Contig-U00705-1
Contig ID Contig-U00705-1
Contig update 2001. 8.29
Contig sequence
>Contig-U00705-1 (Contig-U00705-1Q) /CSM_Contig/Contig-U00705-1Q.Seq.d
ATTTTTNTTTTTTTTTATTTTTCGAAAATTTAAGGGGTTGGTTTGTTGTT
GGGAGAGATTATNAGAAAATTTTACATTTCTAGAAAAACAAAGGAAATAA
AAAAAAGAATGTCTTTATTTGGTAATACAACAACAGGTGGTGGTGGATTA
TTTGGAAATACAACAACACCAACACAAACCACTGGCGGNGGGTTATTTGG
AAATACAACAACAGGTGGTGGATTATTTGGAAATACAGCAACACCAACAA
CAGGTGGCGGAGGATTATTTGGAAATACAGCAACACCAACACTAACCACA
GGTGGCGGNGGTGGATTATTTGGAAATACAACAGCACCAACAACAGGTGG
TGGTGGATTATTTGGAAATACACCCACACAAACCACTGGTGGGGGATTAT
TTGGAAATACAGCAACNGGTGGTGGTGGATTATTTGGAAATNCACAACAA
CAACAACAACAACAACAACAACAACAACAA----------ATAATTATCA
AGCAAATGGGCAATTGGTTGACCCAAATTCAATACCAAAACCACCAAATG
TAACAGTAGATCAATGGGCATACGCTCTTTCAAATAATCCTGATCCTTCA
ATATTAATACCAGTTGCAGCTAAATCATTTGATGATTTAATTAATAGAAG
AATGAAACAAGAAGAAACAATTATAGCATTAGATCAAAATACACAAGAAG
CGTTAAAGAGAATGAGAGATTTAGAAAATCATTTAAATTTTCATATTCAT
ACACAATTGGAAATGATGAGAAAGAAACAAATTGAATTGATTCAACGTTA
TATTGAAGTTTGGTCAAATTTAGAGATTTATCAAAGTAAAGGTAAAACAT
TTACAACAAGTGAAGAAAGAATTATGAAAAAAATCTATGAATTATTCGAA
GAGATTAATCAACCAAATTCAATTAAATCAAAAGTCGAAGAAATCTCGAA
TCAATTGAAATTAGGTTCAATGGAAAAAGAGAAAATTAAATATGAAATTT
CACCAGAAGCCGTCGAACCACTTTATAATCTTTTAAAAAATATGACTATT
TCAATTGAACGTATAACAAATGAATTGGAAATTGCTGTAAAAGATGCTCA
AATTTTAAAAAATAATTATATCAATTAAAAAAATGTTAAGATA

Gap gap included
Contig length 1133
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 4636713
End point 4635563
Strand (PLUS/MINUS) MINUS
Number of clones 2
Number of EST 3
Link to clone list U00705
List of clone(s)

est1=CFA533F,1,481
est2=CFA533Z,482,1148
est3=SFJ414Z,495,1108
Translated Amino Acid sequence
ifxffyfski*GVGLLLGEIXRKFYISRKTKEIKKRMSLFGNTTTGGGGLFGNTTTPTQT
TGGGLFGNTTTGGGLFGNTATPTTGGGGLFGNTATPTLTTGGGGGLFGNTTAPTTGGGGL
FGNTPTQTTGGGLFGNTATGGGGLFGNXQQQQQQQQQQQQ---

---NYQANGQLVDPNSIPKPPNVTVDQWAYALSNNPDPSILIPVAAKSFDDLINRRMKQE
ETIIALDQNTQEALKRMRDLENHLNFHIHTQLEMMRKKQIELIQRYIEVWSNLEIYQSKG
KTFTTSEERIMKKIYELFEEINQPNSIKSKVEEISNQLKLGSMEKEKIKYEISPEAVEPL
YNLLKNMTISIERITNELEIAVKDAQILKNNYIN*knvki


Translated Amino Acid sequence (All Frames)
Frame A:
ifxffyfski*GVGLLLGEIXRKFYISRKTKEIKKRMSLFGNTTTGGGGLFGNTTTPTQT
TGGGLFGNTTTGGGLFGNTATPTTGGGGLFGNTATPTLTTGGGGGLFGNTTAPTTGGGGL
FGNTPTQTTGGGLFGNTATGGGGLFGNXQQQQQQQQQQQQ---

---iiikqmgnwltqiqyqnhqm*q*inghtlfqiililqy*yqlqlnhlmi*liee*nk
kkql*h*ikihkkr*re*ei*kii*ififihnwk**ernkln*fnvilkfgqi*rfikvk
vkhlqqvkkel*kksmnyskrlinqiqlnqkskksrin*n*vqwkkrklnmkfhqkpsnh
fiif*ki*lfqlnv*qmnwkll*kmlkf*kiiisikkmlr

Frame B:
fxfffifrkfkglvccwerlxenftflekqrk*kkeclylviqqqvvvdyleiqqhqhkp
laxgyleiqqqvvdyleiqqhqqqvaedyleiqqhqh*pqvaxvdyleiqqhqqqvvvdy
leihphkplvgdyleiqqxvvvdylexhnnnnnnnnnnn---

---*lsskwaig*pkfntkttkcnsrsmgirsfk*s*sfnintscs*ii**fn**knetr
rnnysirskytrsvkenerfrksfkfsysytigndeketn*idstly*slvkfrdlsk*r
*niynk*rknyeknl*iirrd*stkfn*iksrrnlesieirfngkren*i*nftrsrrtt
l*sfkkydyfn*tynk*igncckrcsnfkk*lyqlkkc*d

Frame C:
fxfflffenlrgwfvvgrdyxkilhf*knkgnkkknvfiw*ynnrwwwiiwkynntntnh
wrxviwkynnrwwiiwkysntnnrwrriiwkysntntnhrwrxwiiwkynstnnrwwwii
wkythtnhwwgiiwkysnxwwwiiwkxtttttttttttt---

---NYQANGQLVDPNSIPKPPNVTVDQWAYALSNNPDPSILIPVAAKSFDDLINRRMKQE
ETIIALDQNTQEALKRMRDLENHLNFHIHTQLEMMRKKQIELIQRYIEVWSNLEIYQSKG
KTFTTSEERIMKKIYELFEEINQPNSIKSKVEEISNQLKLGSMEKEKIKYEISPEAVEPL
YNLLKNMTISIERITNELEIAVKDAQILKNNYIN*knvki

own update 2004. 6.21
Homology vs CSM-cDNA
Query= Contig-U00705-1 (Contig-U00705-1Q)
/CSM_Contig/Contig-U00705-1Q.Seq.d
(1143 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U00705-1 (Contig-U00705-1Q) /CSM_Contig/Conti... 1219 0.0
Contig-U16185-1 (Contig-U16185-1Q) /CSM_Contig/Conti... 54 5e-07
Contig-U09697-1 (Contig-U09697-1Q) /CSM_Contig/Conti... 40 0.007
Contig-U15567-1 (Contig-U15567-1Q) /CSM_Contig/Conti... 38 0.029
Contig-U15053-1 (Contig-U15053-1Q) /CSM_Contig/Conti... 38 0.029
Contig-U09348-1 (Contig-U09348-1Q) /CSM_Contig/Conti... 38 0.029
Contig-U09347-1 (Contig-U09347-1Q) /CSM_Contig/Conti... 38 0.029
Contig-U08537-1 (Contig-U08537-1Q) /CSM_Contig/Conti... 38 0.029
Contig-U15262-1 (Contig-U15262-1Q) /CSM_Contig/Conti... 36 0.12

>Contig-U00705-1 (Contig-U00705-1Q) /CSM_Contig/Contig-U00705-1Q.Seq.d
Length = 1143

Score = 1219 bits (615), Expect = 0.0
Identities = 629/636 (98%)
Strand = Plus / Plus


Query: 491 ataattatcaagcaaatgggcaattggttgacccaaattcaataccaaaaccaccaaatg 550
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 491 ataattatcaagcaaatgggcaattggttgacccaaattcaataccaaaaccaccaaatg 550


Query: 551 taacagtagatcaatgggcatacgctctttcaaataatcctgatccttcaatattaatac 610
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 551 taacagtagatcaatgggcatacgctctttcaaataatcctgatccttcaatattaatac 610


Query: 611 cagttgcagctaaatcatttgatgatttaattaatagaagaatgaaacaagaagaaacaa 670
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 611 cagttgcagctaaatcatttgatgatttaattaatagaagaatgaaacaagaagaaacaa 670


Query: 671 ttatagcattagatcaaaatacacaagaagcgttaaagagaatgagagatttagaaaatc 730
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 671 ttatagcattagatcaaaatacacaagaagcgttaaagagaatgagagatttagaaaatc 730


Query: 731 atttaaattttcatattcatacacaattggaaatgatgagaaagaaacaaattgaattga 790
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 731 atttaaattttcatattcatacacaattggaaatgatgagaaagaaacaaattgaattga 790


Query: 791 ttcaacgttatattgaagtttggtcaaatttagagatttatcaaagtaaaggtaaaacat 850
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 791 ttcaacgttatattgaagtttggtcaaatttagagatttatcaaagtaaaggtaaaacat 850


Query: 851 ttacaacaagtgaagaaagaattatgnnnnnnntctatgaattattcgaagagattaatc 910
|||||||||||||||||||||||||| |||||||||||||||||||||||||||
Sbjct: 851 ttacaacaagtgaagaaagaattatgaaaaaaatctatgaattattcgaagagattaatc 910


Query: 911 aaccaaattcaattaaatcaaaagtcgaagaaatctcgaatcaattgaaattaggttcaa 970
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 911 aaccaaattcaattaaatcaaaagtcgaagaaatctcgaatcaattgaaattaggttcaa 970


Query: 971 tggaaaaagagaaaattaaatatgaaatttcaccagaagccgtcgaaccactttataatc 1030
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 971 tggaaaaagagaaaattaaatatgaaatttcaccagaagccgtcgaaccactttataatc 1030


Query: 1031 ttttaaaaaatatgactatttcaattgaacgtataacaaatgaattggaaattgctgtaa 1090
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1031 ttttaaaaaatatgactatttcaattgaacgtataacaaatgaattggaaattgctgtaa 1090


Query: 1091 aagatgctcaaattttaaaaaataattatatcaatt 1126
||||||||||||||||||||||||||||||||||||
Sbjct: 1091 aagatgctcaaattttaaaaaataattatatcaatt 1126


Score = 759 bits (383), Expect = 0.0
Identities = 411/419 (98%)
Strand = Plus / Plus


Query: 23 cgaaaatttaaggggttggtttgttgttgggagagattatnagaaaattttacatttcta 82
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 23 cgaaaatttaaggggttggtttgttgttgggagagattatnagaaaattttacatttcta 82


Query: 83 gaaaaacaaaggaaatnnnnnnnngaatgtctttatttggtaatacaacaacaggtggtg 142
|||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 83 gaaaaacaaaggaaataaaaaaaagaatgtctttatttggtaatacaacaacaggtggtg 142


Query: 143 gtggattatttggaaatacaacaacaccaacacaaaccactggcggngggttatttggaa 202
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 143 gtggattatttggaaatacaacaacaccaacacaaaccactggcggngggttatttggaa 202


Query: 203 atacaacaacaggtggtggattatttggaaatacagcaacaccaacaacaggtggcggag 262
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 203 atacaacaacaggtggtggattatttggaaatacagcaacaccaacaacaggtggcggag 262


Query: 263 gattatttggaaatacagcaacaccaacactaaccacaggtggcggnggtggattatttg 322
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 263 gattatttggaaatacagcaacaccaacactaaccacaggtggcggnggtggattatttg 322


Query: 323 gaaatacaacagcaccaacaacaggtggtggtggattatttggaaatacacccacacaaa 382
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 323 gaaatacaacagcaccaacaacaggtggtggtggattatttggaaatacacccacacaaa 382


