database: 5,674,871
effective HSP length: 16
effective length of query: 582
effective length of database: 5,564,391
effective search space: 3238475562
effective search space used: 3238475562
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 5.24
Homology vs DNA 
Query= Contig-U02965-1 (Contig-U02965-1Q) /CSM_Contig/Contig-U02965-1Q.Seq.d
         (598 letters)

Database: ddbj_A
           102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU268282) Dictyostelium discoideum vegetative cDNA clone:VS...   682   0.0    1
(AU268281) Dictyostelium discoideum vegetative cDNA clone:VS...   682   0.0    1
(C91000) Dictyostelium discoideum slug cDNA, clone SSJ550.        652   0.0    1
(C93065) Dictyostelium discoideum slug cDNA, clone SSF731.        603   e-168  1
(BJ345242) Dictyostelium discoideum cDNA clone:dda23g06, 3' ...   224   e-163  3
(AU073024) Dictyostelium discoideum slug cDNA, clone SSF731.      400   e-107  1
(EJ031222) 1095454047683 Global-Ocean-Sampling_GS-26-01-01-1...    38   0.68   2
(AC025716) Caenorhabditis elegans cosmid Y39G10AR, complete ...    34   0.83   2
(AC024766) Caenorhabditis elegans cosmid Y39G10AL, complete ...    34   0.91   2
(AC121828) Mus musculus BAC clone RP23-478K4 from chromosome...    46   1.5    1
(AC117221) Mus musculus BAC clone RP23-347F2 from 1, complet...    46   1.5    1
(AC212292) Pongo abelii BAC clone CH276-50K11 from chromosom...    46   1.5    1
(AC184533) Strongylocentrotus purpuratus clone R3-4017I19, W...    46   1.5    1
(AC174013) Strongylocentrotus purpuratus clone R3-3009B10, W...    46   1.5    1
(EJ094439) 1095460261191 Global-Ocean-Sampling_GS-26-01-01-1...    46   1.5    1
(GE415192) 294495736 Nasonia vitripennis Adult Male Nasonia ...    46   1.5    1
(AC124745) Mus musculus BAC clone RP23-236O12 from 14, compl...    42   1.7    2
(BH383847) AG-ND-150M10.TF ND-TAM Anopheles gambiae genomic ...    34   2.4    2
(BH369956) AG-ND-124D17.TF ND-TAM Anopheles gambiae genomic ...    34   2.4    2
(AC005724) Arabidopsis thaliana chromosome 2 clone MSF3 map ...    44   5.7    3
(CR812923) Zebrafish DNA sequence from clone DKEY-13G7 in li...    44   6.0    1
(BX649420) Zebrafish DNA sequence from clone CH211-139N7 in ...    44   6.0    1
(BX649243) Zebrafish DNA sequence from clone CH211-127E19 in...    44   6.0    1
(AC232578) Brassica rapa subsp. pekinensis clone KBrS013H10,...    44   6.0    1
(AL391804) Human DNA sequence from clone RP11-384H3 on chrom...    44   6.0    1
(AC079596) Homo sapiens 12 BAC RP11-632N20 (Roswell Park Can...    44   6.0    1
(AC118172) Rattus norvegicus clone CH230-424E2, WORKING DRAF...    44   6.0    1
(FI140910) MUGQ_CH252P294D16T7_CH0244_062 CHORI-252 Vervet M...    44   6.0    1
(FI140870) MUGQ_CH252P294B16T7_CH0244_064 CHORI-252 Vervet M...    44   6.0    1
(ER377776) 1093047005130 Global-Ocean-Sampling_GS-34-01-01-1...    44   6.0    1
(EK251607) 1095460282470 Global-Ocean-Sampling_GS-31-01-01-1...    44   6.0    1
(EJ363813) 1092963698087 Global-Ocean-Sampling_GS-28-01-01-1...    44   6.0    1
(EJ112527) 1092343160295 Global-Ocean-Sampling_GS-27-01-01-1...    44   6.0    1
(AL439146) T3 end of clone BD0AA002G05 of library BD0AA from...    44   6.0    1
(CU973437) Brassica napus GSS, clone JBnB004P07, end read, p...    44   6.0    1
(BX208112) Danio rerio genomic clone DKEY-222P6, genomic sur...    44   6.0    1
(CV978837) UMC-bemiv_0A01-008-g02 Pre-compaction morula in v...    44   6.0    1
(AC151994) Mus musculus BAC clone RP23-188B20 from 14, compl...    42   7.1    3
(AC016734) Homo sapiens BAC clone RP11-391A7 from 2, complet...    40   9.0    2

