| Contig-U02939-1 |
| Contig ID |
Contig-U02939-1 |
| Contig update |
2001. 8.29 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1237 |
| Chromosome number (1..6, M) |
3 |
| Chromosome length |
6358359 |
| Start point |
4058867 |
| End point |
4057630 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
4 |
| Number of EST |
5 |
| Link to clone list |
U02939 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6. 9 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 5.24 |
| Homology vs DNA |
Query= Contig-U02939-1 (Contig-U02939-1Q) /CSM_Contig/Contig-U02939-1Q.Seq.d
(1237 letters)
Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ390552) Dictyostelium discoideum cDNA clone:dds22h21, 5' ... 1174 0.0 1
(BJ343362) Dictyostelium discoideum cDNA clone:dda22h19, 3' ... 829 0.0 1
(AU036935) Dictyostelium discoideum slug cDNA, clone SSB838. 557 e-160 2
(AU074363) Dictyostelium discoideum slug cDNA, clone SSK493. 476 e-129 1
(AU071586) Dictyostelium discoideum slug cDNA, clone SSB838. 476 e-129 1
(EH431785) NPE00000438 Neocallimastix patriciarum ZAP II cDN... 50 3e-20 5
(EH431537) NPE00000865 Neocallimastix patriciarum ZAP II cDN... 48 4e-09 3
(AR547284) Sequence 2415 from patent US 6747137. 42 1e-05 3
(U85005) Candida albicans ornithine decarboxylase (SPE1) gen... 42 3e-05 3
(X94994) C.albicans ornithine decarboxylase gene. 42 3e-05 3
(CK799387) AGENCOURT_18794575 NICHD_XGC_Te2N Xenopus laevis ... 54 3e-04 2
(BC047954) Xenopus laevis ornithine decarboxylase-2, mRNA (c... 54 7e-04 2
(AF217544) Xenopus laevis ornithine decarboxylase-2 mRNA, co... 54 7e-04 2
(FC281488) CAGN24841.fwd CAGN Nematostella vectensis Nemve m... 52 9e-04 2
(FC251636) CAGH6998.fwd CAGH Nematostella vectensis Nemve La... 52 0.001 2
(CB889754) taa40g12.x3 Hydra EST -III Hydra magnipapillata c... 36 0.001 3
(FC264092) CAGN15163.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC183672) CAAB4554.fwd CAAB Nematostella vectensis nemve_P1... 52 0.001 2
(FC235655) CAGH10731.fwd CAGH Nematostella vectensis Nemve L... 52 0.001 2
(FC220717) CAGF605.fwd CAGF Nematostella vectensis Nemve Ear... 52 0.001 2
(AJ243276) Schizosaccharomyces pombe mRNA for ornithine deca... 42 0.001 3
(FC216246) CAGF3747.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC243187) CAGH2413.fwd CAGH Nematostella vectensis Nemve La... 52 0.001 2
(FC253809) CAGH8598.fwd CAGH Nematostella vectensis Nemve La... 52 0.001 2
(FC232668) CAGG4531.fwd CAGG Nematostella vectensis Nemve Ea... 52 0.001 2
(FC215774) CAGF3452.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC184031) CAAB4813.fwd CAAB Nematostella vectensis nemve_P1... 52 0.001 2
(FC287784) CAGN4105.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC288855) CAGN4683.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC251188) CAGH676.fwd CAGH Nematostella vectensis Nemve Lat... 52 0.001 2
(FC276127) CAGN2196.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC263474) CAGN14572.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC211527) CAGF12823.fwd CAGF Nematostella vectensis Nemve E... 52 0.001 2
(FC209371) CAGF11715.fwd CAGF Nematostella vectensis Nemve E... 52 0.001 2
(FC219160) CAGF5257.rev CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC276551) CAGN22186.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC214994) CAGF3006.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC297533) CAGN9303.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC294700) CAGN7775.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC220030) CAGF5699.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC274062) CAGN20823.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC260401) CAGN12903.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(DV080822) 248-03_A10.abi Nematostella vectensis non-normali... 52 0.001 2
(FC227318) CAGF9660.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC274533) CAGN21086.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC289622) CAGN5099.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC291744) CAGN6213.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC271691) CAGN19562.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC282463) CAGN25367.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC258080) CAGN11327.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC255178) CAGH9775.fwd CAGH Nematostella vectensis Nemve La... 52 0.001 2
(FC294878) CAGN7863.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC270725) CAGN19037.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC222723) CAGF7099.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC250123) CAGH619.fwd CAGH Nematostella vectensis Nemve Lat... 52 0.001 2
(FC267379) CAGN17066.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC267965) CAGN17415.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC262292) CAGN13920.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC244534) CAGH3194.fwd CAGH Nematostella vectensis Nemve La... 52 0.001 2
(FC261459) CAGN13478.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC257496) CAGN11017.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC218563) CAGF4952.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.001 2
(FC249049) CAGH5629.fwd CAGH Nematostella vectensis Nemve La... 52 0.001 2
(DV080823) 248-2_P16.abi Nematostella vectensis non-normaliz... 52 0.001 2
(FC272141) CAGN19808.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC265229) CAGN15811.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC258453) CAGN11533.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC259056) CAGN11852.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC263718) CAGN1493.fwd CAGN Nematostella vectensis Nemve mi... 52 0.001 2
(FC280133) CAGN24099.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC276646) CAGN22239.rev CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC270345) CAGN18819.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(FC283641) CAGN25999.fwd CAGN Nematostella vectensis Nemve m... 52 0.001 2
(CA286480) SCBGSD2050A03.g SD2 Saccharum officinarum cDNA cl... 46 0.002 3
(CR565084) Xenopus tropicalis EST, clone THdA015i23 5'. 40 0.002 2
(AL794298) Xenopus tropicalis EST, clone TNeu116p12 5'. 40 0.003 2
(AL775468) Xenopus tropicalis EST, clone TGas072i19 5'. 40 0.003 2
(AL971218) Xenopus tropicalis EST, clone TGas101n20 5'. 40 0.003 2
(AL960962) Xenopus tropicalis EST, clone TGas099g10 5'. 40 0.003 2
(AL959645) Xenopus tropicalis EST, clone TGas089m16 5'. 40 0.003 2
(CX477398) JGI_XZG20639.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.003 2
(AL784059) Xenopus tropicalis EST, clone TGas073m16 5'. 40 0.003 2
(CX455534) JGI_XZG56824.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.003 2
(AL898018) Xenopus tropicalis EST, clone TEgg043k04 5'. 40 0.003 2
(AL869888) Xenopus tropicalis EST, clone TEgg112k10 5'. 40 0.004 2
(AL630789) Xenopus tropicalis EST, clone TGas014p17 5'. 40 0.004 2
(AL681534) Xenopus tropicalis EST, clone TGas066b17 5'. 40 0.004 2
(AL859097) Xenopus tropicalis EST, clone TEgg063i14 5'. 40 0.004 2
(ES677075) CCAX3480.b1 NICHD_XGC_tropEye1 Xenopus (Silurana)... 40 0.004 2
(AL855422) Xenopus tropicalis EST, clone TEgg020d06 5'. 40 0.004 2
(AL651141) Xenopus tropicalis EST, clone TGas048l09 5'. 40 0.004 2
(AL968749) Xenopus tropicalis EST, clone TGas144k22 5'. 40 0.004 2
(AL848554) Xenopus tropicalis EST, clone TEgg003n18 5'. 40 0.004 2
(AL862273) Xenopus tropicalis EST, clone TEgg137c23 5'. 40 0.004 2
(AL866360) Xenopus tropicalis EST, clone TEgg123l18 5'. 40 0.004 2
(AL859523) Xenopus tropicalis EST, clone TEgg060h03 5'. 40 0.004 2
(AL848714) Xenopus tropicalis EST, clone TEgg006k17 5'. 40 0.004 2
(AL852715) Xenopus tropicalis EST, clone TEgg016o08 5'. 40 0.004 2
(DC171634) Xenopus (Silurana) tropicalis NBRP cDNA clone: st... 40 0.004 2
(AL881611) Xenopus tropicalis EST, clone TEgg028g12 5'. 40 0.004 2
(AL662667) Xenopus tropicalis EST, clone TNeu041d22 5'. 40 0.004 2
(AL647538) Xenopus tropicalis EST, clone TGas027j10 5'. 40 0.004 2
(AL636297) Xenopus tropicalis EST, clone TNeu021e02 5'. 40 0.004 2
(CX452589) JGI_XZG24068.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(AL648788) Xenopus tropicalis EST, clone TGas033g24 5'. 40 0.004 2
(CX489218) JGI_XZG32554.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(CX477340) JGI_XZG20605.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(AL648531) Xenopus tropicalis EST, clone TGas032l09 5'. 40 0.004 2
(EL664488) CBST10144.fwd NICHD_XGC_tropThy1 Xenopus (Siluran... 40 0.004 2
(CR563234) Xenopus tropicalis EST, clone THdA015j06 5'. 40 0.004 2
(CX477391) JGI_XZG20635.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(CX443621) JGI_XZG9284.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 40 0.004 2
(EH287571) Q4_Reed_1DPH_cDNA_03_D20_308.F 1d_posthatch Melea... 54 0.004 2
(DN086497) JGI_CABE1260.fwd NIH_XGC_tropOva1 Xenopus (Silura... 40 0.004 2
(FC184438) CAAB5091.fwd CAAB Nematostella vectensis nemve_P1... 50 0.004 2
(BX710001) Xenopus tropicalis EST, clone TTpA017a17 5'. 40 0.004 2
(CX444443) JGI_XZG10430.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(CX941070) JGI_CAAO7480.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 40 0.004 2
(CX431461) JGI_XZG62194.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(ES677057) CCAX3469.b1 NICHD_XGC_tropEye1 Xenopus (Silurana)... 40 0.004 2
(EL784227) Q4_Reed_18d_tembryo_07_J12_186.F 14d_emb Meleagri... 54 0.004 2