Query: 383 ccactggtgggggattatttggaaatacagcaacnggtggtggtggattatttggaaat 441
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 383 ccactggtgggggattatttggaaatacagcaacnggtggtggtggattatttggaaat 441


>Contig-U16185-1 (Contig-U16185-1Q) /CSM_Contig/Contig-U16185-1Q.Seq.d
Length = 3297

Score = 54.0 bits (27), Expect = 5e-07
Identities = 33/35 (94%)
Strand = Plus / Plus


Query: 331 acagcaccaacaacaggtggtggtggattatttgg 365
||||||||| |||||||||||||||| ||||||||
Sbjct: 184 acagcaccagcaacaggtggtggtggtttatttgg 218


Score = 54.0 bits (27), Expect = 5e-07
Identities = 33/35 (94%)
Strand = Plus / Plus


Query: 331 acagcaccaacaacaggtggtggtggattatttgg 365
||||||||| |||||||||||||||| ||||||||
Sbjct: 1168 acagcaccagcaacaggtggtggtggtttatttgg 1202


Score = 52.0 bits (26), Expect = 2e-06
Identities = 35/38 (92%)
Strand = Plus / Plus


Query: 329 caacagcaccaacaacaggtggtggtggattatttgga 366
||||| ||||| |||||||||||||||| |||||||||
Sbjct: 1118 caacaacaccagcaacaggtggtggtggtttatttgga 1155


Score = 44.1 bits (22), Expect = 5e-04
Identities = 27/29 (93%)
Strand = Plus / Plus


Query: 410 cagcaacnggtggtggtggattatttgga 438
||||||| ||||||||||| |||||||||
Sbjct: 1127 cagcaacaggtggtggtggtttatttgga 1155


Score = 44.1 bits (22), Expect = 5e-04
Identities = 25/26 (96%)
Strand = Plus / Plus


Query: 131 caacaggtggtggtggattatttgga 156
|||||||||||||||| |||||||||
Sbjct: 1130 caacaggtggtggtggtttatttgga 1155


Score = 42.1 bits (21), Expect = 0.002
Identities = 26/28 (92%)
Strand = Plus / Plus


Query: 410 cagcaacnggtggtggtggattatttgg 437
||||||| ||||||||||| ||||||||
Sbjct: 1175 cagcaacaggtggtggtggtttatttgg 1202


Score = 42.1 bits (21), Expect = 0.002
Identities = 24/25 (96%)
Strand = Plus / Plus


Query: 131 caacaggtggtggtggattatttgg 155
|||||||||||||||| ||||||||
Sbjct: 194 caacaggtggtggtggtttatttgg 218


Score = 42.1 bits (21), Expect = 0.002
Identities = 26/28 (92%)
Strand = Plus / Plus


Query: 410 cagcaacnggtggtggtggattatttgg 437
||||||| ||||||||||| ||||||||
Sbjct: 191 cagcaacaggtggtggtggtttatttgg 218


Score = 42.1 bits (21), Expect = 0.002
Identities = 24/25 (96%)
Strand = Plus / Plus


Query: 131 caacaggtggtggtggattatttgg 155
|||||||||||||||| ||||||||
Sbjct: 1178 caacaggtggtggtggtttatttgg 1202


Score = 40.1 bits (20), Expect = 0.007
Identities = 23/24 (95%)
Strand = Plus / Plus


Query: 234 tacagcaacaccaacaacaggtgg 257
|||||||||| |||||||||||||
Sbjct: 429 tacagcaacaacaacaacaggtgg 452


Score = 40.1 bits (20), Expect = 0.007
Identities = 23/24 (95%)
Strand = Plus / Plus


Query: 234 tacagcaacaccaacaacaggtgg 257
|||||||||| |||||||||||||
Sbjct: 1414 tacagcaacaacaacaacaggtgg 1437


Score = 38.2 bits (19), Expect = 0.029
Identities = 22/23 (95%)
Strand = Plus / Plus


Query: 209 caacaggtggtggattatttgga 231
||||||||||||| |||||||||
Sbjct: 1088 caacaggtggtggtttatttgga 1110


Score = 36.2 bits (18), Expect = 0.12
Identities = 24/26 (92%)
Strand = Plus / Plus


Query: 329 caacagcaccaacaacaggtggtggt 354
||||| ||||| ||||||||||||||
Sbjct: 1076 caacaacaccagcaacaggtggtggt 1101


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 350 gtggtggattatttgga 366
|||||||||||||||||
Sbjct: 2107 gtggtggattatttgga 2123


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 215 gtggtggattatttgga 231
|||||||||||||||||
Sbjct: 2179 gtggtggattatttgga 2195


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 140 gtggtggattatttgga 156
|||||||||||||||||
Sbjct: 1678 gtggtggattatttgga 1694


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 215 gtggtggattatttgga 231
|||||||||||||||||
Sbjct: 617 gtggtggattatttgga 633


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 350 gtggtggattatttgga 366
|||||||||||||||||
Sbjct: 617 gtggtggattatttgga 633


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 422 gtggtggattatttgga 438
|||||||||||||||||
Sbjct: 2107 gtggtggattatttgga 2123


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 350 gtggtggattatttgga 366
|||||||||||||||||
Sbjct: 1678 gtggtggattatttgga 1694


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 422 gtggtggattatttgga 438
|||||||||||||||||
Sbjct: 2179 gtggtggattatttgga 2195


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 215 gtggtggattatttgga 231
|||||||||||||||||
Sbjct: 2107 gtggtggattatttgga 2123


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 140 gtggtggattatttgga 156
|||||||||||||||||
Sbjct: 2107 gtggtggattatttgga 2123


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 422 gtggtggattatttgga 438
|||||||||||||||||
Sbjct: 1678 gtggtggattatttgga 1694


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 140 gtggtggattatttgga 156
|||||||||||||||||
Sbjct: 2179 gtggtggattatttgga 2195


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 422 gtggtggattatttgga 438
|||||||||||||||||
Sbjct: 617 gtggtggattatttgga 633


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 350 gtggtggattatttgga 366
|||||||||||||||||
Sbjct: 2179 gtggtggattatttgga 2195


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 215 gtggtggattatttgga 231
|||||||||||||||||
Sbjct: 1678 gtggtggattatttgga 1694


Score = 34.2 bits (17), Expect = 0.46
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 140 gtggtggattatttgga 156
|||||||||||||||||
Sbjct: 617 gtggtggattatttgga 633


Score = 32.2 bits (16), Expect = 1.8
Identities = 16/16 (100%)
Strand = Plus / Plus


Query: 239 caacaccaacaacagg 254
||||||||||||||||
Sbjct: 2635 caacaccaacaacagg 2650


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 1840 ggaggattatttgga 1854


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 2382 ggaggattatttgga 2396


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 310 ggtggattatttgga 324
|||||||||||||||
Sbjct: 619 ggtggattatttgga 633


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 352 ggtggattatttgga 366
|||||||||||||||
Sbjct: 1382 ggtggattatttgga 1396


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 2340 ggaggattatttgga 2354


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 2217 ggaggattatttgga 2231


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 310 ggtggattatttgga 324
|||||||||||||||
Sbjct: 2181 ggtggattatttgga 2195


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 349 ggaggattatttgga 363


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 310 ggtggattatttgga 324
|||||||||||||||
Sbjct: 397 ggtggattatttgga 411


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 310 ggtggattatttgga 324
|||||||||||||||
Sbjct: 1680 ggtggattatttgga 1694


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 1882 ggaggattatttgga 1896


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 424 ggtggattatttgga 438
|||||||||||||||
Sbjct: 397 ggtggattatttgga 411


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 310 ggtggattatttgga 324
|||||||||||||||
Sbjct: 2109 ggtggattatttgga 2123


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 352 ggtggattatttgga 366
|||||||||||||||
Sbjct: 397 ggtggattatttgga 411


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 1717 ggaggattatttgga 1731


Score = 30.2 bits (15), Expect = 7.1
Identities = 18/19 (94%)
Strand = Plus / Plus


Query: 329 caacagcaccaacaacagg 347
||||| |||||||||||||
Sbjct: 2632 caacaacaccaacaacagg 2650


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 217 ggtggattatttgga 231
|||||||||||||||
Sbjct: 397 ggtggattatttgga 411


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 250 ggaggattatttgga 264


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 259 ggaggattatttgga 273
|||||||||||||||
Sbjct: 1234 ggaggattatttgga 1248


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 424 ggtggattatttgga 438
|||||||||||||||
Sbjct: 1382 ggtggattatttgga 1396


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 142 ggtggattatttgga 156
|||||||||||||||
Sbjct: 397 ggtggattatttgga 411


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 310 ggtggattatttgga 324
|||||||||||||||
Sbjct: 1382 ggtggattatttgga 1396


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 217 ggtggattatttgga 231
|||||||||||||||
Sbjct: 1382 ggtggattatttgga 1396


Score = 30.2 bits (15), Expect = 7.1
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 142 ggtggattatttgga 156
|||||||||||||||
Sbjct: 1382 ggtggattatttgga 1396


>Contig-U09697-1 (Contig-U09697-1Q) /CSM_Contig/Contig-U09697-1Q.Seq.d
Length = 1319

Score = 40.1 bits (20), Expect = 0.007
Identities = 20/20 (100%)
Strand = Plus / Minus


Query: 1022 tttataatcttttaaaaaat 1041
||||||||||||||||||||
Sbjct: 493 tttataatcttttaaaaaat 474


Database: CSM
Posted date: Jun 21, 2004 12:56 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 33,983
Number of Sequences: 8402
Number of extensions: 33983
Number of successful extensions: 4519
Number of sequences better than 10.0: 480
length of query: 1143
length of database: 8,075,542
effective HSP length: 16
effective length of query: 1127
effective length of database: 7,941,110
effective search space: 8949630970
effective search space used: 8949630970
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 4.18
Homology vs DNA
Query= Contig-U00705-1 (Contig-U00705-1Q) /CSM_Contig/Contig-U00705-1Q.Seq.d
(1143 letters)

Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ401710) Dictyostelium discoideum cDNA clone:dds19l04, 3' ... 765 0.0 2
(BJ373217) Dictyostelium discoideum cDNA clone:ddc2a09, 3' e... 646 0.0 2
(BJ359735) Dictyostelium discoideum cDNA clone:ddc2a09, 5' e... 646 0.0 2
(AL439660) T3 end of clone BD0AA007A06 of library BD0AA from... 44 6e-17 7
(AL440760) T7 end of clone BD0AA014F02 of library BD0AA from... 44 7e-17 7
(BJ387826) Dictyostelium discoideum cDNA clone:dds5a11, 5' e... 54 2e-15 8
(BJ412244) Dictyostelium discoideum cDNA clone:ddv7c16, 5' e... 54 9e-15 6
(BJ329437) Dictyostelium discoideum cDNA clone:dda24o24, 5' ... 54 1e-14 6
(BJ416506) Dictyostelium discoideum cDNA clone:ddv26k16, 5' ... 54 1e-14 8
(BJ425810) Dictyostelium discoideum cDNA clone:ddv56m20, 5' ... 54 2e-14 4
(BJ411401) Dictyostelium discoideum cDNA clone:ddv4d09, 5' e... 54 2e-14 4
(BJ424092) Dictyostelium discoideum cDNA clone:ddv51i08, 5' ... 54 2e-14 4
(BJ323961) Dictyostelium discoideum cDNA clone:dda4h06, 5' e... 54 2e-14 4
(BJ426896) Dictyostelium discoideum cDNA clone:ddv60i16, 5' ... 54 3e-14 4
(BJ409940) Dictyostelium discoideum cDNA clone:ddv10j17, 5' ... 54 3e-14 4
(BJ427235) Dictyostelium discoideum cDNA clone:ddv61c20, 5' ... 54 3e-14 4
(BJ422539) Dictyostelium discoideum cDNA clone:ddv46c07, 5' ... 54 4e-14 4
(BJ426408) Dictyostelium discoideum cDNA clone:ddv58k21, 5' ... 54 6e-14 4
(BJ420596) Dictyostelium discoideum cDNA clone:ddv39e21, 5' ... 54 1e-13 6
(AL439958) T7 end of clone BD0AA009A10 of library BD0AA from... 40 1e-13 7
(BJ361489) Dictyostelium discoideum cDNA clone:ddc17l09, 5' ... 54 1e-13 7
(BJ426414) Dictyostelium discoideum cDNA clone:ddv58l21, 5' ... 54 1e-13 7
(AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 54 2e-13 17
(BJ339367) Dictyostelium discoideum cDNA clone:dda65g05, 5' ... 54 3e-13 8
(BJ368874) Dictyostelium discoideum cDNA clone:ddc48l10, 5' ... 54 2e-12 7
(DL173298) Methods for Identifying the Target of a Compound ... 50 1e-11 5
(AX488858) Sequence 6158 from Patent WO02053728. 50 1e-11 5
(BJ327351) Dictyostelium discoideum cDNA clone:dda20k01, 5' ... 40 2e-11 8
(BJ422292) Dictyostelium discoideum cDNA clone:ddv45p10, 5' ... 54 5e-11 5
(BJ418828) Dictyostelium discoideum cDNA clone:ddv34l02, 5' ... 54 7e-11 5
(BJ423459) Dictyostelium discoideum cDNA clone:ddv49d10, 5' ... 52 7e-11 4
(BJ415362) Dictyostelium discoideum cDNA clone:ddv22g09, 5' ... 54 7e-11 5
(BJ324402) Dictyostelium discoideum cDNA clone:dda6k02, 5' e... 54 7e-11 5
(BJ391048) Dictyostelium discoideum cDNA clone:dds14g19, 5' ... 54 8e-11 5
(BJ424034) Dictyostelium discoideum cDNA clone:ddv51n05, 5' ... 54 1e-10 5
(BJ422291) Dictyostelium discoideum cDNA clone:ddv45p09, 5' ... 54 1e-10 5
(BJ426352) Dictyostelium discoideum cDNA clone:ddv58n17, 5' ... 54 1e-10 5
(FC818907) Sr_pAMT7_013e17_T7 S. ratti mixed stage pAMP Stro... 36 1e-08 6
(AM632785) Entamoeba dispar GSS, clone dispar94e01.p1k. 34 1e-07 6
(AM641007) Entamoeba dispar GSS, clone dispar7d12.p1k. 34 2e-07 6
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 40 7e-07 18
(FC815815) Sr_pAMT7_04e01_T7 S. ratti mixed stage pAMP Stron... 36 8e-07 5
(CR382135) Debaryomyces hansenii strain CBS767 chromosome C ... 40 8e-07 3
(FC818918) Sr_pAMT7_013f06_T7 S. ratti mixed stage pAMP Stro... 36 4e-06 5
(AM632321) Entamoeba dispar GSS, clone dispar86d08.p1k. 34 4e-06 5
(BJ430511) Dictyostelium discoideum cDNA clone:ddv7c16, 3' e... 34 6e-05 4
(CB097961) ku47d02.y1 Strongyloides ratti PA female naive pA... 36 7e-05 4
(AC115598) Dictyostelium discoideum chromosome 2 map 581427-... 40 5e-04 3
(AJ627419) Helicoverpa armigera microsatellite DNA, locus Ha... 36 8e-04 3
(CZ291946) cp78f01.f Candida parapsilosis Random Genomic Lib... 34 0.001 5
(DQ121048) Hucho taimen clone ZA-43 microsatellite sequence. 34 0.001 4
(CP000496) Pichia stipitis CBS 6054 chromosome 2, complete s... 34 0.002 3
(FE858369) CAFX1087.rev CAFX Pichia stipitis oxygen limited ... 34 0.003 3
(AL402472) T3 end of clone AT0AA002C04 of library AT0AA from... 30 0.003 5
(DQ121072) Hucho taimen clone ZA-66 microsatellite sequence. 32 0.003 4
(DQ120970) Hucho taimen clone ZB-24 microsatellite sequence. 32 0.007 4
(EB324296) CNSN01-F-102315-501 Normalized CNS library (juven... 36 0.010 4
(AU053361) Dictyostelium discoideum slug cDNA, clone SLI462. 32 0.010 4
(AY160106) Dictyostelium discoideum nucleotide exchange fact... 40 0.018 3
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.020 14
(DQ121082) Hucho taimen clone ZA-77 microsatellite sequence. 32 0.025 4
(DQ120972) Hucho taimen clone ZB-27 microsatellite sequence. 32 0.028 4
(AM472053) Vitis vinifera, whole genome shotgun sequence, co... 40 0.031 4
(FF747001) XABT56748.fwd Gateway compatible cien cDNA librar... 32 0.031 4
(AM470640) Vitis vinifera contig VV78X257621.3, whole genome... 30 0.032 3
(FG398822) 020927KSFA007270HT (KSFA) A. deliciosa small frui... 40 0.038 2
(FG397785) 021001KSFA008587HT (KSFA) A. deliciosa small frui... 40 0.041 2
(FG399059) 020927KSFA008249HT (KSFA) A. deliciosa small frui... 40 0.042 2
(FG397630) 021001KSFA008800HT (KSFA) A. deliciosa small frui... 40 0.042 2
(FG398136) 020917KSFA005869HT (KSFA) A. deliciosa small frui... 40 0.042 2
(FG398898) 020927KSFA007770HT (KSFA) A. deliciosa small frui... 40 0.043 2
(FG397621) 021001KSFA008812HT (KSFA) A. deliciosa small frui... 40 0.043 2
(CT107751) Sus scrofa genomic clone PigE-106A2, genomic surv... 52 0.048 1
(BJ421619) Dictyostelium discoideum cDNA clone:ddv43d11, 5' ... 36 0.070 3
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 32 0.082 16
(CU463283) Zebrafish DNA sequence from clone CH211-226M13. 28 0.088 3
(FM992695) Candida dubliniensis CD36 chromosome R, complete ... 42 0.099 2
(AM454401) Vitis vinifera contig VV78X018665.2, whole genome... 44 0.13 3
(DQ120998) Hucho taimen clone ZB-8 microsatellite sequence. 32 0.16 4
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 34 0.18 12
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 32 0.19 13
(AX485858) Sequence 3158 from Patent WO02053728. 50 0.19 1
(CO545357) LyEST13477 Sea lamprey LyEST Petromyzon marinus c... 38 0.22 2
(AC083775) Homo sapiens chromosome 7 clone RP11-776N22 map 7... 38 0.23 6
(FM992688) Candida dubliniensis CD36 chromosome 1, complete ... 38 0.25 18
(EJ980762) 1093022152127 Global-Ocean-Sampling_GS-30-02-01-1... 30 0.30 4
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 32 0.30 10
(AE014296) Drosophila melanogaster chromosome 3L, complete s... 36 0.31 2
(AE014134) Drosophila melanogaster chromosome 2L, complete s... 36 0.31 2
(CZ279902) cp08d02.f Candida parapsilosis Random Genomic Lib... 34 0.35 4
(CP000770) Candidatus Sulcia muelleri GWSS, complete genome. 40 0.38 8
(AC010107) Drosophila melanogaster 3L BAC RP98-2B1 (Roswell ... 36 0.42 2
(AC091220) Drosophila melanogaster 3L BAC RP98-7E7 (Roswell ... 36 0.42 2
(AC014376) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 36 0.42 2
(AC011063) Drosophila melanogaster, chromosome 2L, region 25... 36 0.42 2
(AC008007) Genomic sequence for Arabidopsis thaliana BAC F12... 34 0.43 2
(CT009657) Medicago truncatula chromosome 5 clone mte1-18m20... 34 0.43 2
(AC015158) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 36 0.43 2
(AC010572) Drosophila melanogaster clone RPCI98-11N15, *** S... 36 0.43 2
(AC212011) Medicago truncatula clone mth2-160b4, complete se... 34 0.43 2
(BM159495) EST562018 PyBS Plasmodium yoelii yoelii cDNA clon... 42 0.44 2
(AC016571) Homo sapiens chromosome 5 clone CTB-109A12, compl... 36 0.44 2
(AC087771) Genomic Sequence for Medicago truncatula, clone 8... 34 0.44 2
(CQ586445) Sequence 14203 from Patent WO0171042. 36 0.48 2
(CS133215) Sequence 37 from Patent WO2005061736. 36 0.48 2
(CQ597005) Sequence 24763 from Patent WO0171042. 36 0.49 2
(BT001300) Drosophila melanogaster AT12326 full insert cDNA. 36 0.50 2
(BT011427) Drosophila melanogaster SD06669 full insert cDNA. 36 0.50 2
(CQ597006) Sequence 24764 from Patent WO0171042. 36 0.50 2
(BQ875543) QGI8G16.yg.ab1 QG_ABCDI lettuce salinas Lactuca s... 30 0.51 4
(AC232323) Homo sapiens BAC clone RP11-689L16 from chromosom... 32 0.51 9
(BT022140) Drosophila melanogaster IP01538 full insert cDNA. 36 0.52 2
(X98766) D.melanogaster mRNA for H15 protein. 36 0.52 2
(CQ586446) Sequence 14204 from Patent WO0171042. 36 0.52 2
(GC527637) Sequence 1147 from patent US 7411051. 36 0.52 2
(EA744898) Sequence 1147 from patent US 7368531. 36 0.52 2
(GC530628) Sequence 4138 from patent US 7411051. 36 0.52 2
(EA747889) Sequence 4138 from patent US 7368531. 36 0.52 2
(CQ879118) Sequence 21 from Patent EP1464653. 36 0.52 2
(BD394551) 125 Human Secreted Proteins. 36 0.52 2
(BC022570) Homo sapiens chromosome 5 open reading frame 40, ... 36 0.53 2
(AL067821) Drosophila melanogaster genome survey sequence T7... 36 0.54 2
(CG972711) MBEME20TR mth2 Medicago truncatula genomic clone ... 34 0.54 2
(EL872170) IP04137.3prime IP Drosophila melanogaster iPCR Am... 36 0.54 2
(DT002009) Mdrta1013L10.g1 Apple_EST_Mdrta Malus x domestica... 36 0.55 2
(BI623004) RH55060.5prime RH Drosophila melanogaster normali... 36 0.55 2
(EB144283) 010930ABDA006504HT (ABDA) Royal Gala fruit stored... 36 0.55 2
(ES543089) Kr_K05_03C18_attB1_seq K05 Euphausia superba cDNA... 32 0.55 3
(AQ841540) T137067b shotgun sub-library of BAC clone 42I11 M... 34 0.55 2
(DB571241) Homo sapiens hypothalamus cDNA, RIKEN full-length... 36 0.56 2
(DB565462) Homo sapiens hypothalamus cDNA, RIKEN full-length... 36 0.56 2
(DB565445) Homo sapiens hypothalamus cDNA, RIKEN full-length... 36 0.56 2
(BI617366) RH47689.5prime RH Drosophila melanogaster normali... 36 0.56 2
(AL437280) T7 end of clone BC0AA008D07 of library BC0AA from... 32 0.57 3
(AC115592) Dictyostelium discoideum chromosome 2 map 1-12595... 32 0.58 10
(DU223874) 1098574154348 CHORI-243 Ovis aries genomic clone ... 42 0.60 2
(AV999633) Ciona intestinalis cDNA, clone:cicl27l12, 5' end,... 32 0.64 3
(AR549632) Sequence 4763 from patent US 6747137. 36 0.65 3
(EJ947592) 1093018921829 Global-Ocean-Sampling_GS-30-02-01-1... 30 0.67 4
(BQ854081) QGB22E19.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 30 0.68 4
(AV962678) Ciona intestinalis cDNA, clone:cilv05e12, 5' end,... 32 0.69 3
(AM438365) Vitis vinifera contig VV78X052512.11, whole genom... 38 0.69 3
(FE770270) CCAG5489.g1 CCAG Petrolisthes cinctipes heart, gi... 42 0.71 2
(EJ641110) 1093011898696 Global-Ocean-Sampling_GS-29-01-01-1... 38 0.71 2
(BW249566) Ciona intestinalis cDNA, clone:citb082d19, 5' end... 32 0.74 3
(AM482627) Vitis vinifera contig VV78X192257.5, whole genome... 48 0.75 1
(AM477635) Vitis vinifera contig VV78X209346.3, whole genome... 48 0.75 1
(CR940353) Theileria annulata genomic DNA chromosome 4. 48 0.75 1
(ER857327) POTJZ64TF Solanum tuberosum RHPOTKEY BAC ends Sol... 48 0.75 1
(CU750031) A BAC library has been constructed from PN40024 g... 48 0.75 1
(DT036473) VVL116E08_694572 CabSau Berry Postveraison Mixed ... 48 0.75 1
(BJ324947) Dictyostelium discoideum cDNA clone:dda8g23, 5' e... 36 0.79 3
(FH668124) CHO_OF5021xb21r1.ab1 CHO_OF5 Nicotiana tabacum ge... 42 0.80 2
(AM475454) Vitis vinifera contig VV78X016520.13, whole genom... 46 0.81 2
(BW335572) Ciona intestinalis cDNA, clone:cidg851f15, 5'end,... 32 0.82 3
(AB102779) Dictyostelium discoideum kin2 mRNA for kinesin-re... 32 0.89 5
(FF753516) XABT61286.fwd Gateway compatible cien cDNA librar... 32 0.89 3
(BW035294) Ciona intestinalis cDNA, clone:cibd028f16, 5' end... 32 0.90 3
(BW251013) Ciona intestinalis cDNA, clone:citb088l19, 5' end... 32 0.93 3
(AM442748) Vitis vinifera contig VV78X076072.5, whole genome... 40 0.93 4
(BW265801) Ciona intestinalis cDNA, clone:cign041o10, 5' end... 32 0.93 3
(BJ325077) Dictyostelium discoideum cDNA clone:dda9f18, 5' e... 36 0.96 3
(BJ389791) Dictyostelium discoideum cDNA clone:dds20g02, 5' ... 32 0.99 3
(AC229706) Medicago truncatula clone mth2-4p23, WORKING DRAF... 40 0.99 3
(BJ360362) Dictyostelium discoideum cDNA clone:ddc5p18, 5' e... 36 1.0 3
(BP000526) Ciona intestinalis cDNA, clone:cicl31p12, 5' end,... 32 1.0 3
(BW265514) Ciona intestinalis cDNA, clone:cign040o10, 5' end... 32 1.0 3