>(AU268282) Dictyostelium discoideum vegetative cDNA clone:VSI182,
           3' end single read.
          Length = 410

 Score =  682 bits (344), Expect = 0.0
 Identities = 344/344 (100%)
 Strand = Plus / Plus


Query: 195 agctttccttttctttggtttaatcgcctctgttactatttctatgaaaattgatgtaag 254
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 37  agctttccttttctttggtttaatcgcctctgttactatttctatgaaaattgatgtaag 96


Query: 255 aacacaaagtgaaccaaatttaggagatattccattatgtttgatctgtgactttgctgt 314
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 97  aacacaaagtgaaccaaatttaggagatattccattatgtttgatctgtgactttgctgt 156


Query: 315 tggtaaaattgaaaaatatttagatgataaagcaaatacaactgttatcattgacaaagt 374
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 157 tggtaaaattgaaaaatatttagatgataaagcaaatacaactgttatcattgacaaagt 216


Query: 375 tgaaaaggattgtaatatattaagaaatagttggattggaaaatgtaaaaatatcgttac 434
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 217 tgaaaaggattgtaatatattaagaaatagttggattggaaaatgtaaaaatatcgttac 276


Query: 435 tgaatatggtccaaaaatcattgaccttttggaaagtaacgaatcaccaaaagcagtttg 494
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 277 tgaatatggtccaaaaatcattgaccttttggaaagtaacgaatcaccaaaagcagtttg 336


Query: 495 tgctatcatcgatttatgttaataccattaaacagaattgaaac 538
           ||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 337 tgctatcatcgatttatgttaataccattaaacagaattgaaac 380