(EL836587) CBWN17132.b1 NICHD_XGC_tropTe1 Xenopus (Silurana)... 40 0.004 2
(EL819478) CBWN4511.b1 NICHD_XGC_tropTe1 Xenopus (Silurana) ... 40 0.004 2
(CX935671) JGI_CAAO4503.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 40 0.004 2
(FC220093) CAGF5730.fwd CAGF Nematostella vectensis Nemve Ea... 50 0.004 2
(CX502828) JGI_XZG40434.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(CX457562) JGI_XZG54306.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(ES686791) CCAX9074.b1 NICHD_XGC_tropEye1 Xenopus (Silurana)... 40 0.004 2
(CR566343) Xenopus tropicalis EST, clone THdA015j01 5'. 40 0.004 2
(CX514663) JGI_XZG44759.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(CX424141) JGI_XZG63951.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(EL855755) CBXT12340.b1 NICHD_XGC_trop_25 Xenopus (Silurana)... 40 0.004 2
(CX939716) JGI_CAAO6739.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 40 0.004 2
(CX438474) JGI_XZG6664.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 40 0.004 2
(CX466612) JGI_XZG47719.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.004 2
(EL721280) CBSS4094.fwd NICHD_XGC_tropSp1 Xenopus (Silurana)... 40 0.005 2
(CX464018) JGI_XZG46220.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CX454318) JGI_XZG56113.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CX443649) JGI_XZG9315.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 40 0.005 2
(BX739766) Xenopus tropicalis EST, clone TTpA048d02 5'. 40 0.005 2
(CR407873) Xenopus tropicalis EST, clone TTbA001f05 5'. 40 0.005 2
(CX961707) JGI_CAAO11552.fwd NIH_XGC_tropTe5 Xenopus (Silura... 40 0.005 2
(CX440663) JGI_XZG60102.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CX331958) JGI_XZT17387.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.005 2
(DN095354) JGI_CABE6318.fwd NIH_XGC_tropOva1 Xenopus (Silura... 40 0.005 2
(CR415870) Xenopus tropicalis EST, clone TTbA024b01 5'. 40 0.005 2
(CR415662) Xenopus tropicalis EST, clone TTbA045a03 5'. 40 0.005 2
(CF783798) AGENCOURT_15972820 XtSt10-30 Xenopus (Silurana) t... 40 0.005 2
(CX497976) JGI_XZG43847.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CX342872) JGI_XZT46998.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.005 2
(CX748339) JGI_ANHP1102.fwd NIH_XGC_tropNeu5 Xenopus (Silura... 40 0.005 2
(CX326095) JGI_XZT15005.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.005 2
(DR844006) JGI_CABE9642.fwd NIH_XGC_tropOva1 Xenopus (Silura... 40 0.005 2
(CX498273) JGI_XZG44019.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CX932143) JGI_CAAO2164.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 40 0.005 2
(BX735609) Xenopus tropicalis EST, clone TTpA067k19 5'. 40 0.005 2
(DN085277) JGI_CABE615.fwd NIH_XGC_tropOva1 Xenopus (Siluran... 40 0.005 2
(DT439891) JGI_CABK2885.fwd NIH_XGC_tropSpl1 Xenopus (Silura... 40 0.005 2
(CX315224) JGI_XZT65491.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.005 2
(CX505760) JGI_XZG42150.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CR411085) Xenopus tropicalis EST, clone TTbA029b13 5'. 40 0.005 2
(CX388794) JGI_XZT37161.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.005 2
(CX456295) JGI_XZG53577.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(CX493914) JGI_XZG36718.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.005 2
(BX732841) Xenopus tropicalis EST, clone TTpA077p01 5'. 40 0.005 2
(BX745783) Xenopus tropicalis EST, clone TGas055c15 3'. 40 0.005 2
(EL659450) AGENCOURT_103343831 NICHD_XGC_tropInt_63 Xenopus ... 40 0.005 2
(EL658844) AGENCOURT_103344491 NICHD_XGC_tropInt_66 Xenopus ... 40 0.005 2
(BX725560) Xenopus tropicalis EST, clone TTpA028k23 5'. 40 0.005 2
(CR436986) Xenopus tropicalis EST, clone TTbA032b16 5'. 40 0.005 2
(BX718300) Xenopus tropicalis EST, clone TTpA030p02 5'. 40 0.005 2
(EE002580) ROE00008651 Rhizopus oryzae Company Rhizopus oryz... 42 0.006 3
(CT025275) Xenopus tropicalis finished cDNA, clone TEgg063i14. 40 0.009 2
(BC074547) Xenopus tropicalis ornithine decarboxylase 1, mRN... 40 0.011 2
(CR848307) Xenopus tropicalis finished cDNA, clone TNeu085h23. 54 0.013 1
(EB735707) AGENCOURT_77726855 NICHD_XGC_skin_m Xenopus laevi... 54 0.013 1
(EB731987) AGENCOURT_77793043 NICHD_XGC_skin_m Xenopus laevi... 54 0.013 1
(DY566408) AGENCOURT_69684790 NICHD_XGC_Emb10 Xenopus laevis... 54 0.013 1
(DT435354) JGI_CABJ11196.fwd NIH_XGC_tropSki1 Xenopus (Silur... 54 0.013 1
(DT434219) JGI_CABJ10588.fwd NIH_XGC_tropSki1 Xenopus (Silur... 54 0.013 1
(DT433215) JGI_CABJ10047.fwd NIH_XGC_tropSki1 Xenopus (Silur... 54 0.013 1
(DT426956) JGI_CABJ6639.fwd NIH_XGC_tropSki1 Xenopus (Silura... 54 0.013 1
(DT078204) AGENCOURT_55791451 NICHD_XGC_FaBN Xenopus laevis ... 54 0.013 1
(DN059861) JGI_CABC806.fwd NIH_XGC_tropFat1 Xenopus (Siluran... 54 0.013 1
(DC116062) Xenopus laevis NBRP cDNA clone:xl274m15, 5' end. 54 0.013 1
(DC110142) Xenopus laevis NBRP cDNA clone:xl254j01, 5' end. 54 0.013 1
(DC108107) Xenopus laevis NBRP cDNA clone:xl247n05, 5' end. 54 0.013 1
(DC107293) Xenopus laevis NBRP cDNA clone:xl245b03, 5' end. 54 0.013 1
(DC106464) Xenopus laevis NBRP cDNA clone:xl242g06, 5' end. 54 0.013 1
(CX959750) JGI_CAAO10486.fwd NIH_XGC_tropTe5 Xenopus (Silura... 54 0.013 1
(CX476399) JGI_XZG19885.fwd NIH_XGC_tropGas7 Xenopus (Silura... 54 0.013 1
(CX385263) JGI_XZT64816.fwd NIH_XGC_tropTad5 Xenopus (Silura... 54 0.013 1
(CX135025) AGENCOURT_39736161 NICHD_XGC_Te2N Xenopus laevis ... 54 0.013 1
(CV074409) AGENCOURT_31443180 NICHD_XGC_Te2 Xenopus laevis c... 54 0.013 1
(CR568212) Xenopus tropicalis EST, clone THdA017a03 5'. 54 0.013 1
(AL857290) Xenopus tropicalis EST, clone TEgg048d23 5'. 54 0.013 1
(CN320642) AGENCOURT_21856933 XtSt10-30 Xenopus (Silurana) t... 54 0.013 1
(CK806043) AGENCOURT_19144166 NICHD_XGC_Te2 Xenopus laevis c... 54 0.013 1
(CK805990) AGENCOURT_19144367 NICHD_XGC_Te2 Xenopus laevis c... 54 0.013 1
(CK805180) AGENCOURT_19147792 NICHD_XGC_Te2 Xenopus laevis c... 54 0.013 1
(CF152004) AGENCOURT_14888204 NICHD_XGC_Emb8 Xenopus (Silura... 54 0.013 1
(BX736493) Xenopus tropicalis EST, clone TTpA038f11 5'. 54 0.013 1
(BX729366) Xenopus tropicalis EST, clone TTpA056i19 5'. 54 0.013 1
(BX712353) Xenopus tropicalis EST, clone TTpA020d16 5'. 54 0.013 1
(BX711241) Xenopus tropicalis EST, clone TTpA001i07 5'. 54 0.013 1
(BU906226) AGENCOURT_10455074 NICHD_XGC_Emb1 Xenopus laevis ... 54 0.013 1
(BQ734797) AGENCOURT_8098723 NICHD_XGC_Emb4 Xenopus laevis c... 54 0.013 1
(BP699889) Xenopus laevis NBRP cDNA clone:XL489a10ex, 5' end. 54 0.013 1
(BP699881) Xenopus laevis NBRP cDNA clone:XL489a02ex, 5' end. 54 0.013 1
(BP672875) Xenopus laevis NBRP cDNA clone:XL412b20ex, 5' end. 54 0.013 1
(BJ043369) Xenopus laevis cDNA clone:XL034k06, 5' end, singl... 54 0.013 1
(BJ042342) Xenopus laevis cDNA clone:XL035g05, 5' end, singl... 54 0.013 1
(BG552964) dab82a10.y1 NICHD_XGC_Emb4 Xenopus laevis cDNA cl... 54 0.013 1
(BG018525) daa48b03.y1 Wellcome CRC pCS2+ st19-26 Xenopus la... 54 0.013 1
(FC837170) CBHI7059.fwd CBHI Metridium senile tentacle Metri... 46 0.016 2
(DC029008) Xenopus laevis NBRP cDNA clone:rxlk155a02ex, 3' end. 48 0.021 2
(CV185336) taj11g09.y1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.024 3
(DN251572) ACAB-aab91c04.g1 Hydra UCI6- barcoded EST's Hydra... 36 0.030 3
(EX813653) CBNA3618.rev CBNA Phycomyces blakesleeanus NRRL15... 42 0.036 3
(CO376384) tah34d02.y1 Hydra EST -Kiel 5 Hydra magnipapillat... 36 0.041 3
(CF599602) tac36h10.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.042 3
(CB073865) taa21d02.y1 Hydra EST -II Hydra magnipapillata cD... 36 0.046 3
(CX055315) tai92d11.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.046 3
(CB073918) taa22b02.y1 Hydra EST -II Hydra magnipapillata cD... 36 0.050 3
(CX994819) ACAC-aaa56g01.b1 Hydra EST UCI 7 Hydra magnipapil... 36 0.051 3
(CB271317) taa21d02.x2 Hydra EST -II Hydra magnipapillata cD... 36 0.052 3
(AC153788) Mus musculus chromosome 1, clone RP24-282H12, com... 52 0.052 1
(DV080821) 248-2_E20.abi Nematostella vectensis non-normaliz... 52 0.052 1
(AM600259) Paracentrotus lividus EST, clone MPMGp1174N0271Q,... 52 0.052 1
(AM530487) Paracentrotus lividus EST, clone MPMGp1171N1264Q,... 52 0.052 1
(BY307535) Mus musculus 12.5 days embryo Rathke's pouches cD... 52 0.052 1
(FC293975) CAGN7383.fwd CAGN Nematostella vectensis Nemve mi... 52 0.052 1
(FC272522) CAGN20009.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC271622) CAGN19527.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC270871) CAGN19117.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC269819) CAGN18517.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC266744) CAGN16699.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC265988) CAGN16263.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC258259) CAGN11427.fwd CAGN Nematostella vectensis Nemve m... 52 0.052 1
(FC251879) CAGH7134.fwd CAGH Nematostella vectensis Nemve La... 52 0.052 1
(FC217775) CAGF455.fwd CAGF Nematostella vectensis Nemve Ear... 52 0.052 1
(FC214033) CAGF2464.fwd CAGF Nematostella vectensis Nemve Ea... 52 0.052 1
(CN631023) taf50e03.y1 Hydra EST Darmstadt I Hydra magnipapi... 36 0.059 3
(CB889381) taa35d02.x3 Hydra EST -III Hydra magnipapillata c... 36 0.066 3
(BP522377) Hydra magnipapillata cDNA, clone:hmp_20221. 36 0.066 3
(DN635988) ACAC-aab76p10.b1 Hydra EST UCI 7 Hydra magnipapil... 36 0.067 3
(DN242514) ACAD-aab10i24.g1 Hydra_EST_UCI-8 Hydra magnipapil... 36 0.078 3