(BJ359246) Dictyostelium discoideum cDNA clone:ddc13e14, 5' ... 36 1.0 3
(BW193819) Ciona intestinalis cDNA, clone:cicl101p23, 5' end... 32 1.0 3
(BW259047) Ciona intestinalis cDNA, clone:cign001j16, 5' end... 32 1.1 3
(BW356110) Ciona intestinalis cDNA, clone:cima808p03, 5'end,... 32 1.1 3
(BW366248) Ciona intestinalis cDNA, clone:cima837p13, 5'end,... 32 1.1 3
(CS353529) Sequence 8 from Patent WO2006071219. 36 1.2 2
(GM979577) Sequence 8 from Patent EP2003205. 36 1.2 2
(AR641418) Sequence 8 from patent US 6858778. 36 1.2 2
(BW478868) Ciona intestinalis cDNA, clone:cima019h17, 5'end,... 32 1.2 3
(CS353528) Sequence 7 from Patent WO2006071219. 36 1.2 2
(GM979576) Sequence 7 from Patent EP2003205. 36 1.2 2
(AR641417) Sequence 7 from patent US 6858778. 36 1.2 2
(FF727420) XABT42759.fwd Gateway compatible cien cDNA librar... 32 1.2 3
(CP000883) Hemiselmis andersenii chromosome 3, complete sequ... 36 1.3 7
(AC115612) Dictyostelium discoideum chromosome 2 map 6245135... 34 1.3 8
(EK080612) 1092961101709 Global-Ocean-Sampling_GS-31-01-01-1... 38 1.4 3
(CZ282546) cp24h09.f Candida parapsilosis Random Genomic Lib... 34 1.4 3
(AE017308) Mycoplasma mobile 163K complete genome. 34 1.4 17
(AC150207) Medicago truncatula chromosome 2 clone mte1-29a5,... 40 1.5 6
(DL263932) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS. 42 1.5 2
(DJ130381) Method for identification of useful proteins deri... 42 1.5 2
(AC149204) Medicago truncatula chromosome 7 clone mth2-77n20... 40 1.5 5
(AC007814) Drosophila melanogaster, chromosome 3R, region 91... 36 1.5 2
(FL102939) 4199597 CERES-298 Zea mays cDNA clone 984291 5', ... 36 1.5 2
(AC007891) Drosophila melanogaster, chromosome 3R, region 91... 36 1.5 2
(FL102944) 4203443 CERES-298 Zea mays cDNA clone 988078 5', ... 36 1.6 2
(CD442623) EL01N0414A07.b Endosperm_4 Zea mays cDNA, mRNA se... 36 1.6 2
(FL102943) 4211185 CERES-298 Zea mays cDNA clone 995692 5', ... 36 1.6 2
(AF057048) Uroleucon rudbeckiae NADH dehydrogenase subunit 1... 30 1.6 4
(FL102940) 4206595 CERES-298 Zea mays cDNA clone 991102 5', ... 36 1.6 2
(AC017841) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 36 1.7 2
(BM166851) EST569385 PyBS Plasmodium yoelii yoelii cDNA clon... 36 1.7 2
(EJ705411) 1092956051633 Global-Ocean-Sampling_GS-30-02-01-1... 34 1.7 3
(CZ545298) SRAA-aad61a09.b1 Strongyloides ratti whole genome... 34 1.8 3
(CN598279) TTE00007846 Normalized large Tetrahymena thermoph... 34 1.8 3
(CZ528927) SRAA-aac58c02.b1 Strongyloides ratti whole genome... 32 1.8 3
(BA000021) Wigglesworthia glossinidia endosymbiont of Glossi... 34 1.8 14
(AU261463) Dictyostelium discoideum vegetative cDNA clone:VS... 30 1.8 3
(AM457573) Vitis vinifera contig VV78X205010.11, whole genom... 38 1.8 4
(CA172039) SCSFSB1070B12.g SB1 Saccharum officinarum cDNA cl... 38 1.8 2
(AC214186) Homo sapiens chromosome 8 clone ABC9-43849100P14,... 32 1.8 5
(AU060996) Dictyostelium discoideum slug cDNA, clone SLC554. 34 1.8 3
(AY623113) Homo sapiens origin recognition complex, subunit ... 38 1.8 5
(CQ613400) Sequence 41158 from Patent WO0171042. 36 1.8 2
(BJ332791) Dictyostelium discoideum cDNA clone:dda40i19, 5' ... 30 1.8 3
(CQ613401) Sequence 41159 from Patent WO0171042. 36 1.9 2
(AY221112) Acetivibrio cellulolyticus cellulosomal scaffoldi... 32 1.9 2
(CD992094) QBA109d01.xg QBA Zea mays cDNA clone QBA109d01, m... 36 2.0 2
(AL406818) T3 end of clone AU0AA012D12 of library AU0AA from... 34 2.0 2
(EK530011) 1095516005737 Global-Ocean-Sampling_GS-32-01-01-1... 28 2.0 4
(AE014835) Plasmodium falciparum 3D7 chromosome 10 section 7... 42 2.0 6
(AZ156028) SP_0010_B2_B08_T7 Strongylocentrotus purpuratus, ... 36 2.0 2
(CO465664) MZCCL20037H06.g Maize Endosperm cDNA Library Zea ... 36 2.0 2
(AR988203) Sequence 3 from patent US 7119255. 36 2.1 2
(CD445862) EL01T0204E09.b Endosperm_4 Zea mays cDNA, mRNA se... 36 2.1 2
(EJ054260) 1095456017670 Global-Ocean-Sampling_GS-26-01-01-1... 36 2.1 3
(CF014301) QBL14e07.xg QBL Zea mays cDNA clone QBL14e07, mRN... 36 2.1 2
(AC115599) Dictyostelium discoideum chromosome 2 map 4229098... 34 2.1 9
(AC023390) Homo sapiens chromosome 8 clone RP11-96G1 map 8, ... 32 2.1 7
(CD442338) EL01N0408B07.b Endosperm_4 Zea mays cDNA, mRNA se... 36 2.1 2
(CD992533) QBA1g08.yg QBA Zea mays cDNA clone QBA1g08, mRNA ... 36 2.2 2
(CD992440) QBA1b09.yg QBA Zea mays cDNA clone QBA1b09, mRNA ... 36 2.2 2
(CD999956) QBG10d06.xg QBG Zea mays cDNA clone QBG10d06, mRN... 36 2.2 2
(CD992351) QBA111e06.xg QBA Zea mays cDNA clone QBA111e06, m... 36 2.2 2
(CF001935) QBG7f05.xg QBG Zea mays cDNA clone QBG7f05, mRNA ... 36 2.2 2
(CF022147) QBQ06h09.xg QBQ Zea mays cDNA clone QBQ06h09, mRN... 36 2.2 2
(CF001750) QBG6a11.xg QBG Zea mays cDNA clone QBG6a11, mRNA ... 36 2.2 2
(CF001884) QBG7b11.xg QBG Zea mays cDNA clone QBG7b11, mRNA ... 36 2.2 2
(CD448704) EK07D2305D12.b Endosperm_6 Zea mays cDNA, mRNA se... 36 2.3 2
(C84755) Dictyostelium discoideum slug cDNA, clone SSF324. 32 2.3 3
(FK061723) XABT124901.b1 Gateway compatible cien cDNA librar... 30 2.3 3
(AI812147) 605087H03.y1 605 - Endosperm cDNA library from Sc... 36 2.3 2
(CO465212) MZCCS20032C02.g Maize Endosperm cDNA Library Zea ... 36 2.4 2
(AM457154) Vitis vinifera contig VV78X012943.3, whole genome... 36 2.4 3
(CO467356) MZCCL20047G03.g Maize Endosperm cDNA Library Zea ... 36 2.4 2
(CF000727) QBG18f12.xg QBG Zea mays cDNA clone QBG18f12, mRN... 36 2.5 2
(FE118604) LV_HC_RA068K12r Litopenaeus vannamei hemocyte cDN... 36 2.5 2
(CF000828) QBG19g02.xg QBG Zea mays cDNA clone QBG19g02, mRN... 36 2.5 2
(CD443345) EL01N0425B05.b Endosperm_4 Zea mays cDNA, mRNA se... 36 2.5 2
(CD448737) EK07D2305H07.b Endosperm_6 Zea mays cDNA, mRNA se... 36 2.6 2
(CD444773) EL01N0443G09.b Endosperm_4 Zea mays cDNA, mRNA se... 36 2.6 2
(BJ366220) Dictyostelium discoideum cDNA clone:ddc38o03, 5' ... 34 2.7 3
(CO463627) MZCCL20034H09.g Maize Endosperm cDNA Library Zea ... 36 2.7 2
(CO459345) MZCCS15019E12.g Maize Endosperm cDNA Library Zea ... 36 2.7 2
(AC115684) Dictyostelium discoideum chromosome 2 map 3108975... 34 2.7 6
(CD995519) QBB25h06.xg QBB Zea mays cDNA clone QBB25h06, mRN... 36 2.7 2
(AC116032) Dictyostelium discoideum chromosome 2 map 4158743... 46 2.7 4
(CO461923) MZCCL20027A04.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CO461096) MZCCS20024F01.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CD443326) EL01N0424H05.b Endosperm_4 Zea mays cDNA, mRNA se... 36 2.8 2
(DQ121074) Hucho taimen clone ZA-68 microsatellite sequence. 32 2.8 3
(CO459228) MZCCL20021B09.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CO465561) MZCCS20033C02.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CO469162) MZCCL20048D12.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(FI261092) CccaBb058-M21JF CccABb Cajanus cajan genomic clon... 44 2.8 2
(CO466672) MZCCS20043B02.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CO460459) MZCCL15026F11.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CO463480) MZCCL20033B02.g Maize Endosperm cDNA Library Zea ... 36 2.8 2
(CO463040) MZCCS20029C02.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(AC222914) Bos taurus clone CH240-434J17, WORKING DRAFT SEQU... 38 2.9 3
(CO463477) MZCCL20033A11.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO455298) MZCCS20001G02.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO463206) MZCCS20030B05.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CD433201) EL01N0305G10.b Endosperm_3 Zea mays cDNA, mRNA se... 36 2.9 2
(CO460968) MZCCL15030G07.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO463272) MZCCS20030H08.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO466340) MZCCL20035C05.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO455662) MZCCL20006C05.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CD433827) EL01N0315F05.b Endosperm_3 Zea mays cDNA, mRNA se... 36 2.9 2
(CO466840) MZCCL20010A05.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO464675) MZCCS15038F04.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(AC219763) Bos taurus clone CH240-323I8, WORKING DRAFT SEQUE... 38 2.9 8
(CO458341) MZCCS15015F08.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO463676) MZCCL15037A04.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO462238) MZCCS20026F10.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO457002) MZCCL20011D12.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO469332) MZCCS15042D09.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO460484) MZCCL15028B07.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO466633) MZCCS20042F07.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO461557) MZCCS15024G11.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO462450) MZCCS15027B10.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO455321) MZCCS20002A02.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO456974) MZCCL20011B05.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO465875) MZCCL20039F03.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO462152) MZCCS20027F08.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO468339) MZCCS20049A02.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO455098) MZCCL20004A04.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO461276) MZCCL15031B06.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO463595) MZCCL20034E08.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO461781) MZCCL20028D04.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO456964) MZCCL20011A05.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO466399) MZCCL20035H09.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO468079) MZCCL20051A04.g Maize Endosperm cDNA Library Zea ... 36 2.9 2
(CO462758) MZCCL20029H03.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO461823) MZCCL20028H04.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO456750) MZCCS20007D08.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO463002) MZCCL20032G08.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO457014) MZCCL20011F03.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(DV165935) ZM_BFb0163C18.r ZM_BFb Zea mays cDNA 5', mRNA seq... 36 3.0 2
(CO465634) MZCCL20037D03.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO466309) MZCCL20036H06.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO458440) MZCCS20013H02.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(AC158646) Mus musculus 10 BAC RP23-471J13 (Roswell Park Can... 46 3.0 1
(AC153972) Mus musculus 10 BAC RP24-383P4 (Roswell Park Canc... 46 3.0 1
(AC200155) Pongo abelii BAC clone CH276-360C12 from chromoso... 46 3.0 1
(AC198791) Pongo abelii BAC clone CH276-239N18 from chromoso... 46 3.0 1
(BT065705) Zea mays full-length cDNA clone ZM_BFc0035A23 mRN... 46 3.0 1
(AP009546) Solanum lycopersicum DNA, chromosome 8, clone: C0... 46 3.0 1
(AP008212) Oryza sativa (japonica cultivar-group) genomic DN... 46 3.0 1
(AP003767) Oryza sativa Japonica Group genomic DNA, chromoso... 46 3.0 1
(AP003487) Oryza sativa Japonica Group genomic DNA, chromoso... 46 3.0 1
(DL235749) NOVEL COMPOSITIONS AND METHODS FOR CANCER. 46 3.0 1
(DD164448) NOVEL COMPOSITIONS AND METHODS FOR CANCER. 46 3.0 1
(CS788878) Sequence 134 from Patent WO2005031001. 46 3.0 1
(AX695668) Sequence 1295 from Patent WO03008583. 46 3.0 1
(AJ570523) Drosophila simulans X chromosome fragment, ID 348... 46 3.0 1
(AC092018) Homo sapiens chromosome 1 clone RP11-543G21, comp... 46 3.0 1
(AC018509) Homo sapiens chromosome 10 clone RP11-307B23, com... 46 3.0 1
(AC007001) Homo sapiens BAC clone RP11-486P11 from 7, comple... 46 3.0 1
(AC149841) Papio anubis clone RP41-101H15, WORKING DRAFT SEQ... 46 3.0 1
(CU856060) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.0 1
(CU855724) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.0 1
(CU469043) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.0 1
(AL591683) Human DNA sequence *** SEQUENCING IN PROGRESS ***... 46 3.0 1
(AL591114) Human DNA sequence *** SEQUENCING IN PROGRESS ***... 46 3.0 1
(AC226460) Chlorocebus aethiops clone CH252-293L15, WORKING ... 46 3.0 1
(AC214317) Chlorocebus aethiops clone CH252-13P24, WORKING D... 46 3.0 1