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 494,520,931
Number of extensions: 31058739
Number of successful extensions: 2697852
Number of sequences better than 10.0: 39
Length of query: 598
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 575
Effective length of database: 99,442,330,388
Effective search space: 57179339973100
Effective search space used: 57179339973100
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
protein update 2009. 7.21
Homology vs Protein 
Query= Contig-U02965-1 (Contig-U02965-1Q) /CSM_Contig/Contig-U02965-1Q.Seq.d
         (598 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR388420_1(CR388420|pid:none) Zebrafish DNA sequence from clone ...    72   1e-11
BC056717_1(BC056717|pid:none) Danio rerio prosaposin, mRNA (cDNA...    72   1e-11
AF276996_1(AF276996|pid:none) Danio rerio lysosomal cofactor/neu...    72   1e-11
BT045905_1(BT045905|pid:none) Salmo salar clone ssal-rgf-536-147...    67   3e-10
BT045327_1(BT045327|pid:none) Salmo salar clone ssal-rgf-518-210...    64   4e-09
BT058972_1(BT058972|pid:none) Salmo salar clone ssal-rgf-517-167...    64   4e-09
BC080997_1(BC080997|pid:none) Xenopus laevis MGC80725 protein, m...    63   5e-09
U66367_1(U66367|pid:none) Dictyostelium discoideum SapA (sapA) m...    63   7e-09
BC054988_1(BC054988|pid:none) Xenopus laevis hypothetical protei...    59   1e-07
CR855698_1(CR855698|pid:none) Xenopus tropicalis finished cDNA, ...    59   1e-07
AB209776_1(AB209776|pid:none) Homo sapiens mRNA for prosaposin v...    57   5e-07
AK223290_1(AK223290|pid:none) Homo sapiens mRNA for prosaposin (...    57   5e-07
CR861454_1(CR861454|pid:none) Pongo abelii mRNA; cDNA DKFZp459G1...    57   5e-07
M60258_1(M60258|pid:none) Human mutant cerebroside sulfate activ...    57   5e-07
AX704807_1(AX704807|pid:none) Sequence 39 from Patent WO03014151.      57   5e-07
AK299184_1(AK299184|pid:none) Homo sapiens cDNA FLJ54136 complet...    57   5e-07
(Q6IBQ6) RecName: Full=Proactivator polypeptide; Contains:   Rec...    57   5e-07
M60257_1(M60257|pid:none) Human mutant cerebroside sulfate activ...    57   5e-07
AY892719_1(AY892719|pid:none) Synthetic construct Homo sapiens c...    57   5e-07
AB170870_1(AB170870|pid:none) Macaca fascicularis brain cDNA clo...    56   7e-07
AB169527_1(AB169527|pid:none) Macaca fascicularis brain cDNA, cl...    56   7e-07
BC105409_1(BC105409|pid:none) Bos taurus prosaposin, mRNA (cDNA ...    56   7e-07
X57108_1(X57108|pid:none) Human gene for cerebroside sulfate act...    56   7e-07
CR861144_1(CR861144|pid:none) Pongo abelii mRNA; cDNA DKFZp459J1...    56   9e-07
S21770(S21770)saposin-C - bovine                                       55   1e-06
CR456746_1(CR456746|pid:none) Homo sapiens full open reading fra...    55   2e-06
AC115608_3(AC115608|pid:none) Dictyostelium discoideum chromosom...    54   3e-06
DQ071890_1(DQ071890|pid:none) Trichomonas vaginalis saposin-like...    54   4e-06
AK167073_1(AK167073|pid:none) Mus musculus blastocyst blastocyst...    52   1e-05
AF175768_1(AF175768|pid:none) Dictyostelium discoideum SAPLIP C ...    51   2e-05
AK159164_1(AK159164|pid:none) Mus musculus osteoclast-like cell ...    51   2e-05
(P10960) RecName: Full=Sulfated glycoprotein 1;          Short=S...    51   3e-05
BC061759_1(BC061759|pid:none) Rattus norvegicus prosaposin, mRNA...    51   3e-05
AK167719_1(AK167719|pid:none) Mus musculus 15 days pregnant adul...    50   5e-05
(Q61207) RecName: Full=Sulfated glycoprotein 1;          Short=S...    50   5e-05
DQ363441_1(DQ363441|pid:none) Ictalurus punctatus clone C111BF07...    50   5e-05
U57999_1(U57999|pid:none) Mus musculus prosaposin (psap\SGP-1) g...    50   5e-05
AK159722_1(AK159722|pid:none) Mus musculus osteoclast-like cell ...    50   5e-05
AK153404_1(AK153404|pid:none) Mus musculus bone marrow macrophag...    50   5e-05
AK088369_1(AK088369|pid:none) Mus musculus 2 days neonate thymus...    50   5e-05
AK149785_1(AK149785|pid:none) Mus musculus bone marrow macrophag...    50   5e-05
AK152280_1(AK152280|pid:none) Mus musculus bone marrow macrophag...    50   5e-05
AK167902_1(AK167902|pid:none) Mus musculus CRL-1722 L5178Y-R cDN...    50   5e-05
AY815893_1(AY815893|pid:none) Schistosoma japonicum SJCHGC01869 ...    50   6e-05
FN357292_36(FN357292|pid:none) Schistosoma mansoni genome sequen...    50   6e-05
(P20097) RecName: Full=Saposin-C; AltName: Full=Co-beta-glucosid...    49   1e-04
DQ062781_1(DQ062781|pid:none) Drosophila simulans saposin-relate...    49   1e-04