(CO537441) tah76h08.x1 Hydra EST UCI 5 Hydra magnipapillata ... 36 0.080 3
(CO510857) tai55f08.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.080 3
(CB887937) taa60h11.x1 Hydra EST -III Hydra magnipapillata c... 36 0.082 3
(CX836166) tal63a01.x2 Hydra EST UCI 7 Hydra magnipapillata ... 36 0.083 3
(CV465079) taj21c02.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.083 3
(CX055175) tai89h10.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.083 3
(CF658020) tac75d01.y1 Hydra EST -IV Hydra magnipapillata cD... 36 0.083 3
(CD268692) taa98g01.x1 Hydra EST -III Hydra magnipapillata c... 36 0.083 3
(BP509181) Hydra magnipapillata cDNA, clone:hmp_03936. 36 0.084 3
(CV185073) taj11g09.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.085 3
(DT611149) ACAG-aaa86h09.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 0.086 3
(DN245729) ACAE-aaa29h06.b1 Hydra EST UCI 5 Hydra magnipapil... 36 0.086 3
(CF658290) tac63e06.y1 Hydra EST -IV Hydra magnipapillata cD... 36 0.086 3
(AU010432) Schizosaccharomyces pombe cDNA, clone spc05877. 42 0.087 2
(CB889234) taa48h04.x1 Hydra EST -III Hydra magnipapillata c... 36 0.089 3
(CB271569) taa18f04.x2 Hydra EST -II Hydra magnipapillata cD... 36 0.090 3
(CX633149) taj39f05.x3 Hydra EST UCI 5 Hydra magnipapillata ... 36 0.091 3
(CB890038) taa49a01.x1 Hydra EST -III Hydra magnipapillata c... 36 0.091 3
(CD567016) tac14b03.x1 Hydra EST -III Hydra magnipapillata c... 36 0.091 3
(CX055502) tai90g10.y2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.092 3
(CD266136) tab29h01.x1 Hydra EST -III Hydra magnipapillata c... 36 0.092 3
(CX994796) ACAC-aaa55c12.b1 Hydra EST UCI 7 Hydra magnipapil... 36 0.092 3
(CV564171) taj84f02.y1 Hydra EST UCI 6 Hydra magnipapillata ... 36 0.092 3
(CD566054) tab98b05.x1 Hydra EST -III Hydra magnipapillata c... 36 0.093 3
(CB887934) taa60h06.x1 Hydra EST -III Hydra magnipapillata c... 36 0.093 3
(DN816374) ACAC-aab98o08.g1 Hydra EST UCI 7 Hydra magnipapil... 36 0.094 3
(CV660438) tak28b02.y1 Hydra EST UCI 6 Hydra magnipapillata ... 36 0.095 3
(CF674625) tac84d12.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.095 3
(CX835630) ACAC-aaa80a12.g1 Hydra EST UCI 7 Hydra magnipapil... 36 0.095 3
(DR437592) ACAB-aaa68g06.g1 Hydra UCI6- barcoded EST's Hydra... 36 0.095 3
(CF780093) tad07g10.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.096 3
(CV515009) taj69e04.x1 Hydra EST UCI 6 Hydra magnipapillata ... 36 0.10 3
(BP505908) Hydra magnipapillata cDNA, clone:hm_03945. 36 0.10 3
(CX834092) ACAC-aaa77b09.g1 Hydra EST UCI 7 Hydra magnipapil... 36 0.10 3
(CB935849) tab97b10.x1 Hydra EST -III Hydra magnipapillata c... 36 0.10 3
(CF778531) tad18g06.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.10 3
(DN247152) ACAE-aaa30c05.b1 Hydra EST UCI 5 Hydra magnipapil... 36 0.10 3
(DN245574) ACAE-aaa27i20.b1 Hydra EST UCI 5 Hydra magnipapil... 36 0.11 3
(DR435342) ACAB-aaa28h09.g1 Hydra UCI6- barcoded EST's Hydra... 36 0.11 3
(CO905821) tah92d07.x2 Hydra EST UCI 5 Hydra magnipapillata ... 36 0.11 3
(AL954825) Oryza sativa chromosome 12, . BAC OJ2007_H06 of l... 48 0.11 2
(CF656937) tac70g06.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.11 3
(CO905820) tah92d06.x2 Hydra EST UCI 5 Hydra magnipapillata ... 36 0.11 3
(CF656066) tac63e06.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.11 3
(DN636375) ACAC-aab54i10.b1 Hydra EST UCI 7 Hydra magnipapil... 36 0.11 3
(DT610174) ACAG-aab25g09.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 0.11 3
(CN630711) taf50e03.x1 Hydra EST Darmstadt I Hydra magnipapi... 36 0.11 3
(CX054151) tai98e02.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.11 3
(CB890504) taa74a02.x1 Hydra EST -III Hydra magnipapillata c... 36 0.11 3
(DN636416) ACAC-aab56h24.b1 Hydra EST UCI 7 Hydra magnipapil... 36 0.11 3
(CV465686) taj34b02.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.11 3
(CN622910) tad97b02.x1 Hydra EST Darmstadt I Hydra magnipapi... 36 0.11 3
(DT608995) ACAG-aab23b08.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 0.12 3
(CV464957) taj18d03.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.12 3
(CX835868) ACAC-aaa52e11.g1 Hydra EST UCI 7 Hydra magnipapil... 36 0.12 3
(DN636382) ACAC-aab55d13.b1 Hydra EST UCI 7 Hydra magnipapil... 36 0.12 3
(CX055166) tai89f12.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.12 3
(DT612672) ACAG-aaa14f07.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 0.12 3
(CV464973) taj18g06.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.12 3
(CX054698) taj04e11.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.12 3
(DT609215) ACAG-aab05e11.g1 Hydra_EST_UCI-9 Hydra magnipapil... 36 0.13 3
(DN137901) ACAE-aaa10c09.b3 Hydra EST UCI 5 Hydra magnipapil... 36 0.13 3
(EX851970) CBNC9323.rev CBNC Phycomyces blakesleeanus NRRL15... 40 0.13 3
(CF600112) tac49a06.x1 Hydra EST -IV Hydra magnipapillata cD... 36 0.13 3
(CV042106) tai66c12.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.13 3
(CV564810) taj89c12.x1 Hydra EST UCI 6 Hydra magnipapillata ... 36 0.14 3
(DN243918) ACAE-aaa49d06.b1 Hydra EST UCI 5 Hydra magnipapil... 36 0.14 3
(DN247188) ACAE-aaa31m10.b1 Hydra EST UCI 5 Hydra magnipapil... 36 0.14 3
(CV185000) taj10b07.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.14 3
(CV181610) tai78g03.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.14 3
(CX836344) tal53e05.x2 Hydra EST UCI 7 Hydra magnipapillata ... 36 0.14 3
(CV564615) taj84f02.x1 Hydra EST UCI 6 Hydra magnipapillata ... 36 0.15 3
(CV465601) taj32b11.x1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 0.15 3
(GO182377) CAGA7581.fwd CAGA Alvinella pompejana Normalized ... 32 0.15 4
(CV514984) taj68e02.x1 Hydra EST UCI 6 Hydra magnipapillata ... 36 0.19 3
(EU680763) Salpornis spilonotus voucher FMNH:444409 ornithin... 50 0.21 1
(BX704900) Xenopus tropicalis EST, clone TTpA001j08 5'. 50 0.21 1
(BQ121835) EST607411 mixed potato tissues Solanum tuberosum ... 50 0.21 1
(BM112521) EST560057 potato roots Solanum tuberosum cDNA clo... 50 0.21 1
(BG592284) EST500126 P. infestans-challenged leaf Solanum tu... 50 0.21 1
(FC282370) CAGN25317.fwd CAGN Nematostella vectensis Nemve m... 50 0.21 1
(FC274007) CAGN20792.fwd CAGN Nematostella vectensis Nemve m... 50 0.21 1
(AM851367) Venerupis (Ruditapes) decussatus EST, 5' end sequ... 42 0.21 2
(FC712838) CAXY767.fwd CAXY Lottia gigantea from male gonad ... 44 0.22 2
(FC651713) CAXW12078.fwd CAXW Lottia gigantea from female go... 44 0.22 2
(FC694149) CAXX4237.fwd CAXX Lottia gigantea from male gonad... 40 0.22 2
(FC604892) CAXS1774.fwd CAXS Lottia gigantea from head, foot... 44 0.23 2
(FC686244) CAXX18723.fwd CAXX Lottia gigantea from male gona... 40 0.23 2
(FC766374) CBBN3094.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 44 0.23 2
(FC764408) CBBN14547.fwd CBBN Lottia gigantea 3,4,5,6.5d Lar... 44 0.23 2
(FC695675) CAXX5113.fwd CAXX Lottia gigantea from male gonad... 44 0.24 2
(FC564023) CAWF5279.fwd CAWF Lottia gigantea from mantle (H)... 44 0.24 2
(FC607089) CAXS3094.fwd CAXS Lottia gigantea from head, foot... 44 0.24 2
(FC567191) CAWF6987.fwd CAWF Lottia gigantea from mantle (H)... 44 0.25 2
(FC709850) CAXY6019.fwd CAXY Lottia gigantea from male gonad... 44 0.25 2
(FC561404) CAWF3849.fwd CAWF Lottia gigantea from mantle (H)... 44 0.25 2
(EK288342) 1095462320363 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.26 2
(EK168863) 1095458065794 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.29 2
(FE590545) CAXG5001.rev Amphioxus Branchiostoma floridae unp... 34 0.36 3
(AL682047) Xenopus tropicalis EST, clone TGas058b13 5'. 40 0.52 2
(FC810195) Sr_pASP6_03i10_SP6 S. ratti mixed stage pAMP Stro... 34 0.58 3
(FC809870) Sr_pASP6_02g21_SP6 S. ratti mixed stage pAMP Stro... 34 0.62 3
(FC809849) Sr_pASP6_02f19_SP6 S. ratti mixed stage pAMP Stro... 34 0.66 3
(DQ881719) Balaeniceps rex ornithine decarboxylase (OCD) gen... 42 0.74 2
(CX494270) JGI_XZG36928.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.78 2
(EF552711) Balaeniceps rex ornithine decarboxylase gene, par... 42 0.79 2
(AP008218) Oryza sativa (japonica cultivar-group) genomic DN... 48 0.82 1
(AL731761) Oryza sativa chromosome 12, . BAC OJ1119_B11 of l... 48 0.82 1
(EA703734) Sequence 82613 from patent US 7365185. 48 0.82 1
(EA676994) Sequence 55873 from patent US 7365185. 48 0.82 1
(DD379501) Polymorphic markers in Rice, and use thereof. 48 0.82 1
(DE194438) Branchiostoma floridae DNA, clone: CH302-075_O20_... 48 0.82 1
(DE004870) Branchiostoma floridae DNA, clone: CH302-009E17.F... 48 0.82 1
(CX894800) JGI_CAAM6039.fwd NIH_XGC_tropTe3 Xenopus (Siluran... 48 0.82 1
(CF221255) AGENCOURT_14995146 NICHD_XGC_Emb5 Xenopus (Silura... 40 0.90 2
(FE596754) CAXG978.rev Amphioxus Branchiostoma floridae unpu... 34 1.0 3
(DT613163) ACAG-aaa71e09.g1 Hydra_EST_UCI-9 Hydra magnipapil... 34 1.2 3
(CF777045) tad08f02.x1 Hydra EST -IV Hydra magnipapillata cD... 34 1.2 3
(D89177) Schizosaccharomyces pombe mRNA, partial cds, clone:... 42 1.2 2
(CX055158) tai89f02.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 2.0 2
(EC130524) HVE00003614 Hartmannella vermiformis Normalized l... 40 2.1 2
(AE017308) Mycoplasma mobile 163K complete genome. 40 2.3 13
(DQ785933) Eurylaimus javanicus ornithine decarboxylase (ODC... 42 2.6 2
(EU231841) Ampelioides tschudii voucher ZMUC 127031 ornithin... 40 2.8 2
(DY544216) AGENCOURT_69587294 NICHD_XGC_Emb10 Xenopus laevis... 40 2.9 2