(AZ731867) RPCI-24-117P4.TJ RPCI-24 Mus musculus genomic clo... 46 3.0 1
(ER599650) 1093016237941 Global-Ocean-Sampling_GS-36-01-01-2... 46 3.0 1
(ER512222) 1093015457048 Global-Ocean-Sampling_GS-35-01-01-1... 46 3.0 1
(ER501613) 1093015400371 Global-Ocean-Sampling_GS-35-01-01-1... 46 3.0 1
(ER371728) 1093025053078 Global-Ocean-Sampling_GS-34-01-01-1... 46 3.0 1
(EK269575) 1095462249724 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.0 1
(EJ102358) 1092963204142 Global-Ocean-Sampling_GS-26-02-01-1... 46 3.0 1
(EI806191) MUGQ_CH252P253A05T7_CN515_031 CHORI-252 Vervet Mo... 46 3.0 1
(EI751794) CHORI520R122M14TR BAC library from the breast cel... 46 3.0 1
(CU975275) Brassica napus GSS, clone JBnB062H01, end read, p... 46 3.0 1
(CT242478) Sus scrofa genomic clone PigE-3J20, genomic surve... 46 3.0 1
(CT105638) Sus scrofa genomic clone PigE-69J21, genomic surv... 46 3.0 1
(CR878045) Sus scrofa BES. 46 3.0 1
(EB603862) AGENCOURT_54722624 D. grimshawi EST Drosophila gr... 46 3.0 1
(DR610978) EST1001106 FvG Gibberella moniliformis cDNA clone... 46 3.0 1
(DR604237) EST994365 FvG Gibberella moniliformis cDNA clone ... 46 3.0 1
(BU319903) 603850513F1 CSEQCHN62 Gallus gallus cDNA clone Ch... 46 3.0 1
(CD433819) EL01N0315E08.b Endosperm_3 Zea mays cDNA, mRNA se... 36 3.0 2
(CO466817) MZCCS20044G03.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO464232) MZCCL15044G04.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO465873) MZCCL20039E12.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO459586) MZCCL20022B10.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO457484) MZCCL20014F04.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO456980) MZCCL20011B11.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO459852) MZCCL15016D04.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO466614) MZCCS20042D12.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO460687) MZCCL20023B07.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO467095) MZCCL20046A10.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO457489) MZCCL20014F09.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO459593) MZCCL20022C06.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO464354) MZCCS15031B04.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO455405) MZCCS20002H06.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO457799) MZCCS20011F05.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO467207) MZCCS20045E07.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO468216) MZCCS20048F05.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO467482) MZCCL20009C12.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO461895) MZCCL20026F10.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO459043) MZCCL20019H02.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO448373) MZCCL15005E05.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO469405) MZCCS20051C05.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO466932) MZCCL20044A11.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO457831) MZCCL20015A06.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO466196) MZCCS20036F04.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO462749) MZCCL20029G03.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO456221) MZCCS20005C06.g Maize Endosperm cDNA Library Zea ... 36 3.0 2
(CO468026) MZCCL20050C12.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO456232) MZCCS20005D05.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO463325) MZCCS15030E07.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO461643) MZCCS20021G06.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO460747) MZCCL20023H05.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO462916) MZCCL20030G08.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO461487) MZCCS15024A01.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO459595) MZCCL20022C08.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO463289) MZCCS15030B01.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(EB165730) ZM_BFb0341L07.r ZM_BFb Zea mays cDNA 5', mRNA seq... 36 3.1 2
(CO461012) MZCCL15029E08.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO458844) MZCCS20016F01.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO467164) MZCCL20046H09.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO464868) MZCCL15047C06.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO457190) MZCCL20013B06.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO465345) MZCCS20034F07.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO462760) MZCCL20029H05.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO461841) MZCCL20026A11.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO469151) MZCCL20048C10.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO465993) MZCCL20042A09.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO456988) MZCCL20011C08.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO460381) MZCCL15025A05.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO455066) MZCCL15008D07.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO457189) MZCCL20013B05.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO468072) MZCCL20050H04.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO468816) MZCCS20047B09.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO464200) MZCCL15044B05.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO458485) MZCCL20016D04.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO458091) MZCCS15013C09.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO466843) MZCCL20010A08.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO458849) MZCCS20016F07.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO458159) MZCCL20017C04.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO463072) MZCCS20029F03.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO464028) MZCCL15040A09.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO456680) MZCCS15007F03.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO457853) MZCCL20015C07.g Maize Endosperm cDNA Library Zea ... 36 3.1 2
(CO463756) MZCCL15036C05.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(CD433570) EL01N0312E07.b Endosperm_3 Zea mays cDNA, mRNA se... 36 3.2 2
(BU830858) T014A04 Populus apical shoot cDNA library Populus... 28 3.2 4
(EX308609) GQ01308.T3_J03 GQ013 - Elongating ROOTS tips - sa... 38 3.2 2
(BJ421004) Dictyostelium discoideum cDNA clone:ddv41k09, 5' ... 30 3.2 3
(BJ339214) Dictyostelium discoideum cDNA clone:dda64e16, 5' ... 30 3.2 3
(CO463303) MZCCS15030C07.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(CO448301) MZCCM15001H06.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(CO456276) MZCCS20005H06.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(BJ330059) Dictyostelium discoideum cDNA clone:dda27b08, 5' ... 34 3.2 3
(AR988202) Sequence 1 from patent US 7119255. 36 3.2 2
(CO461232) MZCCL15032C06.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(CO456165) MZCCS20008F06.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(CO456704) MZCCS15007H06.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(CO456113) MZCCS20008A12.g Maize Endosperm cDNA Library Zea ... 36 3.2 2
(BV007371) LS566 Meadowfoam genomic DNA Limnanthes alba STS ... 32 3.2 3
(AL396452) T3 end of clone AR0AA030D05 of library AR0AA from... 40 3.3 2
(CA175816) SCJLST1023A12.g ST1 Saccharum officinarum cDNA cl... 38 3.3 2
(AL429420) clone BA0AB031E11 of library BA0AB from strain CL... 36 3.3 2
(CD435217) EL01N0356H03.b Endosperm_3 Zea mays cDNA, mRNA se... 36 3.3 2
(BJ330250) Dictyostelium discoideum cDNA clone:dda27k19, 5' ... 32 3.3 3
(CO464301) MZCCL15046C03.g Maize Endosperm cDNA Library Zea ... 36 3.3 2
(AR549920) Sequence 5051 from patent US 6747137. 38 3.4 3
(BJ329007) Dictyostelium discoideum cDNA clone:dda30m10, 5' ... 32 3.4 3
(BJ422454) Dictyostelium discoideum cDNA clone:ddv45p23, 5' ... 30 3.4 3
(FM992693) Candida dubliniensis CD36 chromosome 6, complete ... 34 3.4 18
(AA680947) LmFrAm0555 Leishmania major Amastigote Lambda Zap... 30 3.4 3
(AF279874) Homo sapiens chromosome 8 clone CTD-2351C9 map q2... 32 3.5 7
(FF774059) XABT75277.fwd Gateway compatible cien cDNA librar... 32 3.6 3
(AA680946) LmFrAm0554 Leishmania major Amastigote Lambda Zap... 30 3.6 3
(AM425430) Vitis vinifera contig VV78X103645.24, whole genom... 40 3.7 2
(BJ425212) Dictyostelium discoideum cDNA clone:ddv55a03, 5' ... 30 3.7 3
(BT062750) Zea mays full-length cDNA clone ZM_BFb0341L07 mRN... 36 3.8 2
(AM431090) Vitis vinifera contig VV78X131719.5, whole genome... 38 3.8 3
(BT017556) Zea mays clone EL01N0424H05.c mRNA sequence. 36 3.8 2
(AF371263) Zea mays 50kD gamma zein mRNA, complete cds. 36 3.9 2
(CS353522) Sequence 1 from Patent WO2006071219. 36 3.9 2
(GM979570) Sequence 1 from Patent EP2003205. 36 3.9 2
(AR641414) Sequence 1 from patent US 6858778. 36 3.9 2
(BJ337076) Dictyostelium discoideum cDNA clone:dda56l06, 5' ... 30 3.9 3
(FP016182) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 38 3.9 5
(BT016357) Zea mays clone Contig190 mRNA sequence. 36 4.0 2
(AM461728) Vitis vinifera contig VV78X122650.10, whole genom... 34 4.0 3
(AY104069) Zea mays PCO155483 mRNA sequence. 36 4.0 2
(FF785106) XABT82900.fwd Gateway compatible cien cDNA librar... 32 4.0 3
(AC177117) Strongylocentrotus purpuratus clone R3-4014D20, W... 38 4.4 7
(DQ120965) Hucho taimen clone ZB-19 microsatellite sequence. 30 4.4 3
(AK116673) Ciona intestinalis cDNA, clone:cicl031p12, full i... 32 4.5 3
(AC150246) Medicago truncatula chromosome 2 clone mth2-4c5, ... 38 4.6 6
(CP001393) Anaerocellum thermophilum DSM 6725, complete genome. 32 4.6 2
(AM398681) Flavobacterium psychrophilum JIP02/86 complete ge... 34 4.6 2
(AC093897) Homo sapiens BAC clone RP11-721G13 from 4, comple... 38 4.6 4
(AC024127) Homo sapiens chromosome 11 clone pac255-m-19 map ... 38 4.9 2
(AE014850) Plasmodium falciparum 3D7 chromosome 12, section ... 34 5.2 9
(AC212600) Macaca mulatta BAC CH250-82N3 (Children's Hospit... 34 5.3 5
(AL354795) Human DNA sequence from clone RP11-174B4 on chrom... 36 5.3 7
(AC172386) Strongylocentrotus purpuratus clone R3-14P15, WOR... 42 5.4 4
(AC222506) Bos taurus clone CH240-420B23, WORKING DRAFT SEQU... 32 5.6 2
(AY449462) Oikopleura dioica clone BACOIKO006 3xn11, complet... 34 5.6 2
(AC009534) Drosophila melanogaster, chromosome 2L, region 27... 34 5.6 2
(AC195798) Zea mays chromosome 8 clone CH201-224O19; ZMMBBc0... 38 5.6 6
(AU270305) Dictyostelium discoideum vegetative cDNA clone:VS... 28 5.6 4
(AC017528) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 34 5.8 2
(CU019583) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 5.9 8
(AC123817) Mus musculus BAC clone RP24-255D13 from chromosom... 40 5.9 5
(AM445707) Vitis vinifera contig VV78X057418.2, whole genome... 38 6.1 5
(BJ348296) Dictyostelium discoideum cDNA clone:dda32e19, 3' ... 30 6.2 3
(ER287786) 1092343580964 Global-Ocean-Sampling_GS-34-01-01-1... 30 6.3 3
(CQ581681) Sequence 9439 from Patent WO0171042. 34 6.3 2
(AL138849) Human DNA sequence from clone RP5-965L7 on chromo... 36 6.4 9
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 34 6.4 18
(AY521251) Aleurodicus dugesii mitochondrion, complete genome. 34 6.4 2
(EB409111) HPA-N-S01-0208-LF Hepatopancrease library Penaeus... 34 6.5 2
(CL578124) OB__Ba0033J06.r OB__Ba Oryza brachyantha genomic ... 34 6.7 2
(AC213921) Populus trichocarpa clone POP006-K20, complete se... 38 6.7 3
(AF155197) Acetivibrio cellulolyticus cellulosomal scaffoldi... 32 6.7 2
(EJ451348) 1093015426654 Global-Ocean-Sampling_GS-28-01-01-1... 32 6.8 3
(BD460310) Diagnosis of Diseases Associated with Cell Cycle. 34 6.8 2
(BD452232) Diagnosis of Diseases Associated with Cell Cycle. 34 6.8 2
(AX348969) Sequence 427 from Patent WO0202807. 34 6.8 2
(AX344232) Sequence 79 from Patent WO0200926. 34 6.8 2
(AX251846) Sequence 107 from Patent WO0168911. 34 6.8 2
(AX458523) Sequence 69 from Patent WO0246454. 34 6.8 2
(AU074688) Dictyostelium discoideum slug cDNA, clone SSL551. 30 6.9 3
(BJ348080) Dictyostelium discoideum cDNA clone:dda32j01, 3' ... 30 6.9 3

>(BJ401710) Dictyostelium discoideum cDNA clone:dds19l04, 3' end,
single read.
Length = 614

Score = 765 bits (386), Expect(2) = 0.0
Identities = 386/386 (100%)
Strand = Plus / Minus


Query: 491 ataattatcaagcaaatgggcaattggttgacccaaattcaataccaaaaccaccaaatg 550
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 614 ataattatcaagcaaatgggcaattggttgacccaaattcaataccaaaaccaccaaatg 555


Query: 551 taacagtagatcaatgggcatacgctctttcaaataatcctgatccttcaatattaatac 610
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 554 taacagtagatcaatgggcatacgctctttcaaataatcctgatccttcaatattaatac 495


Query: 611 cagttgcagctaaatcatttgatgatttaattaatagaagaatgaaacaagaagaaacaa 670
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 494 cagttgcagctaaatcatttgatgatttaattaatagaagaatgaaacaagaagaaacaa 435


Query: 671 ttatagcattagatcaaaatacacaagaagcgttaaagagaatgagagatttagaaaatc 730
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 434 ttatagcattagatcaaaatacacaagaagcgttaaagagaatgagagatttagaaaatc 375


Query: 731 atttaaattttcatattcatacacaattggaaatgatgagaaagaaacaaattgaattga 790
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 374 atttaaattttcatattcatacacaattggaaatgatgagaaagaaacaaattgaattga 315


Query: 791 ttcaacgttatattgaagtttggtcaaatttagagatttatcaaagtaaaggtaaaacat 850
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 314 ttcaacgttatattgaagtttggtcaaatttagagatttatcaaagtaaaggtaaaacat 255


Query: 851 ttacaacaagtgaagaaagaattatg 876
||||||||||||||||||||||||||
Sbjct: 254 ttacaacaagtgaagaaagaattatg 229

Score = 438 bits (221), Expect(2) = 0.0
Identities = 221/221 (100%)
Strand = Plus / Minus


Query: 884 tctatgaattattcgaagagattaatcaaccaaattcaattaaatcaaaagtcgaagaaa 943
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 221 tctatgaattattcgaagagattaatcaaccaaattcaattaaatcaaaagtcgaagaaa 162


Query: 944 tctcgaatcaattgaaattaggttcaatggaaaaagagaaaattaaatatgaaatttcac 1003
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 161 tctcgaatcaattgaaattaggttcaatggaaaaagagaaaattaaatatgaaatttcac 102


Query: 1004 cagaagccgtcgaaccactttataatcttttaaaaaatatgactatttcaattgaacgta 1063
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 101 cagaagccgtcgaaccactttataatcttttaaaaaatatgactatttcaattgaacgta 42


Query: 1064 taacaaatgaattggaaattgctgtaaaagatgctcaaatt 1104
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 41 taacaaatgaattggaaattgctgtaaaagatgctcaaatt 1

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 1,553,395,684
Number of extensions: 108259952
Number of successful extensions: 9850867
Number of sequences better than 10.0: 545
Length of query: 1143
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 1119
Effective length of database: 99,340,224,878
Effective search space: 111161711638482
Effective search space used: 111161711638482
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.14
Homology vs Protein
Query= Contig-U00705-1 (Contig-U00705-1Q) /CSM_Contig/Contig-U00705-1Q.Seq.d
(1143 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

FM992695_227(FM992695|pid:none) Candida dubliniensis CD36 chromo... 59 4e-07
(O42963) RecName: Full=Nucleoporin nup44; AltName: Full=Nuclear ... 58 5e-07
D89269_1(D89269|pid:none) Schizosaccharomyces pombe mRNA, partia... 58 5e-07
CR380958_209(CR380958|pid:none) Candida glabrata strain CBS138 c... 58 5e-07
BC135328_1(BC135328|pid:none) Xenopus tropicalis nucleoporin 54,... 58 7e-07
FN357690_9(FN357690|pid:none) Schistosoma mansoni genome sequenc... 57 9e-07
(Q8BTS4) RecName: Full=Nucleoporin p54; AltName: Full=54 kDa nuc... 57 1e-06
BC060003_1(BC060003|pid:none) Xenopus laevis hypothetical protei... 57 1e-06
FN392322_366(FN392322|pid:none) Pichia pastoris GS115 chromosome... 57 2e-06
CU928174_185(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 56 2e-06
(P70582) RecName: Full=Nucleoporin p54; AltName: Full=54 kDa nuc... 56 3e-06
BT045518_1(BT045518|pid:none) Salmo salar clone ssal-rgf-523-346... 55 4e-06
AK300036_1(AK300036|pid:none) Homo sapiens cDNA FLJ52746 complet... 55 4e-06
AK223352_1(AK223352|pid:none) Homo sapiens mRNA for nucleoporin ... 55 5e-06
AK299442_1(AK299442|pid:none) Homo sapiens cDNA FLJ60840 complet... 55 6e-06
AM270168_47(AM270168|pid:none) Aspergillus niger contig An08c013... 54 8e-06
BC114015_1(BC114015|pid:none) Bos taurus nucleoporin 54kDa, mRNA... 54 1e-05
(Q9V6B9) RecName: Full=Probable nucleoporin Nup54; &AE013599_15... 53 2e-05
CU928170_593(CU928170|pid:none) Kluyveromyces thermotolerans str... 53 2e-05
BT029947_1(BT029947|pid:none) Drosophila melanogaster IP16983 fu... 53 2e-05
CR382127_657(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 51 7e-05
AE016814_291(AE016814|pid:none) Ashbya gossypii (= Eremothecium ... 50 1e-04
CR382122_455(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 49 3e-04
CP001034_1349(CP001034|pid:none) Natranaerobius thermophilus JW/... 48 6e-04
T30010(T30010) hypothetical protein F58G4.1 - Caenorhabditis ele... 48 6e-04
AL683874_14(AL683874|pid:none) Aspergillus fumigatus BAC AfA14E5. 47 0.001
T23420(T23420) hypothetical protein K07F5.13a - Caenorhabditis e... 46 0.003
T23422(T23422) hypothetical protein K07F5.13b - Caenorhabditis e... 46 0.003
AM446570_1(AM446570|pid:none) Vitis vinifera contig VV78X034573.... 44 0.008
(P58301) RecName: Full=DNA double-strand break repair rad50 ATPa... 44 0.008
Z72905_1(Z72905|pid:none) S.cerevisiae chromosome VII reading fr... 44 0.008
(P48837) RecName: Full=Nucleoporin NUP57; AltName: Full=Nuclear ... 44 0.008
CP000771_291(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 44 0.011
CP000771_697(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 42 0.041
CP000728_474(CP000728|pid:none) Clostridium botulinum F str. Lan... 41 0.069
CR926392_1(CR926392|pid:none) Xenopus tropicalis finished cDNA, ... 41 0.091
AC002396_25(AC002396|pid:none) Arabidopsis thaliana chromosome I... 40 0.12
BX538002_1(BX538002|pid:none) Homo sapiens mRNA; cDNA DKFZp686B1... 40 0.12
FN357337_20(FN357337|pid:none) Schistosoma mansoni genome sequen... 40 0.12
CP001393_1103(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 40 0.12
CP001581_487(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 40 0.12
AY810645_1(AY810645|pid:none) Schistosoma japonicum SJCHGC08846 ... 40 0.12
AP006628_691(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 40 0.12
CP000923_199(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 40 0.15
CP000924_1961(CP000924|pid:none) Thermoanaerobacter pseudethanol... 40 0.15
BC148068_1(BC148068|pid:none) Bos taurus nudE nuclear distributi... 40 0.20
AL606654_1(AL606654|pid:none) Oryza sativa genomic DNA, chromoso... 40 0.20
AL844509_254(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 40 0.20
AE017350_100(AE017350|pid:none) Cryptococcus neoformans var. neo... 40 0.20
CU928178_658(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 40 0.20
AM494940_72(AM494940|pid:none) Leishmania braziliensis chromosom... 39 0.26
(P08964) RecName: Full=Myosin-1; AltName: Full=Type II myosin; ... 39 0.26
AL035475_17(AL035475|pid:none) Plasmodium falciparum MAL4P2. &A... 39 0.26
BA000001_1852(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 39 0.26
(Q54N50) RecName: Full=Dynactin subunit 2; 39 0.34
CP001279_1054(CP001279|pid:none) Nautilia profundicola AmH, comp... 39 0.34
AY583360_1(AY583360|pid:none) Borrelia garinii strain N34 P-83/1... 39 0.34
AE016819_519(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 39 0.34
AM412317_472(AM412317|pid:none) Clostridium botulinum A str. ATC... 39 0.34
BA000045_3562(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 39 0.45
CP000962_479(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 39 0.45
FN357333_10(FN357333|pid:none) Schistosoma mansoni genome sequen... 39 0.45
BC144320_1(BC144320|pid:none) Homo sapiens coiled-coil domain co... 38 0.59
AF022655_1(AF022655|pid:none) Homo sapiens cep250 centrosome ass... 38 0.59
AK303192_1(AK303192|pid:none) Homo sapiens cDNA FLJ56275 complet... 38 0.59
AB201172_1(AB201172|pid:none) Homo sapiens GRDN mRNA for girdin,... 38 0.59
AY318871_156(AY318871|pid:none) Canarypox virus strain ATCC VR-1... 38 0.59
CP000721_1143(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 38 0.59
AF049105_1(AF049105|pid:none) Homo sapiens centrosomal Nek2-asso... 38 0.59
(Q9BV73) RecName: Full=Centrosome-associated protein CEP250; Alt... 38 0.59
BC132736_1(BC132736|pid:none) Homo sapiens coiled-coil domain co... 38 0.59
AE001273_367(AE001273|pid:none) Chlamydia trachomatis D/UW-3/CX,... 38 0.59
BC078168_1(BC078168|pid:none) Homo sapiens coiled-coil domain co... 38 0.59
(A6UTV9) RecName: Full=Probable thymidylate kinase; EC=... 38 0.59
(Q96KP6) RecName: Full=TNFAIP3-interacting protein 3; AltName: F... 38 0.59
CP001634_186(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 38 0.59
AF277289_1(AF277289|pid:none) Homo sapiens putative Listeria-ind... 38 0.59
AK290409_1(AK290409|pid:none) Homo sapiens cDNA FLJ76250 complet... 38 0.59
(Q3V6T2) RecName: Full=Girdin; AltName: Full=Girders of actin fi... 38 0.59
AK301058_1(AK301058|pid:none) Homo sapiens cDNA FLJ55864 complet... 38 0.59
FN357481_3(FN357481|pid:none) Schistosoma mansoni genome sequenc... 38 0.77
AM884176_611(AM884176|pid:none) Chlamydia trachomatis strain L2/... 38 0.77
AB266188_1(AB266188|pid:none) Plasmodium cynomolgi msp1 gene for... 38 0.77
AB266192_1(AB266192|pid:none) Plasmodium cynomolgi msp1 gene for... 38 0.77
CP001251_887(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 38 0.77
(O30189) Uncharacterized protein AF_0047. &AE000782_46(AE000782... 38 0.77
CP000246_2515(CP000246|pid:none) Clostridium perfringens ATCC 13... 38 0.77
AB266186_1(AB266186|pid:none) Plasmodium cynomolgi msp1 gene for... 38 0.77
AB266189_1(AB266189|pid:none) Plasmodium cynomolgi msp1 gene for... 38 0.77
CP000777_1019(CP000777|pid:none) Leptospira biflexa serovar Pato... 38 0.77
CR855029_5(CR855029|pid:none) Oryza sativa (indica cultivar-grou... 38 0.77
(Q9X1X1) RecName: Full=Probable DNA double-strand break repair r... 38 0.77
AE015927_509(AE015927|pid:none) Clostridium tetani E88, complete... 38 0.77
AB266196_1(AB266196|pid:none) Plasmodium cynomolgi msp1 gene for... 38 0.77
(Q8CDI7) RecName: Full=Coiled-coil domain-containing protein 150... 38 0.77
(O44199) RecName: Full=DNA repair protein rad-50; EC=3.... 38 0.77
AC116920_30(AC116920|pid:none) Dictyostelium discoideum chromoso... 37 1.0
AY010670_1(AY010670|pid:none) Drosophila simulans isolate Sim2 A... 37 1.0
AY010671_1(AY010671|pid:none) Drosophila simulans isolate Sim3 A... 37 1.0
CP001047_47(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, c... 37 1.0
CP001229_1223(CP001229|pid:none) Sulfurihydrogenibium azorense A... 37 1.0
DQ916328_1(DQ916328|pid:none) Borrelia garinii strain Tom 5202 p... 37 1.0
CP000743_970(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 37 1.0
BC095849_1(BC095849|pid:none) Rattus norvegicus similar to chrom... 37 1.0
EF547865_1(EF547865|pid:none) Plasmodium vivax isolate 1021 32 k... 37 1.3
AY902464_1(AY902464|pid:none) Xenopus laevis TPR (TPR) mRNA, par... 37 1.3
CP001322_1297(CP001322|pid:none) Desulfatibacillum alkenivorans ... 37 1.3
AM263198_2452(AM263198|pid:none) Listeria welshimeri serovar 6b ... 37 1.3
BC153839_1(BC153839|pid:none) Bos taurus caspase recruitment dom... 37 1.3
(Q9C438) RecName: Full=Autophagy-related protein 11; AltName: Fu... 37 1.3
AB055861_1(AB055861|pid:none) Procambarus clarkii I-con mRNA for... 37 1.3
AP009179_1735(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 37 1.3
AK096713_1(AK096713|pid:none) Homo sapiens cDNA FLJ39394 fis, cl... 37 1.3
CP000609_236(CP000609|pid:none) Methanococcus maripaludis C5, co... 37 1.3
DQ321780_1(DQ321780|pid:none) Trichomonas vaginalis strain NIH-C... 37 1.3
AL844504_249(AL844504|pid:none) Plasmodium falciparum 3D7 chromo... 37 1.3
DQ016663_1(DQ016663|pid:none) Borrelia garinii strain p35 P83/10... 37 1.3
(Q8CIS0) RecName: Full=Caspase recruitment domain-containing pro... 37 1.3
AK131134_1(AK131134|pid:none) Mus musculus mRNA for mFLJ00120 pr... 37 1.3
BC077128_1(BC077128|pid:none) Danio rerio homer homolog 1 (Droso... 37 1.7
EU262891_79(EU262891|pid:none) Oenothera parviflora chloroplast,... 37 1.7
U09214_1(U09214|pid:none) Borrelia garinii p93 gene, complete cds. 37 1.7
(O70156) RecName: Full=Oxidized low-density lipoprotein receptor... 37 1.7
AE017196_413(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 37 1.7
CR626903_2(CR626903|pid:none) Zebrafish DNA sequence from clone ... 37 1.7
CR548612_182(CR548612|pid:none) Paramecium tetraurelia macronucl... 37 1.7
DQ916332_1(DQ916332|pid:none) Borrelia garinii strain Tom 2903 p... 37 1.7
CR626903_1(CR626903|pid:none) Zebrafish DNA sequence from clone ... 37 1.7
AX468280_1(AX468280|pid:none) Sequence 67 from Patent WO0216422.... 37 1.7
AF039187_1(AF039187|pid:none) Schistosoma japonicum myosin mRNA,... 37 1.7
AB280018_1(AB280018|pid:none) Molgula tectiformis Mt-MHC2 mRNA f... 37 1.7
CP000124_1093(CP000124|pid:none) Burkholderia pseudomallei 1710b... 36 2.2
CP000570_946(CP000570|pid:none) Burkholderia pseudomallei 668 ch... 36 2.2
DQ286057_1(DQ286057|pid:none) Hydra vulgaris myosin heavy chain ... 36 2.2
AY583361_1(AY583361|pid:none) Borrelia garinii strain G25 P-83/1... 36 2.2
CP000771_1073(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 36 2.2
S61464(S61464;S72308)p83/100 protein - Lyme disease spirochete (... 36 2.2
(Q60563) RecName: Full=Synaptonemal complex protein 1; ... 36 2.2
AL844505_127(AL844505|pid:none) Plasmodium falciparum 3D7 chromo... 36 2.2
CP000312_189(CP000312|pid:none) Clostridium perfringens SM101, c... 36 2.2
X77749_1(X77749|pid:none) B.burgdorferi gene for P97-protein. 36 2.2
AC116957_105(AC116957|pid:none) Dictyostelium discoideum chromos... 36 2.2
AM502249_361(AM502249|pid:none) Leishmania infantum chromosome 31. 36 2.9
CT005268_296(CT005268|pid:none) Leishmania major strain Friedlin... 36 2.9
AP006628_380(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 36 2.9
AY135367_1(AY135367|pid:none) Mus musculus caspase recruitment d... 36 2.9
BC157669_1(BC157669|pid:none) Xenopus tropicalis hypothetical pr... 36 2.9
FN357525_5(FN357525|pid:none) Schistosoma mansoni genome sequenc... 36 2.9
CP001403_1107(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 36 2.9
DQ916326_1(DQ916326|pid:none) Borrelia garinii strain Tom 3101 p... 36 2.9
(Q836W6) RecName: Full=Exodeoxyribonuclease 7 large subunit; ... 36 2.9
CP000969_1282(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 36 2.9
CP001124_312(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 36 2.9
(O66834) RecName: Full=DNA repair protein recN; AltName: Full=Re... 36 2.9
AF281870_1(AF281870|pid:none) Mus musculus Syne-1B mRNA, partial... 36 2.9
AE017245_496(AE017245|pid:none) Mycoplasma synoviae 53, complete... 36 2.9
FN357719_21(FN357719|pid:none) Schistosoma mansoni genome sequen... 36 2.9
DQ916319_1(DQ916319|pid:none) Borrelia garinii strain Nov 105 p8... 36 2.9
CR382137_797(CR382137|pid:none) Debaryomyces hansenii strain CBS... 36 2.9
AP007151_1246(AP007151|pid:none) Aspergillus oryzae RIB40 genomi... 36 2.9
CP000227_4526(CP000227|pid:none) Bacillus cereus Q1, complete ge... 36 2.9
CP000702_1140(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 36 2.9
FJ897525_1(FJ897525|pid:none) Bombyx mandarina clone B myosin he... 36 2.9
EF101928_447(EF101928|pid:none) Acanthocystis turfacea Chlorella... 35 3.8
BT069060_1(BT069060|pid:none) Zea mays full-length cDNA clone ZM... 35 3.8
(Q555I8) RecName: Full=Kinesin-related protein 9; AltName: Full=... 35 3.8
AE001362_157(AE001362|pid:none) Plasmodium falciparum 3D7 chromo... 35 3.8
DQ653303_1(DQ653303|pid:none) Arabidopsis thaliana clone 0000010... 35 3.8
AP009049_1151(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 35 3.8
AP009240_1417(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 35 3.8
BX293980_441(BX293980|pid:none) Mycoplasma mycoides subsp. mycoi... 35 3.8
AM398681_810(AM398681|pid:none) Flavobacterium psychrophilum JIP... 35 3.8
CP001142_378(CP001142|pid:none) Phaeodactylum tricornutum CCAP 1... 35 3.8
DQ446981_1(DQ446981|pid:none) Arabidopsis thaliana clone pENTR22... 35 3.8
AE017347_144(AE017347|pid:none) Cryptococcus neoformans var. neo... 35 3.8
(A8MPV3) RecName: Full=Putative uncharacterized protein ENSP0000... 35 3.8
CP000815_629(CP000815|pid:none) Paulinella chromatophora chromat... 35 3.8
CP001034_2282(CP001034|pid:none) Natranaerobius thermophilus JW/... 35 3.8
DQ059011_2(DQ059011|pid:none) Samia cynthia ricini NADH dehydrog... 35 5.0
AY010583_1(AY010583|pid:none) Drosophila melanogaster isolate Se... 35 5.0
CP001037_2963(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 35 5.0
U85759_1(U85759|pid:none) Drosophila melanogaster accessory glan... 35 5.0
BC115276_1(BC115276|pid:none) Danio rerio wu:fb15e04, mRNA (cDNA... 35 5.0
CP001175_89(CP001175|pid:none) Listeria monocytogenes HCC23, com... 35 5.0
AY010588_1(AY010588|pid:none) Drosophila melanogaster isolate WS... 35 5.0
AY010584_1(AY010584|pid:none) Drosophila melanogaster isolate WS... 35 5.0
CP000679_1519(CP000679|pid:none) Caldicellulosiruptor saccharoly... 35 5.0
AY346403_1(AY346403|pid:none) Streptococcus pyogenes strain JS19... 35 5.0
AE006641_984(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 35 5.0
AB264661_1(AB264661|pid:none) Papilio xuthus mRNA for muscle myo... 35 5.0
AY010585_1(AY010585|pid:none) Drosophila melanogaster isolate WS... 35 5.0
AJ243902_1(AJ243902|pid:none) Mycoplasma hominis p75 gene, strai... 35 5.0
AF145666_1(AF145666|pid:none) Drosophila melanogaster clone GH11... 35 5.0
AY346417_1(AY346417|pid:none) Streptococcus pyogenes strain JS95... 35 5.0
AY346393_1(AY346393|pid:none) Streptococcus pyogenes strain JS14... 35 5.0
AY010586_1(AY010586|pid:none) Drosophila melanogaster isolate WS... 35 5.0
AK117759_1(AK117759|pid:none) Arabidopsis thaliana At3g17680 mRN... 35 5.0
AJ131892_1(AJ131892|pid:none) Gallus gallus mRNA for Hyperion pr... 35 5.0
FM992695_367(FM992695|pid:none) Candida dubliniensis CD36 chromo... 35 5.0
(Q4UJ79) RecName: Full=Coiled-coil domain-containing protein 29;... 35 5.0
CP001357_1905(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 35 5.0
CP000084_902(CP000084|pid:none) Candidatus Pelagibacter ubique H... 35 5.0
BC100346_1(BC100346|pid:none) Mus musculus protein tyrosine phos... 35 5.0
AY010579_1(AY010579|pid:none) Drosophila melanogaster isolate Se... 35 5.0
CP001104_1013(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 35 5.0
(Q9V3R1) RecName: Full=Accessory gland protein Acp36DE; Flags: P... 35 5.0
AF453997_1(AF453997|pid:none) Tetrahymena thermophila protein ty... 35 5.0
AE015450_321(AE015450|pid:none) Mycoplasma gallisepticum strain ... 35 5.0
FM992692_166(FM992692|pid:none) Candida dubliniensis CD36 chromo... 35 5.0
AY505274_1(AY505274|pid:none) Drosophila mauritiana isolate 75 a... 35 5.0
AM910993_5(AM910993|pid:none) Plasmodium knowlesi strain H chrom... 35 6.5
FN357667_8(FN357667|pid:none) Schistosoma mansoni genome sequenc... 35 6.5
(P51834) RecName: Full=Chromosome partition protein smc; &G6970... 35 6.5
CR380948_105(CR380948|pid:none) Candida glabrata strain CBS138 c... 35 6.5
BT059484_1(BT059484|pid:none) Salmo salar clone ssal-rgf-520-115... 35 6.5
AY010673_1(AY010673|pid:none) Drosophila simulans isolate Sim7 A... 35 6.5
CP001146_777(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 35 6.5
AL844506_295(AL844506|pid:none) Plasmodium falciparum 3D7 chromo... 35 6.5
AE008384_712(AE008384|pid:none) Methanosarcina mazei strain Goe1... 35 6.5
AY505221_1(AY505221|pid:none) Drosophila sechellia isolate 77 25... 35 6.5
AE015927_1098(AE015927|pid:none) Clostridium tetani E88, complet... 35 6.5
FN357667_11(FN357667|pid:none) Schistosoma mansoni genome sequen... 35 6.5
FN357667_12(FN357667|pid:none) Schistosoma mansoni genome sequen... 35 6.5
AE016817_753(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 35 6.5
AY010672_1(AY010672|pid:none) Drosophila simulans isolate Sim4 A... 35 6.5
AY505222_1(AY505222|pid:none) Drosophila sechellia isolate 81 ac... 35 6.5
FN357667_9(FN357667|pid:none) Schistosoma mansoni genome sequenc... 35 6.5
CP001056_442(CP001056|pid:none) Clostridium botulinum B str. Ekl... 35 6.5
AL009126_1651(AL009126|pid:none) Bacillus subtilis subsp. subtil... 35 6.5
AY505219_1(AY505219|pid:none) Drosophila sechellia isolate 24 ac... 35 6.5
CP000246_195(CP000246|pid:none) Clostridium perfringens ATCC 131... 35 6.5
(A6GYR0) RecName: Full=2',3'-cyclic-nucleotide 2'-phosphodiester... 35 6.5
CP000849_511(CP000849|pid:none) Rickettsia bellii OSU 85-389, co... 35 6.5
AY010669_1(AY010669|pid:none) Drosophila simulans isolate Sim1 A... 35 6.5
CR857546_1(CR857546|pid:none) Pongo abelii mRNA; cDNA DKFZp469L0... 35 6.5
AY505218_1(AY505218|pid:none) Drosophila sechellia isolate 15 ac... 35 6.5
AK302306_1(AK302306|pid:none) Homo sapiens cDNA FLJ59579 complet... 35 6.5
AY505270_1(AY505270|pid:none) Drosophila mauritiana isolate 105 ... 35 6.5
AY010674_1(AY010674|pid:none) Drosophila simulans isolate Sim8 A... 35 6.5
FJ029108_1(FJ029108|pid:none) Bombyx mori clone B myosin heavy c... 35 6.5
(Q6CT90) RecName: Full=Eukaryotic translation initiation factor ... 35 6.5
AY505275_1(AY505275|pid:none) Drosophila mauritiana isolate bowl... 35 6.5
BX649567_4(BX649567|pid:none) Human DNA sequence from clone RP11... 35 6.5
AY505272_1(AY505272|pid:none) Drosophila mauritiana isolate 207 ... 35 6.5
FN357667_10(FN357667|pid:none) Schistosoma mansoni genome sequen... 35 6.5
AJ224893_1(AJ224893|pid:none) Dictyostelium discoideum srfA gene. 34 8.5
(P08799) RecName: Full=Myosin-2 heavy chain; AltName: Full=Myosi... 34 8.5
DQ916324_1(DQ916324|pid:none) Borrelia garinii strain Mng 4702 p... 34 8.5
CP000721_1234(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 34 8.5
AY505217_1(AY505217|pid:none) Drosophila sechellia isolate 11 ac... 34 8.5
AB275402_1(AB275402|pid:none) Saurida wanieso wMYH1 mRNA for myo... 34 8.5
AY810340_1(AY810340|pid:none) Schistosoma japonicum SJCHGC01885 ... 34 8.5
CR380950_222(CR380950|pid:none) Candida glabrata strain CBS138 c... 34 8.5
CP000679_486(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 34 8.5
AB472675_1(AB472675|pid:none) Oryzias latipes mMYHL2 mRNA for my... 34 8.5
FN357431_10(FN357431|pid:none) Schistosoma mansoni genome sequen... 34 8.5
AE000657_847(AE000657|pid:none) Aquifex aeolicus VF5, complete g... 34 8.5
BX908798_45(BX908798|pid:none) Parachlamydia-related symbiont UW... 34 8.5
T13829(T13829) Tpr homolog - fruit fly (Drosophila melanogaster)... 34 8.5
X65591_1(X65591|pid:none) S.mansoni mRNA for myosin II heavy cha... 34 8.5
S33068(S33068)myosin heavy chain - fluke (Schistosoma mansoni) (... 34 8.5
S28061(S28061) SCP1 protein - rat &X67805_1(X67805|pid:none) 34 8.5
AJ276471_1(AJ276471|pid:none) Tetrahymena thermophila mRNA for t... 34 8.5
AJ243901_1(AJ243901|pid:none) Mycoplasma hominis p75 gene, strai... 34 8.5
A26655(A26655;A24728;S00250) myosin heavy chain [similarity] - s... 34 8.5
BA000016_216(BA000016|pid:none) Clostridium perfringens str. 13 ... 34 8.5
AJ243768_1(AJ243768|pid:none) Notothenia coriiceps partial mRNA ... 34 8.5
DQ916344_1(DQ916344|pid:none) Borrelia afzelii strain Tom 2403 p... 34 8.5
AM910996_572(AM910996|pid:none) Plasmodium knowlesi strain H chr... 34 8.5
CP001251_1558(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 34 8.5
FM992692_446(FM992692|pid:none) Candida dubliniensis CD36 chromo... 34 8.5
AM263198_2454(AM263198|pid:none) Listeria welshimeri serovar 6b ... 34 8.5
(Q03410) RecName: Full=Synaptonemal complex protein 1; ... 34 8.5

>FM992695_227(FM992695|pid:none) Candida dubliniensis CD36 chromosome
R, complete sequence.
Length = 616

Score = 58.5 bits (140), Expect = 4e-07
Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 7/179 (3%)
Frame = +1

Query: 535 PKPPNVTVDQWAYALSNNPDPSILIPVAAKSFDDLINRRMKQEETIIA----LDQNTQEA 702
P+P N + + W A+ + P P+ P+ SF+D + +R++ + +A L N E
Sbjct: 365 PRPINESAEDWENAMISRPGPN-YYPIKVNSFND-VGQRIETQLDYVAKSRILLNNINEN 422

Query: 703 LKRM---RDLENHLNFHIHTQLEMMRKKQIELIQRYIEVWSNLEIYQSKGKTFTTSEERI 873
L + DLEN T++ + + I+L +R + + + L I + KG EE I
Sbjct: 423 LNNLSSQHDLEN------TTRIMKAKSRHIKLSRRLLRLATILAIVKLKGYPLLPEEEEI 476

Query: 874 MKKIYELFEEINQPNSIKSKVEEISNQLKLGSMEKEKIKYEISPEAVEPLYNLLKNMTI 1050
K+ L ++N PNS K+ ++ +L + E+ Y+ E NLL N I
Sbjct: 477 SKQFELLTSKLNDPNSSIGKLSDVFARLAILKERAEEFNYQ-----CENSVNLLNNTLI 530

Lambda K H
0.315 0.131 0.359

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,316,748,112
Number of extensions: 24122857
Number of successful extensions: 119832
Number of sequences better than 10.0: 273
Number of HSP's gapped: 118205
Number of HSP's successfully gapped: 281
Length of query: 381
Length of database: 1,051,180,864
Length adjustment: 130
Effective length of query: 251
Effective length of database: 630,428,194
Effective search space: 158237476694
Effective search space used: 158237476694
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.53 gvh: 0.43 alm: 0.49 top: 0.53 tms: 0.00 mit: 0.23 mip: 0.05
nuc: 0.06 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: nuclear
36.0 %: cytoplasmic
12.0 %: mitochondrial
8.0 %: vesicles of secretory system
4.0 %: cytoskeletal

>> prediction for Contig-U00705-1 is nuc

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 1
CH (FL, L) 0
CF (FL, S) 1
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0