BC149798_1(BC149798|pid:none) Bos taurus prosaposin-like 1, mRNA...    48   2e-04
AF108656_1(AF108656|pid:none) Gallus gallus prosaposin mRNA, com...    48   2e-04
AK159634_1(AK159634|pid:none) Mus musculus osteoclast-like cell ...    48   2e-04
(O13035) RecName: Full=Proactivator polypeptide; Contains:   Rec...    48   2e-04
AB008449_1(AB008449|pid:none) Bombyx mori mRNA for BmP109, compl...    48   2e-04
AC116956_84(AC116956|pid:none) Dictyostelium discoideum chromoso...    47   3e-04
EF585930_1(EF585930|pid:none) Sonneratia ovata isolate Sonn529_3...    47   3e-04
AF162129_1(AF162129|pid:none) Drosophila melanogaster ecdysone d...    47   3e-04
S71616_1(S71616|pid:none) prosaposin [mice, mRNA, 2593 nt].            47   4e-04
AB170090_1(AB170090|pid:none) Macaca fascicularis brain cDNA clo...    47   5e-04
BC091483_1(BC091483|pid:none) Homo sapiens prosaposin, mRNA (cDN...    47   5e-04
DQ666082_1(DQ666082|pid:none) Artemia franciscana clone 13RP1.05...    45   0.001
EU441799_1(EU441799|pid:none) Xenopus borealis clone Psap.a3 pro...    45   0.002
DQ648018_1(DQ648018|pid:none) Nicotiana tabacum aspartic proteas...    45   0.002
CR859906_1(CR859906|pid:none) Pongo abelii mRNA; cDNA DKFZp468M2...    44   0.003
BC155325_1(BC155325|pid:none) Danio rerio cDNA clone IMAGE:70680...    44   0.003
CT033825_6(CT033825|pid:none) Zebrafish DNA sequence from clone ...    44   0.003
EZ000561_1(EZ000561|pid:none) TSA: Culex tarsalis Ctar-515 sapos...    44   0.003
(Q6NUJ1) RecName: Full=Proactivator polypeptide-like 1; Contains...    44   0.004
BT003256_1(BT003256|pid:none) Drosophila melanogaster LD25144 fu...    44   0.004
DQ153190_1(DQ153190|pid:none) Ictalurus punctatus NK-lysin type ...    44   0.004
BC068579_1(BC068579|pid:none) Homo sapiens prosaposin-like 1, mR...    44   0.004
BC119540_1(BC119540|pid:none) Mus musculus prosaposin-like 1, mR...    43   0.006
(Q8C1C1) RecName: Full=Proactivator polypeptide-like 1; Contains...    43   0.006
DQ153187_1(DQ153187|pid:none) Ictalurus punctatus NK-lysin type ...    43   0.008
(P22355) RecName: Full=Pulmonary surfactant-associated protein B...    43   0.008
BC072466_1(BC072466|pid:none) Rattus norvegicus surfactant prote...    43   0.008
AF196308_1(AF196308|pid:none) Naegleria fowleri naegleriapore A ...    42   0.010
AY811214_1(AY811214|pid:none) Schistosoma japonicum clone SJCHGC...    42   0.013
AB069959_1(AB069959|pid:none) Glycine max soyAP1 mRNA for aspart...    40   0.038
AB219968_1(AB219968|pid:none) Triticum aestivum WAP1 mRNA for as...    40   0.038
AY826351_1(AY826351|pid:none) Fagopyrum esculentum aspartic prot...    40   0.038
DQ153189_1(DQ153189|pid:none) Ictalurus punctatus NK-lysin type ...    40   0.049
DQ153186_1(DQ153186|pid:none) Ictalurus punctatus NK-lysin type ...    40   0.049
DQ186291_1(DQ186291|pid:none) Gallus gallus NK-lysin mRNA, compl...    40   0.049
(P42210) RecName: Full=Phytepsin;          EC=3.4.23.40; AltName...    40   0.049
AC000375_21(AC000375|pid:none) Sequence of BAC F19K23 from Arabi...    40   0.065
AK317285_1(AK317285|pid:none) Arabidopsis thaliana AT1G62290 mRN...    40   0.065
U51036_1(U51036|pid:none) Arabidopsis thaliana aspartic proteina...    40   0.065
AL132968_11(AL132968|pid:none) Arabidopsis thaliana DNA chromoso...    40   0.065
S41400(S41400)aspartic proteinase (EC 3.4.23.-) - wild cabbage (...    40   0.065
T14446(T14446) aspartic proteinase (EC 3.4.23.-) - wild cabbage ...    40   0.065
AJ313384_1(AJ313384|pid:none) Theobroma cacao mRNA for aspartic ...    39   0.11
DQ841161_1(DQ841161|pid:none) Xenopus laevis surfactant protein ...    39   0.11
AF220198_1(AF220198|pid:none) Vitis riparia putative protein mRN...    39   0.11
BC170328_1(BC170328|pid:none) Xenopus laevis surfactant protein ...    39   0.11
BC123315_1(BC123315|pid:none) Xenopus laevis hypothetical protei...    39   0.11
AM461662_3(AM461662|pid:none) Vitis vinifera contig VV78X237399....    39   0.11
AF196309_1(AF196309|pid:none) Naegleria fowleri naegleriapore B ...    39   0.14
AF107544_1(AF107544|pid:none) Ovis aries pulmonary surfactant-as...    38   0.19
T11686(T11686)aspartic proteinase (EC 3.4.23.-) - cowpea               38   0.19
AY253927_1(AY253927|pid:none) Entamoeba invadens invapore X (IP-...    38   0.19
AF287258_1(AF287258|pid:none) Vigna unguiculata aspartic protein...    38   0.19
D32144_1(D32144|pid:none) Rice mRNA for aspartic protease, compl...    38   0.25
AB045893_1(AB045893|pid:none) Nepenthes alata NaAP3 mRNA for asp...    38   0.25
(Q42456) RecName: Full=Aspartic proteinase oryzasin-1;          ...    38   0.25