(BP702798) Xenopus laevis NBRP cDNA clone:XL506e08ex, 5' end. 40 3.1 2
(DC042041) Xenopus laevis NBRP cDNA clone:xlk120d07ex, 5' end. 40 3.2 2
(AC160151) Bos taurus clone CH240-81H13, WORKING DRAFT SEQUE... 46 3.2 1
(AC143497) Macaca mulatta clone CH250-269F16, *** SEQUENCING... 46 3.2 1
(AC220398) Bos taurus clone CH240-360A12, WORKING DRAFT SEQU... 46 3.2 1
(FH984858) CHO_OF6838xn05f1.ab1 CHO_OF6 Nicotiana tabacum ge... 46 3.2 1
(EJ523211) 1092955159679 Global-Ocean-Sampling_GS-29-01-01-1... 46 3.2 1
(EI920359) VUH2-58N13TV VUUBBa (VUH2) Vigna unguiculata geno... 46 3.2 1
(EL929854) EST1483 ARS-CICGRU ONmgEST Ostrinia nubilalis cDN... 46 3.2 1
(DV080818) 248-1_I03.abi Nematostella vectensis non-normaliz... 46 3.2 1
(BG016374) de59g09.y1 Kirschner embryo St10 14 Xenopus laevi... 46 3.2 1
(FC847564) CBHN4819.fwd CBHN Metridium senile tentacle Metri... 46 3.2 1
(FC840916) CBHN11108.fwd CBHN Metridium senile tentacle Metr... 46 3.2 1
(FC826510) CBHI1166.fwd CBHI Metridium senile tentacle Metri... 46 3.2 1
(FC286107) CAGN3169.fwd CAGN Nematostella vectensis Nemve mi... 46 3.2 1
(CX054141) tai98c05.x2 Hydra EST UCI 5 ALP Hydra magnipapill... 36 3.2 2
(BP688831) Xenopus laevis NBRP cDNA clone:XL458j17ex, 5' end. 40 3.3 2
(CJ402682) Molgula tectiformis cDNA, gonad clone:mtgd018i13,... 36 3.3 2
(EB473031) AGENCOURT_73663653 NICHD_XGC_int_m Xenopus laevis... 40 3.5 2
(ES662808) WS03918.C21_L16 SS-B-24 Picea sitchensis cDNA clo... 40 3.5 2
(CA972835) AGENCOURT_10769299 Wellcome CRC pSK egg Xenopus l... 40 3.5 2
(BU909245) AGENCOURT_10481241 NICHD_XGC_Emb1 Xenopus laevis ... 40 3.5 2
(BQ732538) AGENCOURT_8510818 NICHD_XGC_Emb4 Xenopus laevis c... 40 3.6 2
(CK798688) AGENCOURT_18788792 NICHD_XGC_Te2N Xenopus laevis ... 40 3.6 2
(BU916281) AGENCOURT_10497486 NICHD_XGC_OO1 Xenopus laevis c... 40 3.6 2
(CA983374) AGENCOURT_11281720 Wellcome CRC pSK egg Xenopus l... 40 3.8 2
(CK804719) AGENCOURT_19152029 NICHD_XGC_Te2 Xenopus laevis c... 40 3.8 2
(AY507105) Anas zonorhyncha isolate ZH-25 ornithine decarbox... 42 4.0 2
(AY507104) Anas zonorhyncha isolate ZH-24 ornithine decarbox... 42 4.0 2
(AY507103) Anas zonorhyncha isolate ZH-23 ornithine decarbox... 42 4.0 2
(AY507102) Anas zonorhyncha isolate ZH-22 ornithine decarbox... 42 4.0 2
(AY507101) Anas zonorhyncha isolate ZH-21 ornithine decarbox... 42 4.0 2
(AY507100) Anas zonorhyncha isolate ZH-19 ornithine decarbox... 42 4.0 2
(AY507099) Anas zonorhyncha isolate ZH-18 ornithine decarbox... 42 4.0 2
(AY507098) Anas zonorhyncha isolate ZH-17 ornithine decarbox... 42 4.0 2
(AY507097) Anas zonorhyncha isolate ZH-16 ornithine decarbox... 42 4.0 2
(AY507096) Anas zonorhyncha isolate ZH-15 ornithine decarbox... 42 4.0 2
(AY507095) Anas zonorhyncha isolate ZH-14 ornithine decarbox... 42 4.0 2
(AY507094) Anas zonorhyncha isolate PRIM-10f ornithine decar... 42 4.0 2
(AY507093) Anas zonorhyncha isolate PRIM-09f ornithine decar... 42 4.0 2
(AY507092) Anas zonorhyncha isolate PRIM-08f ornithine decar... 42 4.0 2
(AY507091) Anas zonorhyncha isolate PRIM-07f ornithine decar... 42 4.0 2
(AY507090) Anas zonorhyncha isolate PRIM-06f ornithine decar... 42 4.0 2
(AY507089) Anas zonorhyncha isolate PRIM-05f ornithine decar... 42 4.0 2
(AY507088) Anas zonorhyncha isolate PRIM-03f ornithine decar... 42 4.0 2
(AY507087) Anas zonorhyncha isolate PRIM-02f ornithine decar... 42 4.0 2
(AY507086) Anas zonorhyncha isolate PRIM-01f ornithine decar... 42 4.0 2
(AY507085) Anas zonorhyncha isolate PRIM-87 ornithine decarb... 42 4.0 2
(AY507084) Anas zonorhyncha isolate PRIM-86 ornithine decarb... 42 4.0 2
(AY507083) Anas zonorhyncha isolate PRIM-85 ornithine decarb... 42 4.0 2
(AY507082) Anas zonorhyncha isolate PRIM-84 ornithine decarb... 42 4.0 2
(AY507081) Anas zonorhyncha isolate PRIM-83 ornithine decarb... 42 4.0 2
(AY507080) Anas zonorhyncha isolate PRIM-82 ornithine decarb... 42 4.0 2
(AY507079) Anas zonorhyncha isolate PRIM-81 ornithine decarb... 42 4.0 2
(AY507078) Anas zonorhyncha isolate PRIM-80 ornithine decarb... 42 4.0 2
(AY507077) Anas zonorhyncha isolate PRIM-79 ornithine decarb... 42 4.0 2
(AY507076) Anas zonorhyncha isolate PRIM-78 ornithine decarb... 42 4.0 2
(AY507075) Anas zonorhyncha isolate PRIM-77 ornithine decarb... 42 4.0 2
(AY507074) Anas zonorhyncha isolate PRIM-76 ornithine decarb... 42 4.0 2
(AY507073) Anas zonorhyncha isolate PRIM-75 ornithine decarb... 42 4.0 2
(AY507072) Anas zonorhyncha isolate PRIM-74 ornithine decarb... 42 4.0 2
(AY507071) Anas zonorhyncha isolate PRIM-73 ornithine decarb... 42 4.0 2
(AY507070) Anas zonorhyncha isolate PRIM-72 ornithine decarb... 42 4.0 2
(AY507069) Anas zonorhyncha isolate PRIM-71 ornithine decarb... 42 4.0 2
(AY507068) Anas platyrhynchos isolate ZH-13 ornithine decarb... 42 4.0 2
(AY507067) Anas platyrhynchos isolate ZH-12 ornithine decarb... 42 4.0 2
(AY507066) Anas platyrhynchos isolate ZH-11 ornithine decarb... 42 4.0 2
(AY507065) Anas platyrhynchos isolate ZH-10 ornithine decarb... 42 4.0 2
(AY507064) Anas platyrhynchos isolate ZH-09 ornithine decarb... 42 4.0 2
(AY507063) Anas platyrhynchos isolate ZH-08 ornithine decarb... 42 4.0 2
(AY507062) Anas platyrhynchos isolate ZH-07 ornithine decarb... 42 4.0 2
(AY507061) Anas platyrhynchos isolate ZH-06 ornithine decarb... 42 4.0 2
(AY507060) Anas platyrhynchos isolate ZH-05 ornithine decarb... 42 4.0 2
(AY507059) Anas platyrhynchos isolate ZH-04 ornithine decarb... 42 4.0 2
(AY507058) Anas platyrhynchos isolate ZH-03 ornithine decarb... 42 4.0 2
(AY507057) Anas platyrhynchos isolate ZH-02 ornithine decarb... 42 4.0 2
(AY507056) Anas platyrhynchos isolate ZH-01 ornithine decarb... 42 4.0 2
(AY507055) Anas platyrhynchos isolate PRIM-70 ornithine deca... 42 4.0 2
(AY507054) Anas platyrhynchos isolate PRIM-69 ornithine deca... 42 4.0 2
(AY507053) Anas platyrhynchos isolate PRIM-68 ornithine deca... 42 4.0 2
(AY507052) Anas platyrhynchos isolate PRIM-67 ornithine deca... 42 4.0 2
(AY507051) Anas platyrhynchos isolate PRIM-66 ornithine deca... 42 4.0 2
(AY507050) Anas platyrhynchos isolate PRIM-65 ornithine deca... 42 4.0 2
(AY507049) Anas platyrhynchos isolate PRIM-64 ornithine deca... 42 4.0 2
(AY507048) Anas platyrhynchos isolate PRIM-63 ornithine deca... 42 4.0 2
(AY507047) Anas platyrhynchos isolate PRIM-62 ornithine deca... 42 4.0 2
(AY507046) Anas platyrhynchos isolate PRIM-61 ornithine deca... 42 4.0 2
(AY507045) Anas platyrhynchos isolate PRIM-60 ornithine deca... 42 4.0 2
(AY507044) Anas platyrhynchos isolate PRIM-59 ornithine deca... 42 4.0 2
(AY507043) Anas platyrhynchos isolate PRIM-58 ornithine deca... 42 4.0 2
(AY507042) Anas platyrhynchos isolate PRIM-57 ornithine deca... 42 4.0 2
(AY507041) Anas platyrhynchos isolate PRIM-56 ornithine deca... 42 4.0 2
(AY507040) Anas platyrhynchos isolate PRIM-55 ornithine deca... 42 4.0 2
(AY507039) Anas platyrhynchos isolate PRIM-54 ornithine deca... 42 4.0 2
(AY507038) Anas platyrhynchos isolate PRIM-53 ornithine deca... 42 4.0 2
(AY507037) Anas platyrhynchos isolate PRIM-52 ornithine deca... 42 4.0 2
(AY507036) Anas platyrhynchos isolate PRIM-51 ornithine deca... 42 4.0 2
(AY507035) Anas platyrhynchos isolate PRIM-50 ornithine deca... 42 4.0 2
(AY507034) Anas platyrhynchos isolate PRIM-49 ornithine deca... 42 4.0 2
(AY507033) Anas platyrhynchos isolate PRIM-48 ornithine deca... 42 4.0 2
(AY507032) Anas platyrhynchos isolate PRIM-47 ornithine deca... 42 4.0 2
(AY507031) Anas platyrhynchos isolate PRIM-46 ornithine deca... 42 4.0 2
(AY507030) Anas platyrhynchos isolate PRIM-45 ornithine deca... 42 4.0 2
(AY507029) Anas platyrhynchos isolate PRIM-44 ornithine deca... 42 4.0 2
(AY507028) Anas platyrhynchos isolate PRIM-43 ornithine deca... 42 4.0 2
(AY507027) Anas platyrhynchos isolate PRIM-42 ornithine deca... 42 4.0 2
(AY507026) Anas platyrhynchos isolate PRIM-41 ornithine deca... 42 4.0 2
(AY507025) Anas platyrhynchos isolate PRIM-40 ornithine deca... 42 4.0 2
(AY507024) Anas platyrhynchos isolate PRIM-39 ornithine deca... 42 4.0 2
(AY507023) Anas platyrhynchos isolate PRIM-38 ornithine deca... 42 4.0 2
(AY507022) Anas platyrhynchos isolate PRIM-37 ornithine deca... 42 4.0 2
(AY507021) Anas platyrhynchos isolate PRIM-36 ornithine deca... 42 4.0 2
(AY507020) Anas platyrhynchos isolate PRIM-35 ornithine deca... 42 4.0 2
(AY507019) Anas platyrhynchos isolate PRIM-34 ornithine deca... 42 4.0 2
(AY507018) Anas platyrhynchos isolate PRIM-33 ornithine deca... 42 4.0 2
(AY507017) Anas platyrhynchos isolate PRIM-32 ornithine deca... 42 4.0 2
(AY507016) Anas platyrhynchos isolate PRIM-31 ornithine deca... 42 4.0 2
(AY507015) Anas platyrhynchos isolate PRIM-30 ornithine deca... 42 4.0 2
(AY507014) Anas platyrhynchos isolate PRIM-29 ornithine deca... 42 4.0 2
(AY507013) Anas platyrhynchos isolate PRIM-28 ornithine deca... 42 4.0 2
(AY507012) Anas platyrhynchos isolate PRIM-27 ornithine deca... 42 4.0 2
(AY507011) Anas platyrhynchos isolate PRIM-26 ornithine deca... 42 4.0 2
(AY507010) Anas platyrhynchos isolate PRIM-25 ornithine deca... 42 4.0 2
(AY507009) Anas platyrhynchos isolate PRIM-24 ornithine deca... 42 4.0 2
(AY507008) Anas platyrhynchos isolate PRIM-23 ornithine deca... 42 4.0 2
(AY507007) Anas platyrhynchos isolate PRIM-22 ornithine deca... 42 4.0 2
(AY507006) Anas platyrhynchos isolate PRIM-21 ornithine deca... 42 4.0 2
(AY507005) Anas platyrhynchos isolate PRIM-20 ornithine deca... 42 4.0 2
>(BJ390552) Dictyostelium discoideum cDNA clone:dds22h21, 5' end,
single read.
