| Contig-U15133-1 |
| Contig ID |
Contig-U15133-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
738 |
| Chromosome number (1..6, M) |
6 |
| Chromosome length |
3595308 |
| Start point |
2532018 |
| End point |
2531281 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
29 |
| Number of EST |
32 |
| Link to clone list |
U15133 |
| List of clone(s) |
est1=VSD711Z,1,730
est2=VSD146Z,3,312
est3=VSI117E,3,719
est4=VSH332E,8,720
est5=VSJ757Z,8,734
est6=FC-BD04Z,9,731
est7=VSJ757F,10,579
est8=VSH778Z,13,717
est9=FC-AM05E,15,719
est10=VSG446E,15,680
est11=VSH778F,15,557
est12=VSI723E,16,679
est13=VSD464E,18,720
est14=VSE880E,25,733
est15=FC-BF22Z,36,726
est16=VSK151F,53,567
est17=FC-AX15Z,55,724
est18=VSB209Z,57,738
est19=FC-AV12Z,69,726
est20=VSA309Z,108,737
est21=FC-BC07Z,112,731
est22=VSC233Z,115,732
est23=SLB674Z,173,738
est24=SLC844Z,177,738
est25=VSE179Z,181,738
est26=FC-AT21Z,185,731
est27=SLD433Z,229,731
est28=SLH802E,241,736
est29=VSI801F,293,738
est30=VSI801Z,293,729
est31=FC-AT14E,407,722
est32=SLA575E,488,733
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1.13 |
| Homology vs DNA |
Query= Contig-U15133-1 (Contig-U15133-1Q) /CSM_Contig/Contig-U15133-1Q.Seq.d
(738 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(U78756) Dictyostelium discoideum RpgG (rpgG) mRNA, complete... 1021 0.0 6
(AU284562) Dictyostelium discoideum gamete cDNA clone:FC-BD0... 1021 0.0 6
(AU284547) Dictyostelium discoideum gamete cDNA clone:FC-BC0... 1021 0.0 3
(AU284465) Dictyostelium discoideum gamete cDNA clone:FC-AX1... 1021 0.0 5
(AU284437) Dictyostelium discoideum gamete cDNA clone:FC-AV1... 1021 0.0 5
(AU284330) Dictyostelium discoideum gamete cDNA clone:FC-AM0... 1021 0.0 6
(AU264443) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 4
(AU264077) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 4
(AU263452) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 5
(AU262417) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 3
(AU261890) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 5
(AU261411) Dictyostelium discoideum vegetative cDNA clone:VS... 1021 0.0 4
(AU267960) Dictyostelium discoideum vegetative cDNA clone:VS... 1011 0.0 6
(AU269141) Dictyostelium discoideum vegetative cDNA clone:VS... 1003 0.0 6
(AU266494) Dictyostelium discoideum vegetative cDNA clone:VS... 989 0.0 5
(AU284641) Dictyostelium discoideum gamete cDNA clone:FC-BF2... 981 0.0 5
(AU270425) Dictyostelium discoideum vegetative cDNA clone:VS... 900 0.0 5
(AU267278) Dictyostelium discoideum vegetative cDNA clone:VS... 807 0.0 5
(AU033969) Dictyostelium discoideum slug cDNA, clone SLB674. 1007 0.0 1
(AU034416) Dictyostelium discoideum slug cDNA, clone SLC844. 999 0.0 1
(AU262926) Dictyostelium discoideum vegetative cDNA clone:VS... 993 0.0 1
(AU264076) Dictyostelium discoideum vegetative cDNA clone:VS... 809 0.0 6
(AU268175) Dictyostelium discoideum vegetative cDNA clone:VS... 807 0.0 3
(AU284417) Dictyostelium discoideum gamete cDNA clone:FC-AT2... 969 0.0 1
(AU270424) Dictyostelium discoideum vegetative cDNA clone:VS... 507 0.0 8
(AU267277) Dictyostelium discoideum vegetative cDNA clone:VS... 539 0.0 7
(AU267959) Dictyostelium discoideum vegetative cDNA clone:VS... 763 0.0 6
(AU270720) Dictyostelium discoideum vegetative cDNA clone:VS... 781 0.0 5
(AU052506) Dictyostelium discoideum slug cDNA, clone SLD433. 896 0.0 1
(AU039443) Dictyostelium discoideum slug cDNA, clone SLH802. 872 0.0 1
(AU060208) Dictyostelium discoideum slug cDNA, clone SLA575. 864 0.0 1
(AU269247) Dictyostelium discoideum vegetative cDNA clone:VS... 779 0.0 1
(AU269246) Dictyostelium discoideum vegetative cDNA clone:VS... 779 0.0 1
(AU269140) Dictyostelium discoideum vegetative cDNA clone:VS... 274 0.0 8
(AU266493) Dictyostelium discoideum vegetative cDNA clone:VS... 289 0.0 7
(AU268174) Dictyostelium discoideum vegetative cDNA clone:VS... 274 0.0 7
(AU284413) Dictyostelium discoideum gamete cDNA clone:FC-AT1... 513 e-141 1
(AU263550) Dictyostelium discoideum vegetative cDNA clone:VS... 262 e-128 6
(C83954) Dictyostelium discoideum slug cDNA, clone SLA575. 168 6e-59 5
(DJ207647) Method for identification of useful proteins deri... 58 1e-17 4
(DB645816) Saccharomyces cerevisiae mRNA, clone: S03052-41_C... 58 2e-17 4
(BW635030) Dugesia ryukyuensis mRNA, clone: Dr_sW_001_B17, 5... 82 7e-17 2
(BW636368) Dugesia ryukyuensis mRNA, clone: Dr_sW_005_E02, 5... 82 7e-17 2
(BW639673) Dugesia ryukyuensis mRNA, clone: Dr_sW_015_K05, 5... 82 7e-17 2
(BW639869) Dugesia ryukyuensis mRNA, clone: Dr_sW_016_F02, 5... 82 7e-17 2
(BW637368) Dugesia ryukyuensis mRNA, clone: Dr_sW_008_E21, 5... 82 7e-17 2
(BW639731) Dugesia ryukyuensis mRNA, clone: Dr_sW_015_N11, 5... 82 7e-17 2
(BB923203) Trifolium pratense cDNA clone:RCE30742. 66 1e-16 5
(EC761728) PSE00002354 rw_mgpallid Polysphondylium pallidum ... 56 5e-16 3
(DB647193) Saccharomyces cerevisiae mRNA, clone: S03052-47_O... 50 8e-16 4
(DB662667) Saccharomyces cerevisiae mRNA, clone: Y080_H07_F.... 50 2e-15 4
(DB660686) Saccharomyces cerevisiae mRNA, clone: Y064_G01_F.... 50 2e-15 4
(DB660122) Saccharomyces cerevisiae mRNA, clone: Y059_K07_F.... 50 2e-15 4
(DB658116) Saccharomyces cerevisiae mRNA, clone: Y045_F21_F.... 50 2e-15 4
(DB655433) Saccharomyces cerevisiae mRNA, clone: Y028_B01_F.... 50 2e-15 4
(DB653938) Saccharomyces cerevisiae mRNA, clone: Y015_I14_F.... 50 2e-15 4
(DB661965) Saccharomyces cerevisiae mRNA, clone: Y075_A08_F.... 50 2e-15 4
(DB662209) Saccharomyces cerevisiae mRNA, clone: Y077_D03_F.... 50 2e-15 4
(DB666307) Saccharomyces cerevisiae mRNA, clone: Y104_H06_F.... 50 2e-15 4
(DB664144) Saccharomyces cerevisiae mRNA, clone: Y090_I02_F.... 50 2e-15 4
(DB664509) Saccharomyces cerevisiae mRNA, clone: Y092_P06_F.... 50 2e-15 4
(DB661347) Saccharomyces cerevisiae mRNA, clone: Y069_G19_F.... 50 2e-15 4
(DB655867) Saccharomyces cerevisiae mRNA, clone: Y030_P07_F.... 50 2e-15 4
(DB663087) Saccharomyces cerevisiae mRNA, clone: Y083_C08_F.... 50 2e-15 4
(DB653983) Saccharomyces cerevisiae mRNA, clone: Y015_M17_F.... 50 2e-15 4
(DB653589) Saccharomyces cerevisiae mRNA, clone: Y013_G23_F.... 50 2e-15 4
(DB664390) Saccharomyces cerevisiae mRNA, clone: Y092_E01_F.... 50 2e-15 4
(DB658983) Saccharomyces cerevisiae mRNA, clone: Y050_K18_F.... 50 2e-15 4
(DB658317) Saccharomyces cerevisiae mRNA, clone: Y046_G10_F.... 50 2e-15 4
(DB667218) Saccharomyces cerevisiae mRNA, clone: Y109_H21_F.... 50 2e-15 4
(DB666684) Saccharomyces cerevisiae mRNA, clone: Y106_I19_F.... 50 2e-15 4
(DB662020) Saccharomyces cerevisiae mRNA, clone: Y075_G19_F.... 50 2e-15 4
(DB664523) Saccharomyces cerevisiae mRNA, clone: Y093_B14_F.... 50 2e-15 4
(DB661705) Saccharomyces cerevisiae mRNA, clone: Y073_H11_F.... 50 2e-15 4
(DB667255) Saccharomyces cerevisiae mRNA, clone: Y109_K11_F.... 50 2e-15 4
(DQ331506) Synthetic construct Saccharomyces cerevisiae clon... 50 2e-15 4
(D25285) Saccharomyces cerevisiae mRNA for ribosomal protein... 50 3e-15 4
(AX073126) Sequence 237 from Patent WO0102550. 50 1e-14 4
(CK994815) 040D04R1.3A ESTHcyl Hebeloma cylindrosporum cDNA ... 60 3e-14 3
(U34347) Saccharomyces cerevisiae ribosomal protein S3 (RPS3... 50 8e-14 4
(Z71454) S.cerevisiae chromosome XIV reading frame ORF YNL178w. 50 9e-14 4
(DJ134440) Method for identification of useful proteins deri... 50 1e-13 5
(BB908257) Trifolium pratense cDNA clone:RCE06840. 66 3e-12 4
(BB914827) Trifolium pratense cDNA clone:RCE14438. 66 3e-12 4
(BB922581) Trifolium pratense cDNA clone:RCE29911. 66 3e-12 4
(BB911605) Trifolium pratense cDNA clone:RCE10738. 66 3e-12 4
(CT804771) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT816985) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT819749) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(EE006256) ROE00003401 Rhizopus oryzae Company Rhizopus oryz... 62 2e-11 3
(CT805708) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT817619) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(BM171118) EST573641 PyBS Plasmodium yoelii yoelii cDNA clon... 60 2e-11 4
(BM161502) EST564025 PyBS Plasmodium yoelii yoelii cDNA clon... 60 2e-11 4
(CT787987) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT803171) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT800972) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT790542) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT778718) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
(CT775946) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 2e-11 4
>(U78756) Dictyostelium discoideum RpgG (rpgG) mRNA, complete cds.
Length = 690
Score = 1021 bits (515), Expect(6) = 0.0
Identities = 515/515 (100%)
Strand = Plus / Plus
Query: 166 ggtttaactgaaatcatcatccgtgcttcaaagacccaagctgttgttggtccaaacgct 225
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 142 ggtttaactgaaatcatcatccgtgcttcaaagacccaagctgttgttggtccaaacgct 201
Query: 226 cgtcgtatccaagaactctgctctttagtccaaaagagattcaacttcaaagaaggtacc 285
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 202 cgtcgtatccaagaactctgctctttagtccaaaagagattcaacttcaaagaaggtacc 261
Query: 286 gtcgttctctttgctgaaaaaatcttaaacagaggtttatgtgccgtcgctcaagctgaa 345
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 262 gtcgttctctttgctgaaaaaatcttaaacagaggtttatgtgccgtcgctcaagctgaa 321
Query: 346 tcactcaaactcaaattattagctggtctcccagttcgtaaagcttgttacgccatcgtt 405
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 322 tcactcaaactcaaattattagctggtctcccagttcgtaaagcttgttacgccatcgtt 381
Query: 406 caccaaatcatgacccgtggtgctaaaggttgtgaagttatcgtttcaggtaaattaaga 465
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 382 caccaaatcatgacccgtggtgctaaaggttgtgaagttatcgtttcaggtaaattaaga 441
Query: 466 gcccaaagagccaaatcaatgaaattcagagacggttacatgatcaaatctggtcaacca 525
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 442 gcccaaagagccaaatcaatgaaattcagagacggttacatgatcaaatctggtcaacca 501
Query: 526 tcaaaagatttcatcgatttcgcctgtcgtcacgtcttattaagacaaggtaccctcggt 585
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 502 tcaaaagatttcatcgatttcgcctgtcgtcacgtcttattaagacaaggtaccctcggt 561
Query: 586 gtcaaagtcgccattatgttaccatacgacgaaacccgtaaaatccacggtgcttgcaac 645
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 562 gtcaaagtcgccattatgttaccatacgacgaaacccgtaaaatccacggtgcttgcaac 621
Query: 646 atcccacaaccagacgttgttgtcattcgtgatgc 680
|||||||||||||||||||||||||||||||||||
Sbjct: 622 atcccacaaccagacgttgttgtcattcgtgatgc 656
Score = 111 bits (56), Expect(6) = 0.0
Identities = 56/56 (100%)
Strand = Plus / Plus
Query: 32 cattacaaatctcaaagaaaagaaagttcgtcgccgatggtgtcttccacgctgaa 87
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14 cattacaaatctcaaagaaaagaaagttcgtcgccgatggtgtcttccacgctgaa 69
Score = 63.9 bits (32), Expect(6) = 0.0
Identities = 32/32 (100%)
Strand = Plus / Plus
Query: 93 aatgaattgttcactcgtgaattcaacaaaga 124
||||||||||||||||||||||||||||||||
Sbjct: 73 aatgaattgttcactcgtgaattcaacaaaga 104
Score = 40.1 bits (20), Expect(6) = 0.0
Identities = 20/20 (100%)
Strand = Plus / Plus
Query: 140 ggtgttgaattaaaaacctc 159
||||||||||||||||||||
Sbjct: 118 ggtgttgaattaaaaacctc 137
Score = 32.2 bits (16), Expect(6) = 0.0
Identities = 16/16 (100%)
Strand = Plus / Plus
Query: 125 atgaaggttactcagg 140
||||||||||||||||
Sbjct: 104 atgaaggttactcagg 119
Score = 28.2 bits (14), Expect(6) = 0.0
Identities = 14/14 (100%)
Strand = Plus / Plus
Query: 18 aaaatgaactcatc 31
||||||||||||||
Sbjct: 1 aaaatgaactcatc 14
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 689,200,718
Number of extensions: 38188852
Number of successful extensions: 3173041
Number of sequences better than 10.0: 2525
Length of query: 738
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 714
Effective length of database: 97,308,875,965
Effective search space: 69478537439010
Effective search space used: 69478537439010
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.15 |
| Homology vs Protein |
Query= Contig-U15133-1 (Contig-U15133-1Q) /CSM_Contig/Contig-U15133-1Q.Seq.d
(738 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(P90526) RecName: Full=40S ribosomal protein S3; &U78756_1(U787... 374 e-102
FB901915_1(FB901915|pid:none) Sequence 121188 from Patent WO2008... 243 5e-63
FB901921_1(FB901921|pid:none) Sequence 121194 from Patent WO2008... 243 5e-63
EF084684_1(EF084684|pid:none) Picea sitchensis clone WS02725_K04... 242 8e-63
EF083819_1(EF083819|pid:none) Picea sitchensis clone WS02713_L17... 242 8e-63
EF145351_1(EF145351|pid:none) Populus trichocarpa clone WS01123_... 241 1e-62
EF147966_1(EF147966|pid:none) Populus trichocarpa clone WS0126_F... 241 1e-62
(Q9FJA6) RecName: Full=40S ribosomal protein S3-3; &AB015477_14... 241 1e-62
EF145670_1(EF145670|pid:none) Populus trichocarpa clone WS0112_H... 241 1e-62
EU966055_1(EU966055|pid:none) Zea mays clone 291258 40S ribosoma... 240 4e-62
(Q9M339) RecName: Full=40S ribosomal protein S3-2; &AF428405_1(... 240 4e-62
FB901923_1(FB901923|pid:none) Sequence 121196 from Patent WO2008... 238 2e-61
BT036560_1(BT036560|pid:none) Zea mays full-length cDNA clone ZM... 237 3e-61
EU139169_1(EU139169|pid:none) Flustra foliacea putative 40S ribo... 237 3e-61
AC079038_19(AC079038|pid:none) Oryza sativa chromosome 7 clone O... 235 1e-60
FB901931_1(FB901931|pid:none) Sequence 121204 from Patent WO2008... 234 2e-60
DQ122868_1(DQ122868|pid:none) Chlamydomonas incerta 40S ribosoma... 233 5e-60
AY961521_1(AY961521|pid:none) Lysiphlebus testaceipes ribosomal ... 233 6e-60
BT078469_1(BT078469|pid:none) Lepeophtheirus salmonis Pacific fo... 232 1e-59
EF633960_1(EF633960|pid:none) Ornithodoros parkeri clone OP-79 4... 231 2e-59
AJ421144_1(AJ421144|pid:none) Drosophila virilis rps3 gene for r... 230 3e-59
AY159356_1(AY159356|pid:none) Hydra vulgaris ribosomal protein S... 230 3e-59
AB172558_1(AB172558|pid:none) Macaca fascicularis brain cDNA clo... 230 4e-59
AY130450_1(AY130450|pid:none) Petromyzon marinus ribosomal prote... 230 4e-59
AY892063_1(AY892063|pid:none) Synthetic construct Homo sapiens c... 229 7e-59
BC003577_1(BC003577|pid:none) Homo sapiens, clone IMAGE:3544292,... 229 7e-59
AY521669_1(AY521669|pid:none) Pseudopleuronectes americanus 40S ... 229 9e-59
(Q5R465) RecName: Full=40S ribosomal protein S3; &AK223048_1(AK... 228 2e-58
BC061265_1(BC061265|pid:none) Xenopus tropicalis ribosomal prote... 228 2e-58
AK012314_1(AK012314|pid:none) Mus musculus 11 days embryo whole ... 228 2e-58
DQ214645_1(DQ214645|pid:none) Taeniopygia guttata clone 0058P002... 228 2e-58
AB291555_1(AB291555|pid:none) Solea senegalensis rpS3 mRNA for r... 226 4e-58
AY394937_1(AY394937|pid:none) Danio rerio clone RK045A1H03 ribos... 226 4e-58
BT047994_1(BT047994|pid:none) Salmo salar clone ssal-rgb2-636-08... 226 4e-58
(P47835) RecName: Full=40S ribosomal protein S3-B; AltName: Full... 226 6e-58
BT047278_1(BT047278|pid:none) Salmo salar clone ssal-eve-557-006... 226 6e-58
EU643498_1(EU643498|pid:none) Adineta vaga ribosomal protein S1a... 226 6e-58
EF179412_1(EF179412|pid:none) Xenopsylla cheopis clone XC-103 40... 226 8e-58
AJ783866_1(AJ783866|pid:none) Carabus granulatus mRNA for S3e ri... 225 1e-57
BT043894_1(BT043894|pid:none) Salmo salar clone HM6_0318 ribosom... 225 1e-57
BC045902_1(BC045902|pid:none) Danio rerio ribosomal protein S3, ... 225 1e-57
CU633900_531(CU633900|pid:none) Podospora anserina genomic DNA c... 225 1e-57
AM048962_1(AM048962|pid:none) Scarabaeus laticollis mRNA for rib... 225 1e-57
AF429976_1(AF429976|pid:none) Spodoptera frugiperda ribosomal pr... 224 2e-57
(P48153) RecName: Full=40S ribosomal protein S3; &U12708_1(U127... 224 2e-57
AK146165_1(AK146165|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 224 2e-57
(P79891) RecName: Full=40S ribosomal protein S3; &S83098_1(S830... 223 4e-57
BT065860_1(BT065860|pid:none) Zea mays full-length cDNA clone ZM... 222 8e-57
DQ111983_1(DQ111983|pid:none) Aedes aegypti ribosomal protein S3... 222 1e-56
AJ783759_1(AJ783759|pid:none) Papilio dardanus partial mRNA for ... 221 2e-56
CP000584_124(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 221 2e-56
AM270402_12(AM270402|pid:none) Aspergillus niger contig An18c010... 220 3e-56
CR940353_382(CR940353|pid:none) Theileria annulata strain Ankara... 220 3e-56
AM920433_211(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 220 4e-56
CR382124_339(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 218 2e-55
FB901933_1(FB901933|pid:none) Sequence 121206 from Patent WO2008... 217 3e-55
AJ563472_1(AJ563472|pid:none) Crassostrea gigas partial mRNA for... 217 3e-55
CU928175_396(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 217 3e-55
CR380956_482(CR380956|pid:none) Candida glabrata strain CBS138 c... 216 5e-55
CU928166_287(CU928166|pid:none) Kluyveromyces thermotolerans str... 216 5e-55
AY130364_1(AY130364|pid:none) Scyliorhinus canicula ribosomal pr... 214 3e-54
AY389945_1(AY389945|pid:none) Latimeria chalumnae ribosomal prot... 213 4e-54
L31405_1(L31405|pid:none) Yeast ribosomal protein S3 (RPS3) gene... 213 7e-54
AY389965_1(AY389965|pid:none) Gallus gallus ribosomal protein S3... 212 9e-54
AY389946_1(AY389946|pid:none) Protopterus dolloi ribosomal prote... 212 1e-53
FN392319_114(FN392319|pid:none) Pichia pastoris GS115 chromosome... 211 2e-53
BT047735_1(BT047735|pid:none) Salmo salar clone ssal-evf-544-102... 210 4e-53
EU677715_1(EU677715|pid:none) Caenorhabditis brenneri ribosomal ... 207 4e-52
(P48152) RecName: Full=40S ribosomal protein S3; &T15579(T15579... 207 4e-52
AB098927_1(AB098927|pid:none) Bos taurus mRNA for similar to rib... 205 1e-51
DQ206605_1(DQ206605|pid:none) Monosiga brevicollis isolate TOA26... 202 7e-51
FN357348_21(FN357348|pid:none) Schistosoma mansoni genome sequen... 201 2e-50
FN316521_1(FN316521|pid:none) Schistosoma japonicum isolate Anhu... 199 1e-49
EZ000619_1(EZ000619|pid:none) TSA: Culex tarsalis Ctar-98 40S ri... 199 1e-49
FN316515_1(FN316515|pid:none) Schistosoma japonicum isolate Anhu... 199 1e-49
AY223426_1(AY223426|pid:none) Schistosoma japonicum clone ZZZ39 ... 199 1e-49
FN316529_1(FN316529|pid:none) Schistosoma japonicum isolate Anhu... 197 2e-49
DQ206529_1(DQ206529|pid:none) Suberites fuscus isolate TOA26 rib... 197 3e-49
AM494970_111(AM494970|pid:none) Leishmania braziliensis chromoso... 197 4e-49
FN323675_1(FN323675|pid:none) Schistosoma japonicum isolate Anhu... 197 4e-49
AM494952_99(AM494952|pid:none) Leishmania braziliensis chromosom... 196 5e-49
AM502233_101(AM502233|pid:none) Leishmania infantum chromosome 1... 196 8e-49
CP000496_496(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 196 8e-49
FN316517_1(FN316517|pid:none) Schistosoma japonicum isolate Anhu... 195 1e-48
CP000883_61(CP000883|pid:none) Hemiselmis andersenii chromosome ... 194 2e-48
FM992695_438(FM992695|pid:none) Candida dubliniensis CD36 chromo... 193 5e-48
EU558291_1(EU558291|pid:none) Novocrania anomala putative 40S ri... 182 1e-44
FN323654_1(FN323654|pid:none) Schistosoma japonicum isolate Anhu... 180 4e-44
AB099059_1(AB099059|pid:none) Bos taurus mRNA for similar to rib... 169 8e-41
AB099062_1(AB099062|pid:none) Bos taurus mRNA for similar to S3 ... 166 7e-40
AM048961_1(AM048961|pid:none) Mycetophagus quadripustulatus part... 160 5e-38
AF281313_1(AF281313|pid:none) Homo sapiens ribosomal protein S3 ... 156 6e-37
EZ000618_1(EZ000618|pid:none) TSA: Culex tarsalis Ctar-97 40S ri... 154 4e-36
AM439635_1(AM439635|pid:none) Vitis vinifera contig VV78X266991.... 154 4e-36
AX405732_1(AX405732|pid:none) Sequence 147 from Patent WO0222660. 148 2e-34
AY513653_1(AY513653|pid:none) Ostrinia nubilalis ribosomal prote... 144 4e-33
AB170681_1(AB170681|pid:none) Macaca fascicularis brain cDNA clo... 140 5e-32
DQ415986_1(DQ415986|pid:none) Anopheles quadrimaculatus ribosoma... 133 7e-30
FN323669_1(FN323669|pid:none) Schistosoma japonicum isolate Anhu... 127 4e-28
EU116878_1(EU116878|pid:none) Sipunculus nudus putative ribosoma... 126 6e-28
AB098811_1(AB098811|pid:none) Bos taurus mRNA for similar to S3 ... 123 5e-27
CR954204_147(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 122 9e-27
(Q8SQM3) RecName: Full=40S ribosomal protein S3; &AL590451_124(... 120 6e-26
CR954204_146(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 111 2e-23
CP001398_1998(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 108 2e-22
(Q8U004) RecName: Full=30S ribosomal protein S3P; &AE009950_181... 107 3e-22
(Q9V1U1) RecName: Full=30S ribosomal protein S3P; &AJ248284_38(... 105 1e-21
(A1RXG6) RecName: Full=30S ribosomal protein S3P; 92 1e-17
(A6UWU3) RecName: Full=30S ribosomal protein S3P; &CP000743_137... 92 2e-17
(A2SPK9) RecName: Full=30S ribosomal protein S3P; &CP000559_87(... 92 2e-17
(A3CT03) RecName: Full=30S ribosomal protein S3P; &CP000562_568... 91 5e-17
L16016_1(L16016|pid:none) Human ribosomal protein S3 (RPS3) gene... 91 5e-17
CP001338_426(CP001338|pid:none) Candidatus Methanosphaerula palu... 91 5e-17
(P54034) RecName: Full=30S ribosomal protein S3P; &E64357(E6435... 90 8e-17
(P20281) RecName: Full=30S ribosomal protein S3P; AltName: Full=... 88 2e-16
(A7I5P5) RecName: Full=30S ribosomal protein S3P; &CP000780_532... 86 1e-15
(Q3IMY2) RecName: Full=30S ribosomal protein S3P; &CR936257_242... 86 2e-15
CP001365_2412(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 85 3e-15
(Q9UXA0) RecName: Full=30S ribosomal protein S3P; &AE006641_646... 84 4e-15
(Q2FT39) RecName: Full=30S ribosomal protein S3P; &CP000254_217... 84 4e-15
FM200059_1(FM200059|pid:none) Histomonas meleagridis partial mRN... 84 5e-15
(Q2NFW2) RecName: Full=30S ribosomal protein S3P; &CP000102_871... 83 8e-15
(A4FWB6) RecName: Full=30S ribosomal protein S3P; &CP000609_174... 82 2e-14
(Q12ZU5) RecName: Full=30S ribosomal protein S3P; &CP000300_7(C... 81 4e-14
AY714865_4(AY714865|pid:none) Uncultured archaeon GZfos35D7 clon... 81 4e-14
(P15009) RecName: Full=30S ribosomal protein S3P; AltName: Full=... 80 5e-14
(Q975I7) RecName: Full=30S ribosomal protein S3P; &BA000023_472... 80 5e-14
AM980963_1(AM980963|pid:none) Echinorhynchus truttae partial mRN... 79 1e-13
DQ156348_10(DQ156348|pid:none) Uncultured marine group II euryar... 79 1e-13
(A4YCX2) RecName: Full=30S ribosomal protein S3P; &CP000682_97(... 78 3e-13
(A6UQ49) RecName: Full=30S ribosomal protein S3P; &CP000742_706... 78 3e-13
(A6VGZ0) RecName: Full=30S ribosomal protein S3P; &CP000745_643... 77 4e-13
(Q0W1Y3) RecName: Full=30S ribosomal protein S3P; &AM114193_646... 77 6e-13
(A3DNB3) RecName: Full=30S ribosomal protein S3P; &CP000575_100... 75 2e-12
(Q8TX35) RecName: Full=30S ribosomal protein S3P; &AE009439_842... 74 5e-12
(Q9YF78) RecName: Full=30S ribosomal protein S3P; &B72728(B7272... 73 1e-11
EU972699_1(EU972699|pid:none) Zea mays clone 386240 hypothetical... 72 1e-11
EU686610_16(EU686610|pid:none) Uncultured marine group II euryar... 72 2e-11
EU686634_17(EU686634|pid:none) Uncultured marine group II euryar... 71 3e-11
EF576257_1(EF576257|pid:none) Oryza sativa (indica cultivar-grou... 71 3e-11
CP000852_886(CP000852|pid:none) Caldivirga maquilingensis IC-167... 70 5e-11
EU016608_41(EU016608|pid:none) Uncultured marine microorganism H... 70 7e-11
AB099000_1(AB099000|pid:none) Bos taurus mRNA for similar to rib... 70 7e-11
(A1RV98) RecName: Full=30S ribosomal protein S3P; &CP000504_169... 69 2e-10
AB047899_1(AB047899|pid:none) Macaca fascicularis brain cDNA, cl... 69 2e-10
(Q8ZWI0) RecName: Full=30S ribosomal protein S3P; 68 3e-10
AE009441_1230(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 68 3e-10
(A4WIY8) RecName: Full=30S ribosomal protein S3P; 67 6e-10
AY534910_18(AY534910|pid:none) Uncultured marine group II euryar... 67 8e-10
(Q6L1C1) RecName: Full=30S ribosomal protein S3P; &AE017261_646... 65 3e-09
(Q97BX1) RecName: Full=30S ribosomal protein S3P; &BA000011_334... 62 2e-08
AE017199_469(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 52 1e-05
(A0RVX9) RecName: Full=30S ribosomal protein S3P; 52 3e-05
CP000866_800(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 51 3e-05
CP001357_2085(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 50 1e-04
DQ158856_95(DQ158856|pid:none) Bigelowiella natans nucleomorph c... 49 2e-04
CP001279_1573(CP001279|pid:none) Nautilia profundicola AmH, comp... 48 4e-04
CP001230_1177(CP001230|pid:none) Persephonella marina EX-H1, com... 48 4e-04
(Q14JB4) RecName: Full=30S ribosomal protein S3; &(Q5NHW2) RecN... 47 6e-04
CP001047_325(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ... 47 6e-04
(A4IZS8) RecName: Full=30S ribosomal protein S3; &(A7N9T2) RecN... 46 0.001
(A0Q4I9) RecName: Full=30S ribosomal protein S3; &CP000439_243(... 46 0.001
(Q9RXJ6) RecName: Full=30S ribosomal protein S3; &AE000513_305(... 46 0.001
EF183491_2(EF183491|pid:none) Vinca virescence phytoplasma strai... 46 0.001
CP000916_999(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 45 0.002
CP001634_1848(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 45 0.002
(B0SA41) RecName: Full=30S ribosomal protein S3; &(B0SSH1) RecN... 45 0.002
(A5IM89) RecName: Full=30S ribosomal protein S3; &CP000702_1283... 45 0.003
AY197669_3(AY197669|pid:none) Rubus stunt phytoplasma strain RuS... 45 0.003
CP001114_2081(CP001114|pid:none) Deinococcus deserti VCD115, com... 45 0.003
CP000923_851(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 45 0.003
CP000683_728(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 44 0.004
FM864216_130(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T... 44 0.004
CP000879_759(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 44 0.004
EU849487_61(EU849487|pid:none) Trifolium subterraneum chloroplas... 44 0.004
EU651838_3(EU651838|pid:none) Jujube witches'-broom phytoplasma ... 44 0.005
(P46772) RecName: Full=30S ribosomal protein S3; &AE000512_1467... 44 0.005
FJ154855_3(FJ154855|pid:none) Jujube witches'-broom phytoplasma ... 44 0.005
FJ154857_3(FJ154857|pid:none) Jujube witches'-broom phytoplasma ... 44 0.005
AY197680_3(AY197680|pid:none) Peach yellows phytoplasma strain P... 44 0.005
FJ154849_3(FJ154849|pid:none) Jujube witches'-broom phytoplasma ... 44 0.005
AY332656_3(AY332656|pid:none) Peach yellows phytoplasma strain P... 44 0.005
FJ543468_1(FJ543468|pid:none) Chrysanthemum flattened stem Phyto... 44 0.005
(Q8VS61) RecName: Full=30S ribosomal protein S3; &AF396941_1(AF... 44 0.005
(Q8VS63) RecName: Full=30S ribosomal protein S3; &AF396936_1(AF... 44 0.007
(P62663) RecName: Full=30S ribosomal protein S3; &(P80372) RecN... 44 0.007
(Q8VL42) RecName: Full=30S ribosomal protein S3; &AF396940_1(AF... 44 0.007
EF608225_1(EF608225|pid:none) Candidatus Phytoplasma vitis ribos... 44 0.007
AF385627_2(AF385627|pid:none) Flavescence doree phytoplasma ribo... 44 0.007
CP000937_576(CP000937|pid:none) Francisella philomiragia subsp. ... 44 0.007
(Q8VS60) RecName: Full=30S ribosomal protein S3; &AF396944_1(AF... 44 0.007
EU116428_3(EU116428|pid:none) Candidatus Phytoplasma ulmi strain... 43 0.009
AY197672_3(AY197672|pid:none) Spartium witches'-broom phytoplasm... 43 0.009
(Q1ISB6) RecName: Full=30S ribosomal protein S3; &CP000360_1229... 43 0.009
AY197674_3(AY197674|pid:none) Hemp dogbane yellows phytoplasma s... 43 0.009
AF396937_1(AF396937|pid:none) Flavescence doree phytoplasma stra... 43 0.009
(Q4UMS3) RecName: Full=30S ribosomal protein S3; &CP000053_284(... 43 0.009
AY197663_3(AY197663|pid:none) Flavescence doree phytoplasma stra... 43 0.009
(Q8R7W0) RecName: Full=30S ribosomal protein S3; &AE008691_2112... 43 0.012
(A1AVK6) RecName: Full=30S ribosomal protein S3; &CP000488_159(... 43 0.012
(P0A4C1) RecName: Full=30S ribosomal protein S3; &(P0A4C2) RecN... 43 0.012
(A0PXV2) RecName: Full=30S ribosomal protein S3; &CP000382_231(... 42 0.015
(O83225) RecName: Full=30S ribosomal protein S3; &AE000520_193(... 42 0.015
EU592500_2(EU592500|pid:none) Candidatus Phytoplasma ulmi isolat... 42 0.020
CP000804_3914(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 42 0.026
CP001275_937(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 42 0.026
(B5YDU9) RecName: Full=30S ribosomal protein S3; &CP001146_820(... 42 0.026
(B8E1D9) RecName: Full=30S ribosomal protein S3; &CP001251_926(... 41 0.034
AY197662_3(AY197662|pid:none) Alder yellows phytoplasma strain A... 41 0.034
(Q9BBP8) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 41 0.034
(A6LLL9) RecName: Full=30S ribosomal protein S3; &CP000716_938(... 40 0.077
(P47403) RecName: Full=30S ribosomal protein S3; &CP000925_160(... 40 0.077
(A6UZJ4) RecName: Full=30S ribosomal protein S3; &(Q02T74) RecN... 40 0.100
CP001337_2925(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 40 0.100
(Q68W84) RecName: Full=30S ribosomal protein S3; &AE017197_618(... 39 0.13
(Q4FUF0) RecName: Full=30S ribosomal protein S3; &CP000082_495(... 39 0.13
(Q2PMP7) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 39 0.13
(B7IA33) RecName: Full=30S ribosomal protein S3; &CP001182_3412... 39 0.13
(A1B033) RecName: Full=30S ribosomal protein S3; &CP000489_760(... 39 0.13
EU810250_1(EU810250|pid:none) Gymnochlora stellata 40S ribosomal... 39 0.13
CP000875_4899(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 39 0.17
(B0VQS4) RecName: Full=30S ribosomal protein S3; &CU468230_398(... 39 0.17
(Q6F7R8) RecName: Full=30S ribosomal protein S3; &CR543861_2896... 39 0.22
CP000749_4222(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 39 0.22
(A8F4R7) RecName: Full=30S ribosomal protein S3; &CP000812_578(... 38 0.29
CP000908_2134(CP000908|pid:none) Methylobacterium extorquens PA1... 38 0.29
(A0RM17) RecName: Full=30S ribosomal protein S3; &CP000487_40(C... 38 0.29
(Q4FLM4) RecName: Full=30S ribosomal protein S3; &CP000084_1090... 38 0.29
AY967383_1(AY967383|pid:none) Synthetic construct isolate FTT033... 38 0.29
CP001157_614(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 38 0.38
CP001029_2095(CP001029|pid:none) Methylobacterium populi BJ001, ... 38 0.38
(A0M592) RecName: Full=30S ribosomal protein S3; &CU207366_2796... 38 0.38
(Q47J97) RecName: Full=30S ribosomal protein S3; &CP000089_325(... 37 0.50
(A4XZ84) RecName: Full=30S ribosomal protein S3; &CP000680_3875... 37 0.50
CP001104_295(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 37 0.50
(A2C4Z3) RecName: Full=30S ribosomal protein S3; &CP000553_1990... 37 0.50
CP001472_1378(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 37 0.50
CP001393_1667(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 37 0.50
(Q73PM6) RecName: Full=30S ribosomal protein S3; &AE017226_766(... 37 0.50
(Q2GL53) RecName: Full=30S ribosomal protein S3; &CP000235_259(... 37 0.65
AY372454_32(AY372454|pid:none) Uncultured marine gamma proteobac... 37 0.65
(A9WH72) RecName: Full=30S ribosomal protein S3; &CP000909_2326... 37 0.65
(A1ALU7) RecName: Full=30S ribosomal protein S3; &CP000482_676(... 37 0.65
CP001132_495(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 37 0.65
(Q2GGA4) RecName: Full=Polyribonucleotide nucleotidyltransferase... 37 0.65
CP001348_754(CP001348|pid:none) Clostridium cellulolyticum H10, ... 37 0.65
(Q1IFW0) RecName: Full=30S ribosomal protein S3; &CT573326_445(... 37 0.85
(Q3K5Z4) RecName: Full=30S ribosomal protein S3; &(Q48D42) RecN... 37 0.85
(Q3Z975) RecName: Full=30S ribosomal protein S3; &CP000027_469(... 37 0.85
(A4VHN6) RecName: Full=30S ribosomal protein S3; &CP000304_779(... 37 0.85
EF199933_3(EF199933|pid:none) Paulownia witches'-broom phytoplas... 37 0.85
(Q0ABG9) RecName: Full=30S ribosomal protein S3; &CP000453_459(... 36 1.1
(A8G756) RecName: Full=30S ribosomal protein S3; &CP000825_1819... 36 1.1
(Q7VGD8) RecName: Full=30S ribosomal protein S3; &AE017125_1384... 36 1.1
(A2BTD1) RecName: Full=30S ribosomal protein S3; &(A3PF41) RecN... 36 1.1
CP000961_4633(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 36 1.1
(Q7UZV2) RecName: Full=30S ribosomal protein S3; &BX548174_1794... 36 1.1
(A7H650) RecName: Full=30S ribosomal protein S3; &CP000768_1707... 36 1.1
(Q6EW13) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 36 1.1
(A5IHQ8) RecName: Full=30S ribosomal protein S3; &(Q5X853) RecN... 36 1.4
(A0LIJ6) RecName: Full=30S ribosomal protein S3; 36 1.4
(Q5WZK6) RecName: Full=30S ribosomal protein S3; &CR628337_376(... 36 1.4
AY303561_3(AY303561|pid:none) Candidatus Phytoplasma australiens... 36 1.4
CP000478_1544(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 36 1.4
CP000932_63(CP000932|pid:none) Campylobacter lari RM2100, comple... 36 1.4
(Q5FM84) RecName: Full=30S ribosomal protein S3; &CP000033_282(... 36 1.4
(Q18CG5) RecName: Full=30S ribosomal protein S3; &AM180355_80(A... 36 1.4
(A1W1V4) RecName: Full=30S ribosomal protein S3; &(A8FP15) RecN... 36 1.4
(A6MMP6) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 36 1.4
(A5CCK6) RecName: Full=30S ribosomal protein S3; &AM494475_370(... 36 1.4
AY303560_3(AY303560|pid:none) Candidatus Phytoplasma australiens... 36 1.4
AM422018_580(AM422018|pid:none) Candidatus Phytoplasma australie... 36 1.4
(B6JET9) RecName: Full=30S ribosomal protein S3; &CP001196_1659... 36 1.4
AY303558_2(AY303558|pid:none) Candidatus Phytoplasma australiens... 36 1.4
EF183492_2(EF183492|pid:none) Candidatus Phytoplasma fraxini str... 35 1.9
(Q3SSW0) RecName: Full=30S ribosomal protein S3; &CP000115_1363... 35 1.9
AY552545_82(AY552545|pid:none) Uncultured marine gamma proteobac... 35 1.9
(Q7V9W8) RecName: Full=30S ribosomal protein S3; &AE017126_1703... 35 1.9
(A4QKW9) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 35 1.9
EF183493_2(EF183493|pid:none) Candidatus Phytoplasma fraxini str... 35 1.9
(A9BCP1) RecName: Full=30S ribosomal protein S3; &CP000878_1673... 35 1.9
CP001103_449(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 35 2.5
(Q15YN3) RecName: Full=30S ribosomal protein S3; &CP000388_472(... 35 2.5
(A5FRY1) RecName: Full=30S ribosomal protein S3; &CP000688_450(... 35 2.5
CP001616_105(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 35 2.5
(A5ELM1) RecName: Full=30S ribosomal protein S3; &CP000494_4760... 35 2.5
CP001096_3598(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 35 2.5
(Q09FS2) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 35 2.5
CP000851_190(CP000851|pid:none) Shewanella pealeana ATCC 700345,... 35 2.5
(Q9A8U7) RecName: Full=30S ribosomal protein S3; &AE005673_1247... 35 2.5
CP000472_1924(CP000472|pid:none) Shewanella piezotolerans WP3, c... 35 2.5
(A5UDU1) RecName: Full=30S ribosomal protein S3; &(A5UHT6) RecN... 35 2.5
(Q1H4N1) RecName: Full=30S ribosomal protein S3; &CP000284_285(... 35 2.5
(P44372) RecName: Full=30S ribosomal protein S3; &B64093(B64093... 35 2.5
EU431223_60(EU431223|pid:none) Carica papaya chloroplast, comple... 35 3.2
(A4QLN2) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 35 3.2
(A8YXL1) RecName: Full=30S ribosomal protein S3; &CP000517_251(... 35 3.2
(A7GK26) RecName: Full=30S ribosomal protein S3; &CP000764_108(... 35 3.2
(Q5HBH6) RecName: Full=Polyribonucleotide nucleotidyltransferase... 35 3.2
(P55827) RecName: Full=30S ribosomal protein S3; &D64071_7(D640... 35 3.2
(Q2IXQ4) RecName: Full=30S ribosomal protein S3; &CP000250_2294... 35 3.2
(Q7MPI2) RecName: Full=30S ribosomal protein S3; &(Q8DE45) RecN... 35 3.2
(A0KF27) RecName: Full=30S ribosomal protein S3; &CP000462_296(... 35 3.2
EF186799_2(EF186799|pid:none) Rhynchosia little leaf phytoplasma... 35 3.2
(Q211F4) RecName: Full=30S ribosomal protein S3; &CP000301_3403... 35 3.2
(Q09MD9) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 35 3.2
(A1KRH9) RecName: Full=30S ribosomal protein S3; &(A9M3W0) RecN... 34 4.2
(Q5WLQ6) RecName: Full=30S ribosomal protein S3; &AP006627_156(... 34 4.2
EF193383_2(EF193383|pid:none) Pigeon pea witches'-broom phytopla... 34 4.2
FJ042723_1(FJ042723|pid:none) Uncultured Geobacter sp. clone RPS... 34 4.2
(Q5LW56) RecName: Full=30S ribosomal protein S3; &CP000031_476(... 34 4.2
(B2A4E5) RecName: Full=30S ribosomal protein S3; &CP001034_200(... 34 4.2
(B7GJ73) RecName: Full=30S ribosomal protein S3; &CP000922_111(... 34 4.2
CP001089_1334(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 34 4.2
(A5GAX1) RecName: Full=30S ribosomal protein S3; &CP000698_1061... 34 4.2
AY183687_3(AY183687|pid:none) Aster yellows phytoplasma strain B... 34 4.2
FM954972_2658(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 34 4.2
AP008981_1050(AP008981|pid:none) Orientia tsutsugamushi str. Ike... 34 4.2
(Q04PU4) RecName: Full=30S ribosomal protein S3; &(Q055D8) RecN... 34 4.2
EF186800_2(EF186800|pid:none) Gliricidia little leaf phytoplasma... 34 5.5
(Q2S918) RecName: Full=30S ribosomal protein S3; &CP000155_5937... 34 5.5
(P46247) RecName: Full=30S ribosomal protein S3; &AE017263_129(... 34 5.5
(P56010) RecName: Full=30S ribosomal protein S3; &A64684(A64684... 34 5.5
(Q87T07) RecName: Full=30S ribosomal protein S3; &BA000031_263(... 34 5.5
(A8GKJ1) RecName: Full=30S ribosomal protein S3; &CP000826_4521... 34 5.5
(Q5PA64) RecName: Full=30S ribosomal protein S3; &CP000030_627(... 34 5.5
(P02353) RecName: Full=30S ribosomal protein S3; &(Q6MSN1) RecN... 34 5.5
M74771_3(M74771|pid:none) Acholeplasma laidlawii rps19 gene, 3' ... 34 5.5
(A9NED9) RecName: Full=30S ribosomal protein S3; &CP000896_75(C... 34 5.5
(A4VSG0) RecName: Full=30S ribosomal protein S3; &(A4VYP9) RecN... 34 5.5
(A1TYK3) RecName: Full=30S ribosomal protein S3; &CP000514_714(... 34 5.5
(B6JNF1) RecName: Full=30S ribosomal protein S3; &CP001217_1270... 34 5.5
(A4QL57) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 34 5.5
BT077666_1(BT077666|pid:none) Lepeophtheirus salmonis Pacific fo... 34 5.5
(A4QJW9) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 34 5.5
(A4QKE3) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 34 5.5
(Q8K956) RecName: Full=30S ribosomal protein S3; &AE013218_470(... 34 5.5
CU459003_3793(CU459003|pid:none) Magnetospirillum gryphiswaldens... 33 7.2
BA000004_3891(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 33 7.2
(Q49KW0) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 33 7.2
(Q661D6) RecName: Full=30S ribosomal protein S3; &CP000013_476(... 33 7.2
AY183703_3(AY183703|pid:none) Aster yellows phytoplasma strain P... 33 7.2
(Q9CL37) RecName: Full=30S ribosomal protein S3; &AE004439_1409... 33 7.2
(Q2NIW0) RecName: Full=30S ribosomal protein S3; &AY183688_3(AY... 33 7.2
EU922519_1(EU922519|pid:none) Monsonia vanderietiae ribosomal pr... 33 7.2
(A8IAR2) RecName: Full=30S ribosomal protein S3; &AP009384_2548... 33 7.2
(A6TWH6) RecName: Full=30S ribosomal protein S3; &CP000724_4301... 33 7.2
AY303562_3(AY303562|pid:none) Candidatus Phytoplasma australiens... 33 7.2
(A1A075) RecName: Full=30S ribosomal protein S3; &AP009256_327(... 33 7.2
(A3N364) RecName: Full=30S ribosomal protein S3; &CP000569_1742... 33 7.2
(Q748Z4) RecName: Full=30S ribosomal protein S3; &AE017180_2834... 33 7.2
AY183686_3(AY183686|pid:none) Aster yellows phytoplasma strain B... 33 7.2
(Q839F8) RecName: Full=30S ribosomal protein S3; &AE016830_196(... 33 7.2
AY183683_3(AY183683|pid:none) Aster yellows phytoplasma strain B... 33 7.2
CP000821_4302(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 33 7.2
(Q0SN23) RecName: Full=30S ribosomal protein S3; &CP000395_490(... 33 7.2
BX284746_10(BX284746|pid:none) Neurospora crassa DNA linkage gro... 33 9.3
AY183700_3(AY183700|pid:none) Aster yellows phytoplasma strain P... 33 9.4
(Q17ZD2) RecName: Full=30S ribosomal protein S3; &AM260522_125(... 33 9.4
EU017239_1(EU017239|pid:none) Trachelium caeruleum ribosomal pro... 33 9.4
(Q9ZJR9) RecName: Full=30S ribosomal protein S3; &A71835(A71835... 33 9.4
AY183720_3(AY183720|pid:none) Aster yellows phytoplasma strain B... 33 9.4
(B0T2C8) RecName: Full=30S ribosomal protein S3; &CP000927_1611... 33 9.4
(Q70XX2) RecName: Full=30S ribosomal protein S3, chloroplastic; ... 33 9.4
(O66098) RecName: Full=30S ribosomal protein S3; &U96617_3(U966... 33 9.4
AM942759_3231(AM942759|pid:none) Proteus mirabilis strain HI4320... 33 9.4
>(P90526) RecName: Full=40S ribosomal protein S3;
&U78756_1(U78756|pid:none)
Length = 218
Score = 374 bits (960), Expect = e-102
Identities = 197/216 (91%), Positives = 199/216 (92%)
Frame = +1
Query: 34 LQISKKRKFVADGVFHAETQMNCSLVNSTKNEGYSGC*IKNLHQGLTEIIIRASKTQAVV 213
LQISKKRKFVADGVFHAE K+EGYSG +K GLTEIIIRASKTQAVV
Sbjct: 5 LQISKKRKFVADGVFHAELN-ELFTREFNKDEGYSGVELKT-SPGLTEIIIRASKTQAVV 62
Query: 214 GPNARRIQELCSLVQKRFNFKEGTVVLFAEKILNRGLCAVAQAESLKLKLLAGLPVRKAC 393
GPNARRIQELCSLVQKRFNFKEGTVVLFAEKILNRGLCAVAQAESLKLKLLAGLPVRKAC
Sbjct: 63 GPNARRIQELCSLVQKRFNFKEGTVVLFAEKILNRGLCAVAQAESLKLKLLAGLPVRKAC 122
Query: 394 YAIVHQIMTRGAKGCEVIVSGKLRAQRAKSMKFRDGYMIKSGQPSKDFIDFACRHVLLRQ 573
YAIVHQIMTRGAKGCEVIVSGKLRAQRAKSMKFRDGYMIKSGQPSKDFIDFACRHVLLRQ
Sbjct: 123 YAIVHQIMTRGAKGCEVIVSGKLRAQRAKSMKFRDGYMIKSGQPSKDFIDFACRHVLLRQ 182
Query: 574 GTLGVKVAIMLPYDETRKIHGACNIPQPDVVVIRDA 681
GTLGVKVAIMLPYDETRKIHGACNIPQPDVVVIRDA
Sbjct: 183 GTLGVKVAIMLPYDETRKIHGACNIPQPDVVVIRDA 218
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,177,104,147
Number of extensions: 22507991
Number of successful extensions: 53129
Number of sequences better than 10.0: 366
Number of HSP's gapped: 52985
Number of HSP's successfully gapped: 366
Length of query: 246
Length of database: 1,051,180,864
Length adjustment: 125
Effective length of query: 121
Effective length of database: 646,610,989
Effective search space: 78239929669
Effective search space used: 78239929669
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
|
| PSORT |
|
| VS (DIR, S) |
16 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
5 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
8 |
| FC-IC (SUB) |
0 |