S47096(S47096)cynarase (EC 3.4.23.-) - cardoon                         37   0.32
EU968024_1(EU968024|pid:none) Zea mays clone 312992 aspartic pro...    37   0.32
EU960771_1(EU960771|pid:none) Zea mays clone 228459 aspartic pro...    37   0.32
BT062875_1(BT062875|pid:none) Zea mays full-length cDNA clone ZM...    37   0.32
T12049(T12049) cyprosin (EC 3.4.23.-) - cardoon (fragment)  &X69...    37   0.32
(P40782) RecName: Full=Cyprosin;          EC=3.4.23.-; Flags: Pr...    37   0.32
EF676352_1(EF676352|pid:none) Picea sitchensis clone WS02732_P05...    37   0.42
EU967011_1(EU967011|pid:none) Zea mays clone 298823 unknown mRNA.      37   0.42
D12777_1(D12777|pid:none) Oryza sativa Japonica Group mRNA for a...    37   0.42
EF678577_1(EF678577|pid:none) Picea sitchensis clone WS02928_J09...    37   0.42
(P42211) RecName: Full=Aspartic proteinase;          EC=3.4.23.-...    37   0.42
EU969886_1(EU969886|pid:none) Zea mays clone 336826 unknown mRNA.      37   0.42
BT064284_1(BT064284|pid:none) Zea mays full-length cDNA clone ZM...    37   0.42
AK072283_1(AK072283|pid:none) Oryza sativa Japonica Group cDNA c...    36   0.71
DQ903691_1(DQ903691|pid:none) Ipomoea batatas aspartic protease ...    36   0.71
DQ317589_1(DQ317589|pid:none) Homo sapiens truncated surfactant ...    36   0.71
LNHUB(A31361;A28461;A27794;A27592;JU0162;S21134)pulmonary surfac...    35   1.2
(P07988) RecName: Full=Pulmonary surfactant-associated protein B...    35   1.2
AB045892_1(AB045892|pid:none) Nepenthes alata NaAP2 mRNA for asp...    35   1.2
AM779476_1(AM779476|pid:none) Sus scrofa mRNA for surfactant pro...    35   1.2
AF082029_1(AF082029|pid:none) Hemerocallis hybrid cultivar senes...    35   1.2
AB070857_1(AB070857|pid:none) Glycine max soyAP2 mRNA for aspart...    35   1.6
EU960507_1(EU960507|pid:none) Zea mays clone 225521 surfactant p...    35   1.6
BT034142_1(BT034142|pid:none) Zea mays full-length cDNA clone ZM...    35   1.6
AC157894_29(AC157894|pid:none) Medicago truncatula chromosome 7 ...    35   1.6
AB024999_1(AB024999|pid:none) Cicer arietinum mRNA for aspartic ...    35   1.6
AB025359_1(AB025359|pid:none) Helianthus annuus mRNA for asparti...    35   1.6
AM779477_1(AM779477|pid:none) Sus scrofa mRNA for surfactant pro...    35   1.6
AK066523_1(AK066523|pid:none) Oryza sativa Japonica Group cDNA c...    35   2.1
AJ132884_1(AJ132884|pid:none) Cynara cardunculus mRNA for prepro...    35   2.1
BT042292_1(BT042292|pid:none) Zea mays full-length cDNA clone ZM...    35   2.1
DQ241852_1(DQ241852|pid:none) Solanum tuberosum clone 188C11 asp...    35   2.1
(P17129) RecName: Full=Pulmonary surfactant-associated protein B...    35   2.1
AB021787_1(AB021787|pid:none) Pyrus pyrifolia PPFRU11 mRNA for a...    35   2.1
Y09123_1(Y09123|pid:none) C.calcitrapa mRNA for aspartic protein...    34   2.7
BX537304_6(BX537304|pid:none) Zebrafish DNA sequence from clone ...    34   2.7
EF585741_1(EF585741|pid:none) Sonneratia alba isolate Sonn64_1 a...    34   2.7
AP008218_63(AP008218|pid:none) Oryza sativa (japonica cultivar-g...    34   2.7
BT067347_1(BT067347|pid:none) Zea mays full-length cDNA clone ZM...    34   2.7
EF585743_1(EF585743|pid:none) Sonneratia ovata isolate Sonn64_3 ...    34   2.7
EF585744_1(EF585744|pid:none) Sonneratia apetala isolate Sonn64_...    34   2.7
AB372260_1(AB372260|pid:none) Capsicum chinense mRNA for putativ...    34   3.5
S49349(S49349) cyprosin (EC 3.4.23.-) - cardoon  &X81984_1(X8198...    34   3.5
U40797_4(U40797|pid:none) Caenorhabditis elegans cosmid C28C12, ...    33   6.0
T15674(T15674)hypothetical protein C28C12.7 - Caenorhabditis ele...    33   6.0
CQ974048_1(CQ974048|pid:none) Sequence 7 from Patent WO2004113520.     33   6.0
U40797_3(U40797|pid:none) Caenorhabditis elegans cosmid C28C12, ...    33   6.0
X57107_1(X57107|pid:none) Human gene for cerebroside sulfate act...    33   7.9
AY811155_1(AY811155|pid:none) Schistosoma japonicum clone SJCHGC...    33   7.9
AY811092_1(AY811092|pid:none) Schistosoma japonicum clone SJCHGC...    33   7.9
AY811101_1(AY811101|pid:none) Schistosoma japonicum SJCHGC00199 ...    33   7.9
AC145372_5(AC145372|pid:none) Medicago truncatula clone mth2-5f4...    33   7.9
LNRBB(A32421) pulmonary surfactant protein B precursor - rabbit ...    33   7.9
AY811061_1(AY811061|pid:none) Schistosoma japonicum clone SJCHGC...    33   7.9
AY811148_1(AY811148|pid:none) Schistosoma japonicum clone SJCHGC...    33   7.9
AJ237674_1(AJ237674|pid:none) Cynara cardunculus mRNA for prepro...    33   7.9