Length = 592
Score = 1174 bits (592), Expect = 0.0
Identities = 592/592 (100%)
Strand = Plus / Plus
Query: 1 ctgatagagatgcattctttgttgctgatgtcggtgttattattaaacaatggcaaaaat 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ctgatagagatgcattctttgttgctgatgtcggtgttattattaaacaatggcaaaaat 60
Query: 61 gggttaaaaatttaccaaatgttaaaccatattatgcagttaaatgtaatccaaccgttg 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 gggttaaaaatttaccaaatgttaaaccatattatgcagttaaatgtaatccaaccgttg 120
Query: 121 gtgttttaagagttttagatgctttaggtacaaattatgattgcgcaagtagaactgaaa 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gtgttttaagagttttagatgctttaggtacaaattatgattgcgcaagtagaactgaaa 180
Query: 181 ttgaatcagttttaaatttaggtgttgatccaagtcgtattatttatgctaatccatgta 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ttgaatcagttttaaatttaggtgttgatccaagtcgtattatttatgctaatccatgta 240
Query: 241 aacaaatctctgctcttaaatttgcaagagcacataatgttaaattaatgacatttgata 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 aacaaatctctgctcttaaatttgcaagagcacataatgttaaattaatgacatttgata 300
Query: 301 atcttagtgaattagaaaaaattgaaaagtttttcccagaagcagaattagtattaagaa 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 atcttagtgaattagaaaaaattgaaaagtttttcccagaagcagaattagtattaagaa 360
Query: 361 ttgcaccagatgattcaaaatctgttatgagatttggttctaaatttggtgttcatattg 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 ttgcaccagatgattcaaaatctgttatgagatttggttctaaatttggtgttcatattg 420
Query: 421 atgattgtaacgatttgttagagatggcaaaggaaatgaacctcaaggttgttggtgtta 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 atgattgtaacgatttgttagagatggcaaaggaaatgaacctcaaggttgttggtgtta 480
Query: 481 gtttccatgttggtagtggatgtcaaagtggtgattcatacgctgatgctctcattatgg 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 gtttccatgttggtagtggatgtcaaagtggtgattcatacgctgatgctctcattatgg 540
Query: 541 taaagagtgtctttgatatggcaaagaaattaaatatggaattaacattggt 592
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 taaagagtgtctttgatatggcaaagaaattaaatatggaattaacattggt 592
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 1,464,464,769
Number of extensions: 85056913
Number of successful extensions: 6914895
Number of sequences better than 10.0: 765
Length of query: 1237
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 1213
Effective length of database: 99,340,224,878
Effective search space: 120499692777014
Effective search space used: 120499692777014
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.21 |
| Homology vs Protein |
Query= Contig-U02939-1 (Contig-U02939-1Q) /CSM_Contig/Contig-U02939-1Q.Seq.d
(1237 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54UF3) RecName: Full=Probable ornithine decarboxylase; ... 769 0.0
AY214169_1(AY214169|pid:none) Paralichthys olivaceus ornithine d... 369 e-100
AB069857_1(AB069857|pid:none) Danio rerio mRNA for ornithine dec... 364 4e-99
BC047954_1(BC047954|pid:none) Xenopus laevis ornithine decarboxy... 362 1e-98
(Q9I8S4) RecName: Full=Ornithine decarboxylase 2; Short... 362 2e-98
BC044004_1(BC044004|pid:none) Xenopus laevis ornithine decarboxy... 359 1e-97
BT044794_1(BT044794|pid:none) Salmo salar clone ssal-rgf-504-007... 358 2e-97
(P27120) RecName: Full=Ornithine decarboxylase 1; Short... 358 2e-97
CR848307_1(CR848307|pid:none) Xenopus tropicalis finished cDNA, ... 358 2e-97
(P27117) RecName: Full=Ornithine decarboxylase; Short=O... 355 1e-96
(P00860) RecName: Full=Ornithine decarboxylase; Short=O... 353 5e-96
EU831702_1(EU831702|pid:none) Synthetic construct Homo sapiens c... 353 7e-96
AK139610_1(AK139610|pid:none) Mus musculus 2 cells egg cDNA, RIK... 352 2e-95
(P27118) RecName: Full=Ornithine decarboxylase; Short=O... 348 2e-94
(P07805) RecName: Full=Ornithine decarboxylase; Short=O... 340 5e-92
EF103415_1(EF103415|pid:none) Haliotis discus discus ornithine d... 339 1e-91
EU915509_1(EU915509|pid:none) Saccoglossus kowalevskii ornithine... 336 1e-90
EU872215_1(EU872215|pid:none) Haliotis diversicolor supertexta o... 335 2e-90
AF212867_1(AF212867|pid:none) Paracoccidioides brasiliensis orni... 328 3e-88
AB078415_1(AB078415|pid:none) Aspergillus oryzae odcA gene for o... 320 7e-86
AP007157_683(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 320 7e-86
CU640366_267(CU640366|pid:none) Podospora anserina genomic DNA c... 312 2e-83
AF333773_1(AF333773|pid:none) Tapesia yallundae ornithine decarb... 308 3e-82
BC109524_1(BC109524|pid:none) Bos taurus arginine decarboxylase,... 289 1e-76
AB304778_1(AB304778|pid:none) Nicotiana benthamiana mRNA for orn... 288 4e-76
X88796_1(X88796|pid:none) U.maydis ornithine decarboxylase gene. 287 5e-76
FN392321_432(FN392321|pid:none) Pichia pastoris GS115 chromosome... 286 8e-76
(Q96L57) RecName: Full=Arginine decarboxylase; Short=AR... 286 8e-76
AB075825_1(AB075825|pid:none) Homo sapiens mRNA for KIAA1945 pro... 286 8e-76
EU545649_1(EU545649|pid:none) Sus scrofa arginine decarboxylase ... 286 1e-75
AF321138_1(AF321138|pid:none) Nicotiana tabacum ornithine decarb... 286 1e-75
T03632(T03632) ornithine decarboxylase (EC 4.1.1.17) - common to... 286 1e-75
AE017343_491(AE017343|pid:none) Cryptococcus neoformans var. neo... 286 1e-75
CP001326_21(CP001326|pid:none) Micromonas sp. RCC299 chromosome ... 285 2e-75
AF323910_1(AF323910|pid:none) Nicotiana glutinosa ornithine deca... 285 3e-75
AJ575746_1(AJ575746|pid:none) Lotus japonicus mRNA for ornithine... 284 4e-75
AY325129_1(AY325129|pid:none) Homo sapiens arginine decarboxylas... 284 5e-75
BC078981_1(BC078981|pid:none) Rattus norvegicus similar to ornit... 283 7e-75
(Q8BVM4) RecName: Full=Antizyme inhibitor 2; Short=AZI2... 283 7e-75
AM494949_30(AM494949|pid:none) Leishmania braziliensis chromosom... 283 9e-75
U03059_1(U03059|pid:none) Caenorhabditis elegans Bristol (N2) or... 283 1e-74
(O22616) RecName: Full=Ornithine decarboxylase; Short=O... 280 6e-74
CU928174_551(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 280 1e-73
(Q8S3N2) RecName: Full=Ornithine decarboxylase; Short=O... 279 1e-73
EU646900_1(EU646900|pid:none) Sus scrofa antizyme inhibitor 1 (A... 277 6e-73
AB194103_1(AB194103|pid:none) Prunus persica pPpODC mRNA for orn... 276 8e-73
(O14977) RecName: Full=Antizyme inhibitor 1; Short=AZI;... 276 1e-72
CR380950_15(CR380950|pid:none) Candida glabrata strain CBS138 ch... 276 1e-72
AK290516_1(AK290516|pid:none) Homo sapiens cDNA FLJ76496 complet... 276 1e-72
AF159564_1(AF159564|pid:none) Leishmania tarentolae ornithine de... 276 1e-72
(P08432) RecName: Full=Ornithine decarboxylase; Short=O... 275 2e-72
CT005251_29(CT005251|pid:none) Leishmania major strain Friedlin,... 275 2e-72
(P49725) RecName: Full=Ornithine decarboxylase; Short=O... 274 5e-72
BT059103_1(BT059103|pid:none) Salmo salar clone ssal-rgf-525-290... 273 9e-72
EU431332_1(EU431332|pid:none) Malus hupehensis ornithine decarbo... 273 9e-72
Y08233_1(Y08233|pid:none) C.fasciculata gene encoding ornithine ... 271 4e-71
BC019412_1(BC019412|pid:none) Mus musculus antizyme inhibitor 1,... 271 4e-71
AK088112_1(AK088112|pid:none) Mus musculus 2 days neonate thymus... 270 8e-71
AF016891_1(AF016891|pid:none) Haemonchus contortus ornithine dec... 270 8e-71
BC172060_1(BC172060|pid:none) Mus musculus gene model 853, (NCBI... 270 8e-71
AM920436_1839(AM920436|pid:none) Penicillium chrysogenum Wiscons... 269 1e-70
BT045805_1(BT045805|pid:none) Salmo salar clone ssal-rgf-531-354... 269 1e-70
BC061550_1(BC061550|pid:none) Rattus norvegicus antizyme inhibit... 267 7e-70
CR855019_1(CR855019|pid:none) Oryza sativa genomic DNA, chromoso... 266 9e-70
AB109206_23(AB109206|pid:none) Oryza sativa Japonica Group genom... 266 1e-69
(Q63764) RecName: Full=Antizyme inhibitor 1; Short=AZI;... 266 1e-69
M20372_1(M20372|pid:none) Human ornithine decarboxylase (ODC) mR... 263 1e-68
AE016818_433(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 262 2e-68
X66599_1(X66599|pid:none) D.melanogaster mRNA for ornithine deca... 262 2e-68
AJ720630_1(AJ720630|pid:none) Gallus gallus mRNA for hypothetica... 259 1e-67
DQ890022_312(DQ890022|pid:none) Paramecium bursaria Chlorella vi... 254 4e-66
DQ291140_1(DQ291140|pid:none) Fusarium solani ornithine decarbox... 254 6e-66
CR954204_414(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 253 8e-66
DQ491002_278(DQ491002|pid:none) Paramecium bursaria Chlorella vi... 246 1e-63
AL807244_3(AL807244|pid:none) Zebrafish DNA sequence from clone ... 244 5e-63
AB069858_1(AB069858|pid:none) Danio rerio mRNA for antizyme inhi... 244 6e-63
AY050637_1(AY050637|pid:none) Homo sapiens ornithine decarboxyla... 243 8e-63
DQ491003_255(DQ491003|pid:none) Paramecium bursaria Chlorella vi... 243 1e-62
AB168599_1(AB168599|pid:none) Macaca fascicularis testis cDNA cl... 243 1e-62
X66600_1(X66600|pid:none) D.melanogaster gene 2 for ornithine de... 243 1e-62
BC061960_1(BC061960|pid:none) Danio rerio antizyme inhibitor 1, ... 241 4e-62
(P78599) RecName: Full=Ornithine decarboxylase; Short=O... 239 2e-61
EF101928_760(EF101928|pid:none) Acanthocystis turfacea Chlorella... 237 6e-61
AK301956_1(AK301956|pid:none) Homo sapiens cDNA FLJ51371 complet... 236 1e-60
AY050636_1(AY050636|pid:none) Homo sapiens ornithine decarboxyla... 234 4e-60
AK095493_1(AK095493|pid:none) Homo sapiens cDNA FLJ38174 fis, cl... 233 1e-59
(O50657) RecName: Full=Lysine/ornithine decarboxylase; ... 231 3e-59
AY723749_3(AY723749|pid:none) Neotyphodium uncinatum isolate e16... 231 5e-59
AY723750_2(AY723750|pid:none) Neotyphodium uncinatum isolate e16... 228 3e-58
AK057051_1(AK057051|pid:none) Homo sapiens cDNA FLJ32489 fis, cl... 226 1e-57
BC080451_1(BC080451|pid:none) Xenopus tropicalis oazin protein, ... 226 2e-57
AB172231_1(AB172231|pid:none) Macaca fascicularis brain cDNA clo... 218 3e-55
AY091984_1(AY091984|pid:none) Macaca sp. ornithine decarboxylase... 218 5e-55
AY123224_1(AY123224|pid:none) Zea mays ornithine decarboxylase g... 217 6e-55
AY091981_1(AY091981|pid:none) Pan troglodytes ornithine decarbox... 215 2e-54
AY091982_1(AY091982|pid:none) Gorilla gorilla ornithine decarbox... 214 4e-54
EF012269_7(EF012269|pid:none) Neotyphodium sp. PauTG-1 LolE (Lol... 212 2e-53
AY327897_1(AY327897|pid:none) Magnaporthe grisea ornithine decar... 210 7e-53
CP000780_1040(CP000780|pid:none) Candidatus Methanoregula boonei... 209 2e-52
AF521192_1(AF521192|pid:none) Capsicum annuum ornithine decarbox... 209 2e-52
J02813_1(J02813|pid:none) Hamster mRNA encoding ornithine decarb... 206 2e-51
BX294147_254(BX294147|pid:none) Rhodopirellula baltica SH 1 comp... 205 3e-51
AY929249_1(AY929249|pid:none) Entamoeba histolytica ornithine de... 204 5e-51
AY602214_1(AY602214|pid:none) Glomerella lindemuthiana ornithine... 201 4e-50
M12330_1(M12330|pid:none) Mouse kidney ornithine decarboxylase m... 201 6e-50
CP001338_2328(CP001338|pid:none) Candidatus Methanosphaerula pal... 197 6e-49
CP001110_808(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 193 1e-47
AY125816_1(AY125816|pid:none) Daucus carota ornithine decarboxyl... 192 3e-47
AY125817_1(AY125817|pid:none) Phaseolus vulgaris ornithine decar... 191 6e-47
CP001616_851(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 189 2e-46
AY174164_1(AY174164|pid:none) Vitis vinifera ornithine decarboxy... 182 2e-44
BA000038_1524(BA000038|pid:none) Vibrio vulnificus YJ016 DNA, ch... 182 3e-44
CP000109_273(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 178 4e-43
DQ185043_1(DQ185043|pid:none) Homo sapiens ornithine decarboxyla... 177 7e-43
CP000103_1950(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 176 1e-42
CP000462_1229(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 176 2e-42
CP001185_1644(CP001185|pid:none) Thermosipho africanus TCF52B, c... 175 3e-42
CP000450_1342(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 175 3e-42
AL954747_910(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 174 6e-42
BT071986_1(BT071986|pid:none) Salmo salar clone ssal-rgf-506-216... 174 8e-42
CP000716_1300(CP000716|pid:none) Thermosipho melanesiensis BI429... 172 2e-41
CP001147_1699(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 169 2e-40
U59812_1(U59812|pid:none) Nicotiana tabacum ornithine decarboxyl... 166 1e-39
AL591688_2884(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 166 1e-39
CP000916_808(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 166 2e-39
AJ563453_1(AJ563453|pid:none) Crassostrea gigas partial mRNA for... 165 3e-39
AL607086_5(AL607086|pid:none) Mouse DNA sequence from clone RP23... 165 3e-39
CP000301_4780(CP000301|pid:none) Rhodopseudomonas palustris BisB... 164 5e-39
CP000812_144(CP000812|pid:none) Thermotoga lettingae TMO, comple... 163 1e-38
AC151804_20(AC151804|pid:none) Solanum demissum chromosome 5 clo... 162 2e-38
AE000512_1841(AE000512|pid:none) Thermotoga maritima MSB8, compl... 162 2e-38
CP000781_2125(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 162 2e-38
AE007870_192(AE007870|pid:none) Agrobacterium tumefaciens str. C... 162 3e-38
AE008689_196(AE008689|pid:none) Agrobacterium tumefaciens str. C... 162 3e-38
AE008364_6(AE008364|pid:none) Agrobacterium tumefaciens str. C58... 162 3e-38
CP001634_1545(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 160 7e-38
AM236080_4158(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 160 9e-38
CP000319_3247(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 159 1e-37
CP001196_903(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 159 1e-37
CP000463_4760(CP000463|pid:none) Rhodopseudomonas palustris BisA... 159 3e-37
CP001074_3848(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 159 3e-37
CP001191_3354(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 158 4e-37
AJ311755_1(AJ311755|pid:none) Phycomyces blakesleeanus partial o... 157 6e-37
CP000613_2941(CP000613|pid:none) Rhodospirillum centenum SW, com... 157 7e-37
CP000879_516(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 157 7e-37
CP000628_2954(CP000628|pid:none) Agrobacterium radiobacter K84 c... 157 1e-36
CP000633_2780(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 157 1e-36
CP000009_424(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 156 2e-36
AM910988_177(AM910988|pid:none) Plasmodium knowlesi strain H chr... 155 2e-36
AP009384_333(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 155 2e-36
CU234118_5928(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 154 5e-36
AE000657_513(AE000657|pid:none) Aquifex aeolicus VF5, complete g... 154 6e-36
BA000012_2293(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 154 8e-36
CP000494_1279(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 154 8e-36
BX572595_239(BX572595|pid:none) Rhodopseudomonas palustris CGA00... 153 1e-35
CP000031_354(CP000031|pid:none) Ruegeria pomeroyi DSS-3, complet... 153 1e-35
BA000040_7759(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 152 2e-35
CR543861_2511(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 152 2e-35
CP000444_442(CP000444|pid:none) Shewanella sp. MR-7, complete ge... 151 4e-35
AF112367_1(AF112367|pid:none) Plasmodium falciparum S-adenosylme... 151 4e-35
CP000446_3491(CP000446|pid:none) Shewanella sp. MR-4, complete g... 151 4e-35
AE014292_97(AE014292|pid:none) Brucella suis 1330 chromosome II,... 150 9e-35
CP000514_76(CP000514|pid:none) Marinobacter aquaeolei VT8, compl... 150 9e-35
AD3651(AD3651) ornithine decarboxylase (EC 4.1.1.17) [imported] ... 150 9e-35
BX897700_965(BX897700|pid:none) Bartonella quintana str. Toulous... 150 1e-34
AM260525_1535(AM260525|pid:none) Bartonella tribocorum CIP 10547... 149 2e-34
CP001562_1343(CP001562|pid:none) Bartonella grahamii as4aup, com... 148 3e-34
BX897699_1228(BX897699|pid:none) Bartonella henselae strain Hous... 148 4e-34
CP000503_3587(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 148 4e-34
CP000774_3216(CP000774|pid:none) Parvibaculum lavamentivorans DS... 148 4e-34
CP000447_3379(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 148 4e-34
CP000759_1482(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918... 148 4e-34
AL807244_4(AL807244|pid:none) Zebrafish DNA sequence from clone ... 147 6e-34
CP000891_482(CP000891|pid:none) Shewanella baltica OS195, comple... 147 6e-34
AP007255_1388(AP007255|pid:none) Magnetospirillum magneticum AMB... 147 6e-34
AE010299_2653(AE010299|pid:none) Methanosarcina acetivorans str.... 147 1e-33
CP000697_2149(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 146 1e-33
CP001157_1191(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 146 1e-33
CP000099_2111(CP000099|pid:none) Methanosarcina barkeri str. Fus... 145 2e-33
CP001252_481(CP001252|pid:none) Shewanella baltica OS223, comple... 145 2e-33
AP005820_20(AP005820|pid:none) Oryza sativa Japonica Group genom... 145 3e-33
CP000606_3385(CP000606|pid:none) Shewanella loihica PV-4, comple... 145 4e-33
CP000230_1688(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 144 5e-33
CP000304_983(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 144 6e-33
CP000507_408(CP000507|pid:none) Shewanella amazonensis SB2B, com... 144 8e-33
CU459003_690(CU459003|pid:none) Magnetospirillum gryphiswaldense... 144 8e-33
CP000524_1013(CP000524|pid:none) Bartonella bacilliformis KC583,... 144 8e-33
AE008384_3185(AE008384|pid:none) Methanosarcina mazei strain Goe... 143 1e-32
CP000058_4079(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 141 4e-32
CP000376_79(CP000376|pid:none) Silicibacter sp. TM1040 mega plas... 141 5e-32
T25798(T25798) hypothetical protein F53F10.2 - Caenorhabditis el... 140 9e-32
CP000680_794(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 139 2e-31
AJ849360_1(AJ849360|pid:none) Populus nigra partial odc gene for... 139 2e-31
AE016853_4466(AE016853|pid:none) Pseudomonas syringae pv. tomato... 139 2e-31
CT573326_940(CT573326|pid:none) Pseudomonas entomophila str. L48... 138 4e-31
CP000712_879(CP000712|pid:none) Pseudomonas putida F1, complete ... 138 4e-31
AE015451_855(AE015451|pid:none) Pseudomonas putida KT2440 comple... 138 4e-31
CP000744_5075(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 138 5e-31
AB237163_39(AB237163|pid:none) Pseudomonas syringae pv. actinidi... 137 8e-31
CP001280_1141(CP001280|pid:none) Methylocella silvestris BL2, co... 136 2e-30
CP000943_422(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 135 2e-30
CP000908_2012(CP000908|pid:none) Methylobacterium extorquens PA1... 135 3e-30
CP000510_1362(CP000510|pid:none) Psychromonas ingrahamii 37, com... 135 3e-30
CP001016_1064(CP001016|pid:none) Beijerinckia indica subsp. indi... 134 5e-30
CP000830_1368(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 134 5e-30
CP001510_1856(CP001510|pid:none) Methylobacterium extorquens AM1... 134 5e-30
CP001147_1103(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 134 5e-30
CP001298_2195(CP001298|pid:none) Methylobacterium chloromethanic... 134 9e-30
CP001001_4594(CP001001|pid:none) Methylobacterium radiotolerans ... 133 1e-29
CP001349_1587(CP001349|pid:none) Methylobacterium nodulans ORS 2... 133 1e-29
CP000749_2154(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 133 1e-29
CP000613_1670(CP000613|pid:none) Rhodospirillum centenum SW, com... 132 3e-29
FM201307_1(FM201307|pid:none) Colletotrichum higginsianum partia... 130 1e-28
AP006618_3800(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 129 2e-28
AM420293_1236(AM420293|pid:none) Saccharopolyspora erythraea NRR... 126 2e-27
CP000248_1785(CP000248|pid:none) Novosphingobium aromaticivorans... 124 9e-27
CP001020_1368(CP001020|pid:none) Coxiella burnetii CbuK_Q154, co... 123 2e-26
AE008692_1020(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 123 2e-26
AE016828_629(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 122 2e-26
CP000733_677(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1... 122 3e-26
AL731627_1(AL731627|pid:none) Oryza sativa genomic DNA, chromoso... 120 1e-25
AY640230_1(AY640230|pid:none) Carassius auratus ornithine decarb... 119 3e-25
CP000774_2879(CP000774|pid:none) Parvibaculum lavamentivorans DS... 116 1e-24
(Q9ZME5) RecName: Full=Diaminopimelate decarboxylase; S... 116 2e-24
AM260522_501(AM260522|pid:none) Helicobacter acinonychis str. Sh... 116 2e-24
CP001150_293(CP001150|pid:none) Rhodobacter sphaeroides KD131 ch... 115 4e-24
CP000577_694(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170... 115 4e-24
CP000478_57(CP000478|pid:none) Syntrophobacter fumaroxidans MPOB... 114 9e-24
(O27390) RecName: Full=Diaminopimelate decarboxylase; S... 114 9e-24
AP007255_1101(AP007255|pid:none) Magnetospirillum magneticum AMB... 113 2e-23
EU056336_1(EU056336|pid:none) Helicobacter pylori strain SS1 dia... 112 3e-23
CP000524_55(CP000524|pid:none) Bartonella bacilliformis KC583, c... 112 3e-23
CP000744_5940(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 111 5e-23
CP001173_260(CP001173|pid:none) Helicobacter pylori G27, complet... 111 5e-23
CP000879_464(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 111 5e-23
AY458649_1(AY458649|pid:none) Uncultured marine bacterium 582 cl... 111 5e-23
CT573071_2321(CT573071|pid:none) Kuenenia stuttgartiensis genome... 111 6e-23
CP000084_201(CP000084|pid:none) Candidatus Pelagibacter ubique H... 111 6e-23
AM181176_5820(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 111 6e-23
CR378674_120(CR378674|pid:none) Photobacterium profundum SS9; se... 110 8e-23
CP000927_257(CP000927|pid:none) Caulobacter sp. K31, complete ge... 110 1e-22
A31133(A31133)diaminopimelate decarboxylase (EC 4.1.1.20) - Pseu... 110 1e-22
FM209186_5672(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 110 1e-22
CP000449_374(CP000449|pid:none) Maricaulis maris MCS10, complete... 110 1e-22
CP000680_266(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 110 1e-22
CP000438_5596(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 110 1e-22
CP000094_5493(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 110 1e-22
CP001110_1526(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 109 2e-22