>CR388420_1(CR388420|pid:none) Zebrafish DNA sequence from clone
           DKEY-37H18 in linkage group 13 Contains the 3' end of
           the psap gene for prosaposin, the abcg2c gene for
           ATP-binding cassette sub-family G (WHITE) member 2c, the
           gene for a novel protein similar to vertebrate solute
           carrier family 29 (nucleoside transporters) member 3
           (SLC29A3) and three CpG islands, complete sequence.
           &CR854925_5(CR854925|pid:none)
          Length = 520

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 31/78 (39%), Positives = 47/78 (60%)
 Frame = +1

Query: 280 DIPLCLICDFAVGKIEKYLDDKANTTVIIDKVEKDCNILRNSWIGKCKNIVTEYGPKIID 459
           D P C IC++ + +IE  + D+ +   I+  VEK CNIL ++   +CK+++  YG  IID
Sbjct: 308 DSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEKVCNILPSTLTAQCKDLIETYGQAIID 367

Query: 460 LLESNESPKAVCAIIDLC 513
           LL     PK VC+ + LC
Sbjct: 368 LLVQEADPKTVCSFLALC 385

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/74 (27%), Positives = 36/74 (48%)
 Frame = +1

Query: 292 CLICDFAVGKIEKYLDDKANTTVIIDKVEKDCNILRNSWIGKCKNIVTEYGPKIIDLLES 471
           C +C  AV  ++  L+  A  + I + V K C+ L ++   +C  ++ +Y P ++ LL
Sbjct: 405 CDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQ 464

Query: 472 NESPKAVCAIIDLC 513
              P  VC  +  C
Sbjct: 465 TLDPDFVCMKLGAC 478

 Score = 36.6 bits (83), Expect = 0.55
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 355 TVIIDKVEKDCNILRNSWIGKCKNIVTEYGPKIIDLLESNESPKAVCAIIDLC 513
           + +I +VE  C +L       CK  +++YGP +   L S + PK +CA    C
Sbjct: 211 STLIAQVENQCELLGPGMSDMCKEYISQYGPLVFQQLMSMQ-PKDICARAGFC 262

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 587,920,029
Number of extensions: 10325013
Number of successful extensions: 33822
Number of sequences better than 10.0: 159
Number of HSP's gapped: 33773
Number of HSP's successfully gapped: 298
Length of query: 199
Length of database: 1,051,180,864
Length adjustment: 122
Effective length of query: 77
Effective length of database: 656,320,666
Effective search space: 50536691282
Effective search space used: 50536691282
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
PSORT 

 psg: 0.86  gvh: 0.58  alm: 0.28  top: 0.13  tms: 0.07  mit: 0.30  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 1.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 1.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 0.00 

	 24.0 %: endoplasmic reticulum
	 20.0 %: cytoplasmic
	 20.0 %: mitochondrial
	 16.0 %: nuclear
	 12.0 %: Golgi
	  4.0 %: plasma membrane
	  4.0 %: extracellular, including cell wall

>> prediction for Contig-U02965-1 is end
VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 1
SL (DIR, L) 0
SS (DIR, S) 2
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0