CP000776_1230(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 109 2e-22
CP000158_2934(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 108 3e-22
CP001124_4012(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 108 4e-22
EU094469_1(EU094469|pid:none) Sclerotium cepivorum ornithine dec... 108 4e-22
CP001097_1494(CP001097|pid:none) Chlorobium limicola DSM 245, co... 108 4e-22
CP000698_231(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 108 4e-22
CP000932_1310(CP000932|pid:none) Campylobacter lari RM2100, comp... 108 5e-22
AE015451_5158(AE015451|pid:none) Pseudomonas putida KT2440 compl... 108 5e-22
CP000304_509(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 108 5e-22
AP009510_643(AP009510|pid:none) Uncultured Termite group 1 bacte... 108 5e-22
CP000712_5077(CP000712|pid:none) Pseudomonas putida F1, complete... 108 5e-22
CP001359_4174(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 107 7e-22
CU459003_2346(CU459003|pid:none) Magnetospirillum gryphiswaldens... 107 9e-22
BA000031_2984(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 107 9e-22
CP000769_348(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co... 107 9e-22
AL939126_30(AL939126|pid:none) Streptomyces coelicolor A3(2) com... 107 9e-22
(Q9KVL7) RecName: Full=Diaminopimelate decarboxylase; S... 107 9e-22
CP001091_1585(CP001091|pid:none) Actinobacillus pleuropneumoniae... 107 9e-22
CP000514_487(CP000514|pid:none) Marinobacter aquaeolei VT8, comp... 107 9e-22
CU207366_735(CU207366|pid:none) Gramella forsetii KT0803 complet... 107 1e-21
CP000687_1497(CP000687|pid:none) Actinobacillus pleuropneumoniae... 107 1e-21
CP000488_95(CP000488|pid:none) Candidatus Ruthia magnifica str. ... 107 1e-21
CP000949_245(CP000949|pid:none) Pseudomonas putida W619, complet... 107 1e-21
CP000770_108(CP000770|pid:none) Candidatus Sulcia muelleri GWSS,... 107 1e-21
FM954972_2860(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 107 1e-21
CP000569_1501(CP000569|pid:none) Actinobacillus pleuropneumoniae... 106 2e-21
CP000251_4056(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 106 2e-21
CP000472_390(CP000472|pid:none) Shewanella piezotolerans WP3, co... 106 2e-21
CP000767_1574(CP000767|pid:none) Campylobacter curvus 525.92, co... 106 2e-21
CP000926_5253(CP000926|pid:none) Pseudomonas putida GB-1, comple... 105 3e-21
BX897699_1561(BX897699|pid:none) Bartonella henselae strain Hous... 105 3e-21
CP000931_3877(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 105 3e-21
CP001197_348(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 105 3e-21
CP000112_2659(CP000112|pid:none) Desulfovibrio desulfuricans G20... 105 3e-21
AE016827_2084(AE016827|pid:none) Mannheimia succiniciproducens M... 104 6e-21
BX897700_1258(BX897700|pid:none) Bartonella quintana str. Toulou... 104 6e-21
CP001131_4153(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 104 7e-21
CP000477_732(CP000477|pid:none) Methanosaeta thermophila PT, com... 104 7e-21
CP000025_349(CP000025|pid:none) Campylobacter jejuni RM1221, com... 104 7e-21
CP000492_1664(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 104 7e-21
CP000361_2066(CP000361|pid:none) Arcobacter butzleri RM4018, com... 104 7e-21
CP000851_376(CP000851|pid:none) Shewanella pealeana ATCC 700345,... 104 7e-21
AY550057_1(AY550057|pid:none) Sus scrofa ornithine decarboxylase... 103 1e-20
CP000792_567(CP000792|pid:none) Campylobacter concisus 13826, co... 103 1e-20
CP000821_4121(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 103 1e-20
CP000814_289(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 103 1e-20
AM286690_2328(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 103 1e-20
CP001146_1192(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 103 2e-20
CR628337_1784(CR628337|pid:none) Legionella pneumophila str. Len... 103 2e-20
CP000020_2499(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 103 2e-20
CP000507_3240(CP000507|pid:none) Shewanella amazonensis SB2B, co... 102 2e-20
CP000436_1714(CP000436|pid:none) Haemophilus somnus 129PT, compl... 102 2e-20
AE017125_1507(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 102 2e-20
CP001139_2499(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 102 2e-20
CP000285_3091(CP000285|pid:none) Chromohalobacter salexigens DSM... 102 2e-20
CP000302_388(CP000302|pid:none) Shewanella denitrificans OS217, ... 102 2e-20
BA000037_86(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chro... 102 3e-20
AE016795_1056(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 102 3e-20
EU959538_1(EU959538|pid:none) Zea mays clone 218466 diaminopimel... 102 3e-20
CP001357_921(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 102 3e-20
FM178379_125(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 101 5e-20
BT033855_1(BT033855|pid:none) Zea mays full-length cDNA clone ZM... 101 6e-20
BT067641_1(BT067641|pid:none) Zea mays full-length cDNA clone ZM... 101 6e-20
CP000252_1432(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 101 6e-20
AP009351_1317(AP009351|pid:none) Staphylococcus aureus subsp. au... 100 1e-19
AF306669_8(AF306669|pid:none) Staphylococcus aureus strain 8325-... 100 1e-19
BX842650_283(BX842650|pid:none) Bdellovibrio bacteriovorus compl... 100 1e-19
CP000447_443(CP000447|pid:none) Shewanella frigidimarina NCIMB 4... 100 1e-19
CP000075_2546(CP000075|pid:none) Pseudomonas syringae pv. syring... 100 1e-19
CP000155_286(CP000155|pid:none) Hahella chejuensis KCTC 2396, co... 100 1e-19
CP000446_389(CP000446|pid:none) Shewanella sp. MR-4, complete ge... 100 1e-19
AE017354_1782(AE017354|pid:none) Legionella pneumophila subsp. p... 100 1e-19
CP001393_739(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 100 1e-19
CP000961_483(CP000961|pid:none) Shewanella woodyi ATCC 51908, co... 100 1e-19
AE009442_380(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 100 2e-19
CP001348_2451(CP001348|pid:none) Clostridium cellulolyticum H10,... 100 2e-19
CP001614_3677(CP001614|pid:none) Teredinibacter turnerae T7901, ... 100 2e-19
BT070551_1(BT070551|pid:none) Picea sitchensis clone WS02735_K21... 100 2e-19
CP000469_388(CP000469|pid:none) Shewanella sp. ANA-3, complete g... 99 2e-19
AP008934_1350(AP008934|pid:none) Staphylococcus saprophyticus su... 99 2e-19
AE004439_1424(AE004439|pid:none) Pasteurella multocida subsp. mu... 99 2e-19
CP001130_517(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 99 3e-19
CP001100_195(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 99 3e-19
CP000521_2893(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 99 4e-19
CP000789_277(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 99 4e-19
CP000606_321(CP000606|pid:none) Shewanella loihica PV-4, complet... 99 4e-19
CP000352_3262(CP000352|pid:none) Ralstonia metallidurans CH34, c... 98 5e-19
AE014299_4191(AE014299|pid:none) Shewanella oneidensis MR-1, com... 98 5e-19
CP000057_776(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 98 5e-19
(O67262) RecName: Full=Diaminopimelate decarboxylase; S... 98 7e-19
CP000544_1179(CP000544|pid:none) Halorhodospira halophila SL1, c... 98 7e-19
CP000672_1157(CP000672|pid:none) Haemophilus influenzae PittGG, ... 97 9e-19
CP000439_1667(CP000439|pid:none) Francisella tularensis subsp. n... 97 9e-19
CP001252_3829(CP001252|pid:none) Shewanella baltica OS223, compl... 97 9e-19
AE006470_1351(AE006470|pid:none) Chlorobium tepidum TLS, complet... 97 1e-18
(Q949X7) RecName: Full=Diaminopimelate decarboxylase 1, chloropl... 97 1e-18
AB022220_17(AB022220|pid:none) Arabidopsis thaliana genomic DNA,... 97 1e-18
BX571657_310(BX571657|pid:none) Wolinella succinogenes, complete... 97 2e-18
CP000510_40(CP000510|pid:none) Psychromonas ingrahamii 37, compl... 97 2e-18
AP009153_1752(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 97 2e-18
CP001229_385(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 97 2e-18
CP000679_884(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 96 2e-18
CP000083_2798(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 96 2e-18
CP000563_3927(CP000563|pid:none) Shewanella baltica OS155, compl... 96 2e-18
CP000029_948(CP000029|pid:none) Staphylococcus epidermidis RP62A... 96 2e-18
CP001096_5148(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 96 3e-18
AY714866_23(AY714866|pid:none) Uncultured archaeon GZfos36D8 clo... 96 3e-18
CP000159_289(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 96 3e-18
CT573326_3338(CT573326|pid:none) Pseudomonas entomophila str. L4... 96 3e-18
AE017282_812(AE017282|pid:none) Methylococcus capsulatus str. Ba... 96 3e-18
AM260525_2038(AM260525|pid:none) Bartonella tribocorum CIP 10547... 95 5e-18
AE017143_27(AE017143|pid:none) Haemophilus ducreyi strain 35000H... 95 5e-18
A82722(A82722) bifunctional diaminopimelate decarboxylase/aspart... 95 5e-18
AY714854_26(AY714854|pid:none) Uncultured archaeon GZfos32E4 clo... 95 5e-18
CP000780_2087(CP000780|pid:none) Candidatus Methanoregula boonei... 95 5e-18
CP000820_599(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 95 5e-18
CP000941_418(CP000941|pid:none) Xylella fastidiosa M12, complete... 95 6e-18
BA000012_1244(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 95 6e-18
CP000655_86(CP000655|pid:none) Polynucleobacter necessarius subs... 95 6e-18
CP001080_542(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 95 6e-18
CP001321_1326(CP001321|pid:none) Haemophilus parasuis SH0165, co... 95 6e-18
CP000926_1577(CP000926|pid:none) Pseudomonas putida GB-1, comple... 95 6e-18
(Q9JWA6) RecName: Full=Diaminopimelate decarboxylase; S... 94 8e-18
M12331_1(M12331|pid:none) Mouse kidney ornithine decarboxylase m... 94 8e-18
AP009178_387(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 94 8e-18
CP000826_3822(CP000826|pid:none) Serratia proteamaculans 568, co... 94 1e-17
(O29458) RecName: Full=Diaminopimelate decarboxylase; S... 94 1e-17
CP000058_2582(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 94 1e-17
CP000746_186(CP000746|pid:none) Actinobacillus succinogenes 130Z... 94 1e-17
CP000927_3202(CP000927|pid:none) Caulobacter sp. K31, complete g... 94 1e-17
(Q94A94) RecName: Full=Diaminopimelate decarboxylase 2, chloropl... 94 1e-17
CP000633_2942(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 94 1e-17
CP000916_976(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 94 1e-17
AL646052_2977(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 93 2e-17
CP000453_205(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 93 2e-17
CP000702_1260(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 93 2e-17
CP000323_219(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 93 2e-17
CP001322_411(CP001322|pid:none) Desulfatibacillum alkenivorans A... 93 2e-17
AB092607_2(AB092607|pid:none) Burkholderia multivorans lysR, lys... 93 2e-17
CP001098_708(CP001098|pid:none) Halothermothrix orenii H 168, co... 93 2e-17
BX572608_95(BX572608|pid:none) Rhodopseudomonas palustris CGA009... 92 3e-17
CP000743_206(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 92 3e-17
AF070634_1(AF070634|pid:none) Homo sapiens clone 24725 antizyme ... 92 3e-17
CP001099_774(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 92 3e-17
CP000142_2584(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 92 4e-17
CP001010_80(CP001010|pid:none) Polynucleobacter necessarius subs... 92 4e-17
CP001055_680(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 92 4e-17
CP000576_1198(CP000576|pid:none) Prochlorococcus marinus str. MI... 92 4e-17
CP000270_4044(CP000270|pid:none) Burkholderia xenovorans LB400 c... 92 4e-17
AP006716_1511(AP006716|pid:none) Staphylococcus haemolyticus JCS... 92 5e-17
CU928158_2677(CU928158|pid:none) Escherichia fergusonii ATCC 354... 92 5e-17
CP000082_199(CP000082|pid:none) Psychrobacter arcticus 273-4, co... 92 5e-17
CP000716_1022(CP000716|pid:none) Thermosipho melanesiensis BI429... 92 5e-17
(Q6ZG77) RecName: Full=Probable diaminopimelate decarboxylase, c... 91 6e-17
CP000685_2149(CP000685|pid:none) Flavobacterium johnsoniae UW101... 91 6e-17
AE005674_2848(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 91 6e-17
CP001132_2799(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 91 6e-17
CP000781_2714(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 91 6e-17
CP000527_680(CP000527|pid:none) Desulfovibrio vulgaris subsp. vu... 91 8e-17
CP000036_2527(CP000036|pid:none) Shigella boydii Sb227, complete... 91 8e-17
AF2180(AF2180) diaminopimelate decarboxylase [imported] - Nostoc... 91 8e-17
CP000527_1433(CP000527|pid:none) Desulfovibrio vulgaris subsp. v... 91 8e-17
AE017285_1640(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 91 8e-17
EU896225_1(EU896225|pid:none) Escherichia coli strain 493/89 dia... 91 8e-17
EU896228_1(EU896228|pid:none) Escherichia coli strain TB182A dia... 91 8e-17
AE014075_3353(AE014075|pid:none) Escherichia coli CFT073, comple... 91 1e-16
CP000553_1484(CP000553|pid:none) Prochlorococcus marinus str. NA... 91 1e-16
CP000724_4168(CP000724|pid:none) Alkaliphilus metalliredigens QY... 91 1e-16
CP000969_1393(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 91 1e-16
CP001339_40(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, co... 91 1e-16
BX640423_68(BX640423|pid:none) Bordetella parapertussis strain 1... 91 1e-16
CP000390_2015(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 91 1e-16
AE004969_1926(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, ... 90 1e-16
CP000473_2161(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 90 1e-16
AE005174_3716(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 90 1e-16
CP000379_496(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 90 1e-16
CP001161_401(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy... 90 1e-16
CP000653_3258(CP000653|pid:none) Enterobacter sp. 638, complete ... 90 1e-16
CP000086_2975(CP000086|pid:none) Burkholderia thailandensis E264... 90 1e-16
AJ937769_15(AJ937769|pid:none) Uncultured epsilon proteobacteriu... 90 1e-16
CU694391_110(CU694391|pid:none) Ralstonia solanacearum strain Mo... 90 1e-16
CP000712_3610(CP000712|pid:none) Pseudomonas putida F1, complete... 90 2e-16
CP000089_207(CP000089|pid:none) Dechloromonas aromatica RCB, com... 90 2e-16
AM933173_2817(AM933173|pid:none) Salmonella enterica subsp. ente... 90 2e-16
CU914168_2740(CU914168|pid:none) Ralstonia solanacearum strain I... 90 2e-16
CP001472_213(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 90 2e-16
CP000247_2823(CP000247|pid:none) Escherichia coli 536, complete ... 90 2e-16
CP000822_4094(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 90 2e-16
CP001120_3015(CP001120|pid:none) Salmonella enterica subsp. ente... 89 2e-16
CP001050_2564(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945... 89 2e-16
AE014613_2732(AE014613|pid:none) Salmonella enterica subsp. ente... 89 2e-16
CP001108_1453(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 89 2e-16
CP000435_1002(CP000435|pid:none) Synechococcus sp. CC9311, compl... 89 3e-16
AE005673_2196(AE005673|pid:none) Caulobacter crescentus CB15, co... 89 3e-16
CR925678_560(CR925678|pid:none) Ehrlichia ruminantium str. Welge... 89 3e-16
CP000697_735(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 89 4e-16
CP001635_1124(CP001635|pid:none) Variovorax paradoxus S110 chrom... 89 4e-16
CP000896_761(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 89 4e-16
AP007255_4491(AP007255|pid:none) Magnetospirillum magneticum AMB... 89 4e-16
AM421808_1786(AM421808|pid:none) Neisseria meningitidis serogrou... 89 4e-16
CP000934_3222(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 89 4e-16
AM747721_2081(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 89 4e-16
CP000076_2273(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 89 4e-16
AE007870_591(AE007870|pid:none) Agrobacterium tumefaciens str. C... 89 4e-16
CP000774_1596(CP000774|pid:none) Parvibaculum lavamentivorans DS... 88 6e-16
CP001562_1686(CP001562|pid:none) Bartonella grahamii as4aup, com... 88 6e-16
CP000394_129(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 88 6e-16
CP000959_2189(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 88 6e-16
EF571258_1(EF571258|pid:none) Mesorhizobium ciceri diaminopimela... 88 6e-16
CP001144_3033(CP001144|pid:none) Salmonella enterica subsp. ente... 88 7e-16
CP001113_3036(CP001113|pid:none) Salmonella enterica subsp. ente... 88 7e-16
CP000095_1433(CP000095|pid:none) Prochlorococcus marinus str. NA... 88 7e-16
CP000738_2508(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 88 7e-16
CR936257_820(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 87 9e-16
CP000102_1524(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 87 9e-16
CP001185_1297(CP001185|pid:none) Thermosipho africanus TCF52B, c... 87 9e-16
AE017261_16(AE017261|pid:none) Picrophilus torridus DSM 9790, co... 87 2e-15
BX950851_3626(BX950851|pid:none) Erwinia carotovora subsp. atros... 86 2e-15
CP001052_3543(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 86 2e-15
CP000158_3401(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 86 3e-15
CP000830_3043(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 86 3e-15
CP000783_450(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-... 86 3e-15
CP001322_1494(CP001322|pid:none) Desulfatibacillum alkenivorans ... 86 3e-15
AM180088_524(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 86 4e-15
DQ469797_1(DQ469797|pid:none) Liophis lineatus voucher BPN 1310 ... 86 4e-15
CP000489_1995(CP000489|pid:none) Paracoccus denitrificans PD1222... 86 4e-15
CP001101_930(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 86 4e-15
AM286415_3179(AM286415|pid:none) Yersinia enterocolitica subsp. ... 85 5e-15
(Q9Z661) RecName: Full=Diaminopimelate decarboxylase; S... 85 5e-15
CP000301_4816(CP000301|pid:none) Rhodopseudomonas palustris BisB... 85 5e-15
BX571862_284(BX571862|pid:none) Photorhabdus luminescens subsp. ... 85 5e-15
CP000951_95(CP000951|pid:none) Synechococcus sp. PCC 7002, compl... 85 6e-15
CP000441_1025(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 85 6e-15
AE013598_1411(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 85 6e-15
CP000967_3698(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 85 6e-15
CP001074_4010(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 84 8e-15
BA000012_2701(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 84 8e-15
AE016825_3757(AE016825|pid:none) Chromobacterium violaceum ATCC ... 84 8e-15
CP000728_3313(CP000728|pid:none) Clostridium botulinum F str. La... 84 8e-15
CP000111_1188(CP000111|pid:none) Prochlorococcus marinus str. MI... 84 8e-15
CP000572_3711(CP000572|pid:none) Burkholderia pseudomallei 1106a... 84 8e-15
AL591688_2659(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 84 1e-14
CP000110_1596(CP000110|pid:none) Synechococcus sp. CC9605, compl... 84 1e-14
CP001251_1298(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 84 1e-14
CP001581_3548(CP001581|pid:none) Clostridium botulinum A2 str. K... 84 1e-14
CP001191_3531(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 84 1e-14
CP000356_201(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 83 2e-14
BX571861_138(BX571861|pid:none) Photorhabdus luminescens subsp. ... 83 2e-14
CP000264_481(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 83 2e-14
AE008691_1843(AE008691|pid:none) Thermoanaerobacter tengcongensi... 83 2e-14
CP000133_3741(CP000133|pid:none) Rhizobium etli CFN 42, complete... 82 3e-14
AP008955_2404(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 82 4e-14
>(Q54UF3) RecName: Full=Probable ornithine decarboxylase;
Short=ODC; EC=4.1.1.17;
Length = 461
Score = 770 bits (1987), Expect = 0.0
Identities = 379/379 (100%), Positives = 379/379 (100%)
Frame = +3
Query: 3 DRDAFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDALGTNYDCASRTEI 182
DRDAFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDALGTNYDCASRTEI
Sbjct: 83 DRDAFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDALGTNYDCASRTEI 142
Query: 183 ESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIEKFFPEAELVLRI 362
ESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIEKFFPEAELVLRI
Sbjct: 143 ESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIEKFFPEAELVLRI 202
Query: 363 APDDSKSVMRFGSKFGVHIDDCNDLLEMAKEMNLKVVGVSFHVGSGCQSGDSYADALIMV 542
APDDSKSVMRFGSKFGVHIDDCNDLLEMAKEMNLKVVGVSFHVGSGCQSGDSYADALIMV
Sbjct: 203 APDDSKSVMRFGSKFGVHIDDCNDLLEMAKEMNLKVVGVSFHVGSGCQSGDSYADALIMV 262
Query: 543 KSVFDMAKKLNMELTLVDVGGGFTGSDDEKFNAFTKVIREKTAELFSPNVKIIAEPGRYF 722
KSVFDMAKKLNMELTLVDVGGGFTGSDDEKFNAFTKVIREKTAELFSPNVKIIAEPGRYF
Sbjct: 263 KSVFDMAKKLNMELTLVDVGGGFTGSDDEKFNAFTKVIREKTAELFSPNVKIIAEPGRYF 322
Query: 723 AAQSHTLAVTVISKRSIKQEDNRQHPRRTSNNMRQYNYYLADGVYGSFNNTKFDYAKVEP 902
AAQSHTLAVTVISKRSIKQEDNRQHPRRTSNNMRQYNYYLADGVYGSFNNTKFDYAKVEP
Sbjct: 323 AAQSHTLAVTVISKRSIKQEDNRQHPRRTSNNMRQYNYYLADGVYGSFNNTKFDYAKVEP 382
Query: 903 LLLKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLYFQDMGAYTIASSSSFNGF 1082
LLLKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLYFQDMGAYTIASSSSFNGF
Sbjct: 383 LLLKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLYFQDMGAYTIASSSSFNGF 442
Query: 1083 CPPPVYYYNSIPEEELKNL 1139
CPPPVYYYNSIPEEELKNL
Sbjct: 443 CPPPVYYYNSIPEEELKNL 461
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,798,377,753
Number of extensions: 35036146
Number of successful extensions: 98550
Number of sequences better than 10.0: 1040
Number of HSP's gapped: 97082
Number of HSP's successfully gapped: 1089
Length of query: 412
Length of database: 1,051,180,864
Length adjustment: 131
Effective length of query: 281
Effective length of database: 627,191,635
Effective search space: 176240849435
Effective search space used: 176240849435
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
1 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
2 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |