Contig-U15129-1
Contig ID Contig-U15129-1
Contig update 2004. 6.11
Contig sequence
>Contig-U15129-1 (Contig-U15129-1Q) /CSM_Contig/Contig-U15129-1Q.Seq.d
GTCCGCACACACAAAATTTTCAATCAGATTATTTGTCAAAAAAATATATT
AAATAAAGAAGAAAAGAAAAAAAAAAAAAAGAAGATAAAAGAAAAATCAA
ATATATAAAAAAAATGATCTCAAAAATTTTTGAAATTGTTCATAAACATC
AAAAGTTTATTTCAGGTGTTTGTATTTCAAAGACACATACTAAAACAGCA
ATGTGTCAAGTAAAGAGATTATATTTTGATAAAGGAAAATATTCAGCTTT
AAATTATAAAACTACCAAATATATGATTCACGATCCAAATGATATTTGTG
CAGTTGGTGATCAAGTTCACTTTAGAGAATGTGCACCAGTTTCAAAGAGA
AAAGCACACGTAGTCGAAAAAATTGTTAAAAAGAATCCAATCACTGAATT
CCTTAGACAAAACCCACAATATATTGTTACACCAAAAGAAATCGCTGAAA
GAAAAGAAAATGATAAAATTAAATACAAACATATCACAGATTTATAAATT
AAATTAAAAAAAAAATAAAATAAAATAAAAAAATAAAAATTACTGATAGC
GGAAAAAAATAAAAACTAAAAAAAAAATTTATTTATTAATTTGGTAAAGG
GAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Gap no gap
Contig length 646
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 7710800
End point 7710155
Strand (PLUS/MINUS) MINUS
Number of clones 3
Number of EST 3
Link to clone list U15129
List of clone(s)

est1=FC-BG20Z,1,646
est2=FC-AL09E,6,646
est3=VSC724Z,81,573
Translated Amino Acid sequence
phtqnfqsdylskkyik*RRKEKKKKEDKRKIKYIKKMISKIFEIVHKHQKFISGVCISK
THTKTAMCQVKRLYFDKGKYSALNYKTTKYMIHDPNDICAVGDQVHFRECAPVSKRKAHV
VEKIVKKNPITEFLRQNPQYIVTPKEIAERKENDKIKYKHITDL*iklkkk*nkikk*kl
liaeknkn*kknlfinlvkgtkkkkkkkkkkkkk


Translated Amino Acid sequence (All Frames)
Frame A:
vrthkifnqiicqknilnkeekkkkkkkikeksni*kk*sqkflklfinikslfqvfvfq
rhilkqqcvk*rdyilikeniql*iiklpni*ftiqmifvqlvikftlenvhqfqrekht
*skkllkriqslnsldkthnillhqkkslkekkmiklntnisqiykln*kknkik*knkn
y**rkkiktkkkiylliw*reqkkkkkkkkkkkkk


Frame B:
sahtkfsirlfvkkiy*ikkkrkkkkrr*kknqiykkndlknf*ncs*tskvyfrclyfk
dty*nsnvsskeiif**rkifsfkl*nyqiydsrsk*ylcsw*sssl*rmctsfkekstr
srknc*kesnh*ip*tkptiycytkrnr*kkrk**n*iqtyhrfin*ikkkik*nkkiki
tdsgkk*klkkkfiy*fgkgnkkkkkkkkkkkkkk


Frame C:
phtqnfqsdylskkyik*RRKEKKKKEDKRKIKYIKKMISKIFEIVHKHQKFISGVCISK
THTKTAMCQVKRLYFDKGKYSALNYKTTKYMIHDPNDICAVGDQVHFRECAPVSKRKAHV
VEKIVKKNPITEFLRQNPQYIVTPKEIAERKENDKIKYKHITDL*iklkkk*nkikk*kl
liaeknkn*kknlfinlvkgtkkkkkkkkkkkkk


own update 2004. 6.23
Homology vs CSM-cDNA
Query= Contig-U15129-1 (Contig-U15129-1Q)
/CSM_Contig/Contig-U15129-1Q.Seq.d
(646 letters)

Database: CSM
8402 sequences; 8,075,542 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U15129-1 (Contig-U15129-1Q) /CSM_Contig/Conti... 753 0.0
Contig-U12559-1 (Contig-U12559-1Q) /CSM_Contig/Conti... 40 0.004
Contig-U15528-1 (Contig-U15528-1Q) /CSM_Contig/Conti... 38 0.016
Contig-U11306-1 (Contig-U11306-1Q) /CSM_Contig/Conti... 38 0.016
Contig-U12087-1 (Contig-U12087-1Q) /CSM_Contig/Conti... 36 0.064
Contig-U09073-1 (Contig-U09073-1Q) /CSM_Contig/Conti... 36 0.064
Contig-U16060-1 (Contig-U16060-1Q) /CSM_Contig/Conti... 34 0.25
Contig-U15751-1 (Contig-U15751-1Q) /CSM_Contig/Conti... 34 0.25
Contig-U14943-1 (Contig-U14943-1Q) /CSM_Contig/Conti... 34 0.25
Contig-U12028-1 (Contig-U12028-1Q) /CSM_Contig/Conti... 34 0.25

>Contig-U15129-1 (Contig-U15129-1Q) /CSM_Contig/Contig-U15129-1Q.Seq.d
Length = 646

Score = 753 bits (380), Expect = 0.0
Identities = 380/380 (100%)
Strand = Plus / Plus


Query: 115 tgatctcaaaaatttttgaaattgttcataaacatcaaaagtttatttcaggtgtttgta 174
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 115 tgatctcaaaaatttttgaaattgttcataaacatcaaaagtttatttcaggtgtttgta 174


Query: 175 tttcaaagacacatactaaaacagcaatgtgtcaagtaaagagattatattttgataaag 234
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 175 tttcaaagacacatactaaaacagcaatgtgtcaagtaaagagattatattttgataaag 234


Query: 235 gaaaatattcagctttaaattataaaactaccaaatatatgattcacgatccaaatgata 294
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 235 gaaaatattcagctttaaattataaaactaccaaatatatgattcacgatccaaatgata 294


Query: 295 tttgtgcagttggtgatcaagttcactttagagaatgtgcaccagtttcaaagagaaaag 354
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 295 tttgtgcagttggtgatcaagttcactttagagaatgtgcaccagtttcaaagagaaaag 354


Query: 355 cacacgtagtcgaaaaaattgttaaaaagaatccaatcactgaattccttagacaaaacc 414
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 355 cacacgtagtcgaaaaaattgttaaaaagaatccaatcactgaattccttagacaaaacc 414


Query: 415 cacaatatattgttacaccaaaagaaatcgctgaaagaaaagaaaatgataaaattaaat 474
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 415 cacaatatattgttacaccaaaagaaatcgctgaaagaaaagaaaatgataaaattaaat 474


Query: 475 acaaacatatcacagattta 494
||||||||||||||||||||
Sbjct: 475 acaaacatatcacagattta 494


Score = 73.8 bits (37), Expect = 3e-13
Identities = 37/37 (100%)
Strand = Plus / Plus


Query: 1 gtccgcacacacaaaattttcaatcagattatttgtc 37
|||||||||||||||||||||||||||||||||||||
Sbjct: 1 gtccgcacacacaaaattttcaatcagattatttgtc 37


Score = 54.0 bits (27), Expect = 3e-07
Identities = 27/27 (100%)
Strand = Plus / Plus


Query: 578 tttatttattaatttggtaaagggaac 604
|||||||||||||||||||||||||||
Sbjct: 578 tttatttattaatttggtaaagggaac 604


>Contig-U12559-1 (Contig-U12559-1Q) /CSM_Contig/Contig-U12559-1Q.Seq.d
Length = 2019

Score = 40.1 bits (20), Expect = 0.004
Identities = 23/24 (95%)
Strand = Plus / Plus


Query: 446 tgaaagaaaagaaaatgataaaat 469
||||||||||||||||||| ||||
Sbjct: 241 tgaaagaaaagaaaatgatcaaat 264


>Contig-U15528-1 (Contig-U15528-1Q) /CSM_Contig/Contig-U15528-1Q.Seq.d
Length = 3445

Score = 38.2 bits (19), Expect = 0.016
Identities = 22/23 (95%)
Strand = Plus / Plus


Query: 368 aaaaattgttaaaaagaatccaa 390
||||||||||||||| |||||||
Sbjct: 2972 aaaaattgttaaaaaaaatccaa 2994


Database: CSM
Posted date: Jun 21, 2004 1:35 PM
Number of letters in database: 8,075,542
Number of sequences in database: 8402

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 12,195
Number of Sequences: 8402
Number of extensions: 12195
Number of successful extensions: 1502
Number of sequences better than 10.0: 194
length of query: 646
length of database: 8,075,542
effective HSP length: 16
effective length of query: 630
effective length of database: 7,941,110
effective search space: 5002899300
effective search space used: 5002899300
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 1.12
Homology vs DNA
Query= Contig-U15129-1 (Contig-U15129-1Q) /CSM_Contig/Contig-U15129-1Q.Seq.d
(646 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU284672) Dictyostelium discoideum gamete cDNA clone:FC-BG2... 609 0.0 2
(C22919) Dictyostelium discoideum gamete cDNA, clone FC-AL09. 609 0.0 2
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 609 e-178 2
(AU262752) Dictyostelium discoideum vegetative cDNA clone:VS... 579 e-161 1
(FK217691) XABT222017.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK162143) XABT187534.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK145124) XABT176993.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK121386) XABT162661.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK111477) XABT156565.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK106677) XABT153565.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK100767) XABT148885.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK090375) XABT142537.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK080551) XABT136371.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK080550) XABT136371.b1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK061737) XABT124908.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FK056878) XABT121960.g1 Gateway compatible cien cDNA librar... 54 0.006 1
(FF806885) XABT97678.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF798785) XABT91962.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF775330) XABT76104.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF754374) XABT61857.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF745677) XABT55853.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF738907) XABT51322.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF722613) XABT39200.rev Gateway compatible cien cDNA librar... 54 0.006 1
(FF698369) XABT108432.rev Gateway compatible cien cDNA libra... 54 0.006 1
(CU862054) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.39 1
(CU463979) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.39 1
(AM481148) Vitis vinifera contig VV78X076844.7, whole genome... 34 0.97 2
(DX041297) KBrB041F08R KBrB, Brassica rapa BamHI BAC library... 32 1.3 3
(ED519329) KBrB105K03F KBrB, Brassica rapa BamHI BAC library... 32 1.5 3
(ED526285) KBrB115K03F KBrB, Brassica rapa BamHI BAC library... 32 1.5 3
(AM467232) Vitis vinifera contig VV78X243508.10, whole genom... 46 1.6 1
(AC213131) Oryza glaberrima clone OG_BBa0031E23, complete se... 46 1.6 1
(BD455614) Listeria monocytogenes genome,polypeptides and uses. 46 1.6 1
(AX641665) Sequence 2855 from Patent WO0101118. 46 1.6 1
(AX638811) Sequence 1 from Patent WO0101118. 46 1.6 1
(CW759006) OG_BBa0066P23.r OG_BBa Oryza glaberrima genomic c... 46 1.6 1
(FF691703) XABT104080.rev Gateway compatible cien cDNA libra... 46 1.6 1
(AL591974) Listeria monocytogenes strain EGD, complete genom... 46 1.6 1
(BX510929) Zebrafish DNA sequence from clone CH211-261F9. 44 6.1 1
(AC218144) Solanum lycopersicum chromosome 12 clone LE_HBa-8... 44 6.1 1
(AX416752) Sequence 3743 from Patent WO0228891. 44 6.1 1
(CR382400) Plasmodium falciparum chromosome 6, complete sequ... 44 6.1 1
(AC118823) Rattus norvegicus clone CH230-466D22, *** SEQUENC... 44 6.1 1
(AC216955) Solanum tuberosum chromosome 6 clone RHPOTKEY174L... 44 6.1 1
(AC205926) Pongo abelii chromosome UNKNOWN clone CH276-36H14... 44 6.1 1
(ER571315) 1093015793324 Global-Ocean-Sampling_GS-36-01-01-2... 44 6.1 1
(ER453226) 1092963858221 Global-Ocean-Sampling_GS-35-01-01-1... 44 6.1 1
(CL646190) CH213-110B22.T7 CH213 Gasterosteus aculeatus geno... 44 6.1 1
(DY546363) AGENCOURT_69868182 NIH_ZGC_28 Danio rerio cDNA cl... 44 6.1 1
(EX847695) CBNC7029.rev CBNC Phycomyces blakesleeanus NRRL15... 44 6.1 1
(EX816915) CBNA5281.rev CBNA Phycomyces blakesleeanus NRRL15... 44 6.1 1
(CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 44 6.1 1
(CP000513) Dichelobacter nodosus VCS1703A, complete genome. 44 6.1 1
(AE017262) Listeria monocytogenes str. 4b F2365, complete ge... 44 6.1 1

>(AU284672) Dictyostelium discoideum gamete cDNA clone:FC-BG20, 3'
end single read.
Length = 646

Score = 609 bits (307), Expect(2) = 0.0
Identities = 307/307 (100%)
Strand = Plus / Plus


Query: 127 tttttgaaattgttcataaacatcaaaagtttatttcaggtgtttgtatttcaaagacac 186
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 127 tttttgaaattgttcataaacatcaaaagtttatttcaggtgtttgtatttcaaagacac 186


Query: 187 atactaaaacagcaatgtgtcaagtaaagagattatattttgataaaggaaaatattcag 246
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187 atactaaaacagcaatgtgtcaagtaaagagattatattttgataaaggaaaatattcag 246


Query: 247 ctttaaattataaaactaccaaatatatgattcacgatccaaatgatatttgtgcagttg 306
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 247 ctttaaattataaaactaccaaatatatgattcacgatccaaatgatatttgtgcagttg 306


Query: 307 gtgatcaagttcactttagagaatgtgcaccagtttcaaagagaaaagcacacgtagtcg 366
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 307 gtgatcaagttcactttagagaatgtgcaccagtttcaaagagaaaagcacacgtagtcg 366


Query: 367 aaaaaattgttaaaaagaatccaatcactgaattccttagacaaaacccacaatatattg 426
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 367 aaaaaattgttaaaaagaatccaatcactgaattccttagacaaaacccacaatatattg 426


Query: 427 ttacacc 433
|||||||
Sbjct: 427 ttacacc 433

Score = 73.8 bits (37), Expect(2) = 0.0
Identities = 37/37 (100%)
Strand = Plus / Plus


Query: 1 gtccgcacacacaaaattttcaatcagattatttgtc 37
|||||||||||||||||||||||||||||||||||||
Sbjct: 1 gtccgcacacacaaaattttcaatcagattatttgtc 37

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 490,919,588
Number of extensions: 29825939
Number of successful extensions: 2335347
Number of sequences better than 10.0: 54
Length of query: 646
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 623
Effective length of database: 93,106,754,628
Effective search space: 58005508133244
Effective search space used: 58005508133244
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.15
Homology vs Protein
Query= Contig-U15129-1 (Contig-U15129-1Q) /CSM_Contig/Contig-U15129-1Q.Seq.d
(646 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(Q86K64) RecName: Full=Probable 28S ribosomal protein S17, mitoc... 256 5e-67
CP001130_272(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 58 2e-07
(Q89A75) RecName: Full=30S ribosomal protein S17; &AE016826_420... 58 2e-07
T16978(T16978) ribosomal protein S17 - curled-leaved tobacco &Y... 56 1e-06
AC143338_5(AC143338|pid:none) Medicago truncatula clone mth2-8d1... 53 7e-06
CP001634_1845(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 53 9e-06
(A0T0I8) RecName: Full=30S ribosomal protein S17, chloroplastic;... 52 1e-05
(Q493J9) RecName: Full=30S ribosomal protein S17; &CP000016_192... 52 1e-05
(B5Z8V8) RecName: Full=30S ribosomal protein S17; &(B6JNE8) Rec... 50 4e-05
(Q2IJ76) RecName: Full=30S ribosomal protein S17; &CP000251_193... 50 6e-05
(Q8K959) RecName: Full=30S ribosomal protein S17; &AE013218_467... 50 6e-05
(Q318J3) RecName: Full=30S ribosomal protein S17; &CP000111_179... 50 6e-05
(A6TEW3) RecName: Full=30S ribosomal protein S17; &AP006725_456... 50 6e-05
BT038312_1(BT038312|pid:none) Zea mays full-length cDNA clone ZM... 50 7e-05
(A2BYS7) RecName: Full=30S ribosomal protein S17; &CP000552_173... 50 7e-05
AK070753_1(AK070753|pid:none) Oryza sativa Japonica Group cDNA c... 50 7e-05
CP001277_1672(CP001277|pid:none) Candidatus Hamiltonella defensa... 49 1e-04
(Q6CZX9) RecName: Full=30S ribosomal protein S17; &BX950851_399... 49 1e-04
AP008971_164(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 49 1e-04
CP001279_1570(CP001279|pid:none) Nautilia profundicola AmH, comp... 49 1e-04
AK118396_1(AK118396|pid:none) Arabidopsis thaliana At3g18880 mRN... 49 1e-04
(A1AGK0) RecName: Full=30S ribosomal protein S17; &(A7MPH2) Rec... 49 1e-04
(O46903) RecName: Full=30S ribosomal protein S17, chloroplastic;... 49 1e-04
(Q11QC1) RecName: Full=30S ribosomal protein S17; &CP000383_310... 49 2e-04
(A5F557) RecName: Full=30S ribosomal protein S17; &(Q9KNZ3) Rec... 49 2e-04
(O66439) RecName: Full=30S ribosomal protein S17; &AE000657_12(... 49 2e-04
(Q7TU28) RecName: Full=30S ribosomal protein S17; &BX548174_179... 48 2e-04
(A5FZV6) RecName: Full=30S ribosomal protein S17; &CP000697_190... 48 2e-04
(A8GKI8) RecName: Full=30S ribosomal protein S17; &CP000826_451... 48 2e-04
(A1JS24) RecName: Full=30S ribosomal protein S17; &(A4TH01) Rec... 48 2e-04
CP001600_3451(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 48 2e-04
(B5YG38) RecName: Full=30S ribosomal protein S17; &CP001147_138... 48 3e-04
CP001575_19(CP001575|pid:none) Micromonas sp. RCC299 chromosome ... 48 3e-04
CR954215_245(CR954215|pid:none) Ostreococcus tauri strain OTTH05... 48 3e-04
(A8AQK7) RecName: Full=30S ribosomal protein S17; &CP000822_459... 48 3e-04
(B1GZ92) RecName: Full=30S ribosomal protein S17; &AP009510_91(... 48 3e-04
CP001089_1337(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 48 3e-04
EU965865_1(EU965865|pid:none) Zea mays clone 289527 30S ribosoma... 48 3e-04
(P46175) RecName: Full=30S ribosomal protein S17; &D31786_4(D31... 47 4e-04
(Q0BYC3) RecName: Full=30S ribosomal protein S17; &CP000158_278... 47 4e-04
(P57582) RecName: Full=30S ribosomal protein S17; &BA000003_480... 47 4e-04
(A6Q1I7) RecName: Full=30S ribosomal protein S17; &AP009178_232... 47 5e-04
CU468135_3154(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 47 5e-04
(Q8R7W3) RecName: Full=30S ribosomal protein S17; &AE008691_210... 47 6e-04
(A8ESV2) RecName: Full=30S ribosomal protein S17; &CP000361_741... 47 6e-04
CP001139_233(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 47 6e-04
(A4WFB9) RecName: Full=30S ribosomal protein S17; &CP000653_370... 47 6e-04
(Q5E8A6) RecName: Full=30S ribosomal protein S17; &CP000020_239... 47 6e-04
(Q3API2) RecName: Full=30S ribosomal protein S17; &CP000108_181... 46 8e-04
CP000916_1002(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 46 8e-04
EU964315_1(EU964315|pid:none) Zea mays clone 277911 30S ribosoma... 46 8e-04
(Q6LVA7) RecName: Full=30S ribosomal protein S17; &CR378663_313... 46 8e-04
(A0KF30) RecName: Full=30S ribosomal protein S17; &CP000462_299... 46 8e-04
CP001291_3619(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 46 8e-04
AP010904_1229(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 46 8e-04
EF084043_1(EF084043|pid:none) Picea sitchensis clone WS02712_A05... 46 8e-04
AM480261_2(AM480261|pid:none) Vitis vinifera contig VV78X072490.... 46 8e-04
(Q7VKE0) RecName: Full=30S ribosomal protein S17; &AE017143_166... 46 8e-04
(Q6B8W2) RecName: Full=30S ribosomal protein S17, chloroplastic;... 46 0.001
CP000806_4019(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 46 0.001
CP001321_1460(CP001321|pid:none) Haemophilus parasuis SH0165, co... 46 0.001
(A4SSZ7) RecName: Full=30S ribosomal protein S17; &CP000644_380... 45 0.001
(A7N9T4) RecName: Full=30S ribosomal protein S17; &(Q0BNR8) Rec... 45 0.001
CP001103_452(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 45 0.001
(A0Q4J2) RecName: Full=30S ribosomal protein S17; &(A4IZS5) Rec... 45 0.001
(A5UDT8) RecName: Full=30S ribosomal protein S17; &(A5UHT9) Rec... 45 0.002
(P24321) RecName: Full=30S ribosomal protein S17; &(P62658) Rec... 45 0.002
CP001616_108(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 45 0.002
EU168190_137(EU168190|pid:none) Heterosigma akashiwo strain NIES... 45 0.002
CP000628_1488(CP000628|pid:none) Agrobacterium radiobacter K84 c... 45 0.002
(Q28UU5) RecName: Full=30S ribosomal protein S17; &CP000264_600... 45 0.002
(Q601K5) RecName: Full=30S ribosomal protein S17; &AE017332_195... 45 0.002
(A8F4S0) RecName: Full=30S ribosomal protein S17; &CP000812_581... 45 0.002
(Q2W2K0) RecName: Full=30S ribosomal protein S17; &AP007255_312... 45 0.002
(A9NAX9) RecName: Full=30S ribosomal protein S17; &CP000890_294... 45 0.002
CP000698_1063(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 45 0.002
Z21677_11(Z21677|pid:none) Thermotoga maritima DNA for spc operon. 45 0.002
CP001087_3559(CP001087|pid:none) Desulfobacterium autotrophicum ... 45 0.002
(P38519) RecName: Full=30S ribosomal protein S17; &AE000512_146... 45 0.002
(Q4A8I0) RecName: Full=30S ribosomal protein S17; &(Q4AAE9) Rec... 45 0.002
CP001393_1664(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 45 0.002
(A6LLM2) RecName: Full=30S ribosomal protein S17; &CP000716_941... 45 0.002
(A9KD22) RecName: Full=30S ribosomal protein S17; 44 0.003
(Q65QW4) RecName: Full=30S ribosomal protein S17; &AE016827_203... 44 0.003
(P51305) RecName: Full=30S ribosomal protein S17, chloroplastic;... 44 0.003
GQ231541_35(GQ231541|pid:none) Aureococcus anophagefferens strai... 44 0.003
(Q7MYG0) RecName: Full=30S ribosomal protein S17; &BX571874_258... 44 0.003
CP001019_1573(CP001019|pid:none) Coxiella burnetii CbuG_Q212, co... 44 0.004
(P55829) RecName: Full=30S ribosomal protein S17; &D64071_10(D6... 44 0.004
CP001390_3579(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 44 0.004
(Q0VSJ4) RecName: Full=30S ribosomal protein S17; &AM286690_406... 44 0.004
(B6EPT4) RecName: Full=30S ribosomal protein S17; &FM178379_329... 44 0.004
CP001357_2088(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 44 0.004
(A5IHQ5) RecName: Full=30S ribosomal protein S17; &(Q5WZK3) Rec... 44 0.004
FM954972_2655(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 44 0.004
CP000777_1861(CP000777|pid:none) Leptospira biflexa serovar Pato... 44 0.005
(A6VLJ7) RecName: Full=30S ribosomal protein S17; &CP000746_462... 44 0.005
(B0U0Y0) RecName: Full=30S ribosomal protein S17; &CP000937_573... 44 0.005
(A6X0C7) RecName: Full=30S ribosomal protein S17; &CP000758_194... 43 0.007
(Q8EUC2) RecName: Full=30S ribosomal protein S17; &BA000026_100... 43 0.007
(Q6FZD1) RecName: Full=30S ribosomal protein S17; &BX897700_789... 43 0.007
(B1LBN1) RecName: Full=30S ribosomal protein S17; &CP000969_136... 43 0.007
CP001101_2202(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 43 0.007
(Q3AMN9) RecName: Full=30S ribosomal protein S17; &CP000110_361... 43 0.007
(Q5FTZ2) RecName: Full=30S ribosomal protein S17; &CP000009_355... 43 0.009
CP001389_1178(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 43 0.009
(Q2K9K7) RecName: Full=30S ribosomal protein S17; &CP000133_165... 43 0.009
(Q30TV5) RecName: Full=30S ribosomal protein S17; &CP000153_295... 43 0.009
CU466930_1075(CU466930|pid:none) Candidatus Cloacamonas acidamin... 43 0.009
(Q92QG1) RecName: Full=30S ribosomal protein S17; &AL591688_137... 43 0.009
(Q1XDI3) RecName: Full=30S ribosomal protein S17, chloroplastic;... 43 0.009
(Q7TUP4) RecName: Full=30S ribosomal protein S17; &BX548175_226... 43 0.009
CP000487_43(CP000487|pid:none) Campylobacter fetus subsp. fetus ... 43 0.009
(Q0ANQ9) RecName: Full=30S ribosomal protein S17; &CP000449_178... 43 0.009
CP001074_1730(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 43 0.009
(A7HZL5) RecName: Full=30S ribosomal protein S17; &CP000776_84(... 42 0.012
AY552545_85(AY552545|pid:none) Uncultured marine gamma proteobac... 42 0.012
(Q605C1) RecName: Full=30S ribosomal protein S17; &AE017282_223... 42 0.012
CT573071_733(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 42 0.012
(B0C1E2) RecName: Full=30S ribosomal protein S17; &CP000828_459... 42 0.012
(A8LM66) RecName: Full=30S ribosomal protein S17; &CP000830_294... 42 0.012
(A9IW16) RecName: Full=30S ribosomal protein S17; &AM260525_135... 42 0.012
CP001287_239(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 42 0.012
(P54036) RecName: Full=30S ribosomal protein S17P; &A64358(A643... 42 0.012
(Q9CL40) RecName: Full=30S ribosomal protein S17; &AE004439_140... 42 0.015
CP001108_1999(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 42 0.015
CP000607_248(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 42 0.015
AM920437_203(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 42 0.015
(A5GIT6) RecName: Full=30S ribosomal protein S17; &CT971583_425... 42 0.015
(A2SLE8) RecName: Full=30S ribosomal protein S17; &CP000555_342... 42 0.015
(Q2LQB1) RecName: Full=30S ribosomal protein S17; &CP000252_311... 42 0.015
(A8GVC3) RecName: Full=30S ribosomal protein S17; &(Q1RHN0) Rec... 42 0.015
(Q5JDH9) RecName: Full=30S ribosomal protein S17P; &AP006878_15... 42 0.015
CP000951_1040(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 42 0.015
CP001472_1375(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 42 0.015
CP000932_66(CP000932|pid:none) Campylobacter lari RM2100, comple... 42 0.015
CP001011_431(CP001011|pid:none) Xylella fastidiosa M23, complete... 42 0.015
(Q87E73) RecName: Full=30S ribosomal protein S17; &AE009442_417... 42 0.015
(Q8ABV5) RecName: Full=30S ribosomal protein S17 2; 42 0.020
(A5GVW9) RecName: Full=30S ribosomal protein S17; &CT978603_212... 42 0.020
(A5FRY4) RecName: Full=30S ribosomal protein S17; &(Q3ZZL5) Rec... 42 0.020
(A1W1V1) RecName: Full=30S ribosomal protein S17; &(A8FP12) Rec... 42 0.020
(Q6G2X4) RecName: Full=30S ribosomal protein S17; &BX897699_101... 42 0.020
CP001330_486(CP001330|pid:none) Micromonas sp. RCC299 chromosome... 41 0.026
AY548435_2(AY548435|pid:none) Fremyella diplosiphon clone 3088E1... 41 0.026
(A7H647) RecName: Full=30S ribosomal protein S17; &CP000768_170... 41 0.026
CP000510_3327(CP000510|pid:none) Psychromonas ingrahamii 37, com... 41 0.026
CP000594_316(CP000594|pid:none) Ostreococcus lucimarinus CCE9901... 41 0.026
(A0KRN3) RecName: Full=30S ribosomal protein S17; &(Q0HNS8) Rec... 41 0.026
CP000139_770(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 41 0.034
(A6U868) RecName: Full=30S ribosomal protein S17; &CP000738_988... 41 0.034
CP001344_1085(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 41 0.034
(A8G1D9) RecName: Full=30S ribosomal protein S17; &CP000821_429... 41 0.034
CP000860_226(CP000860|pid:none) Candidatus Desulforudis audaxvia... 41 0.034
(A0LIJ9) RecName: Full=30S ribosomal protein S17; &CP000478_154... 41 0.034
(B1KMX4) RecName: Full=30S ribosomal protein S17; &CP000961_463... 40 0.045
(Q9PE67) RecName: Full=30S ribosomal protein S17; &A82718(A8271... 40 0.045
(B8DNA5) RecName: Full=30S ribosomal protein S17; &CP001197_87(... 40 0.045
(A1REC3) RecName: Full=30S ribosomal protein S17; &(A3DA63) Rec... 40 0.045
(Q0AII7) RecName: Full=30S ribosomal protein S17; &CP000450_546... 40 0.045
(B0TM03) RecName: Full=30S ribosomal protein S17; &CP000931_408... 40 0.045
CP000878_1670(CP000878|pid:none) Prochlorococcus marinus str. MI... 40 0.045
CP001281_3157(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 40 0.045
AM999887_1174(AM999887|pid:none) Wolbachia endosymbiont of Culex... 40 0.058
(B1YGV9) RecName: Full=30S ribosomal protein S17; &CP001022_104... 40 0.058
(Q67JV2) RecName: Full=30S ribosomal protein S17; &AP006840_306... 40 0.058
(Q83ER7) RecName: Full=30S ribosomal protein S17; 40 0.058
(A3Q991) RecName: Full=30S ribosomal protein S17; &CP000606_166... 40 0.058
(Q2FT32) RecName: Full=30S ribosomal protein S17P; &CP000254_21... 40 0.058
AM889285_3395(AM889285|pid:none) Gluconacetobacter diazotrophicu... 40 0.058
CP001398_1994(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 40 0.076
CP001099_184(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 40 0.076
(Q2YAY8) RecName: Full=30S ribosomal protein S17; &CP000103_774... 40 0.076
CP001339_2290(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 40 0.076
(Q1QDH7) RecName: Full=30S ribosomal protein S17; &CP000323_492... 40 0.076
AP008981_1053(AP008981|pid:none) Orientia tsutsugamushi str. Ike... 40 0.076
CP000492_2325(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 40 0.076
(Q9CQE3) RecName: Full=28S ribosomal protein S17, mitochondrial;... 40 0.076
(Q4FUE7) RecName: Full=30S ribosomal protein S17; &CP000082_498... 40 0.076
CP000586_172(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 40 0.076
AE016828_209(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 39 0.099
(Q3YRL8) RecName: Full=30S ribosomal protein S17; &CP000107_586... 39 0.099
(A8Z676) RecName: Full=30S ribosomal protein S17; &CP000770_193... 39 0.099
(Q39XZ7) RecName: Full=30S ribosomal protein S17; &CP000148_627... 39 0.099
AY911326_1(AY911326|pid:none) Bos taurus clone IMAGE:7961465 mit... 39 0.099
(P16180) RecName: Full=30S ribosomal protein S17, chloroplastic;... 39 0.099
J05215_1(J05215|pid:none) A.thaliana chloroplast ribosomal prote... 39 0.099
(A5D5G4) RecName: Full=30S ribosomal protein S17; &AP009389_329... 39 0.099
(Q0ABG6) RecName: Full=30S ribosomal protein S17; &CP000453_462... 39 0.099
(A4XZ81) RecName: Full=30S ribosomal protein S17; &CP000680_387... 39 0.13
(P82916) RecName: Full=28S ribosomal protein S17, mitochondrial;... 39 0.13
(Q8TW21) RecName: Full=30S ribosomal protein S17P; &AE009439_12... 39 0.13
CP001102_170(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 39 0.13
CP001013_3968(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 39 0.13
FM992691_64(FM992691|pid:none) Candida dubliniensis CD36 chromos... 39 0.13
CP001146_823(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 39 0.17
(Q7UN11) RecName: Full=30S ribosomal protein S17; 39 0.17
(P73311) RecName: Full=30S ribosomal protein S17; &BA000022_762... 39 0.17
(Q748Z7) RecName: Full=30S ribosomal protein S17; &AE017180_283... 39 0.17
(Q5F5T6) RecName: Full=30S ribosomal protein S17; &AE004969_167... 39 0.17
DQ214813_1(DQ214813|pid:none) Taeniopygia guttata clone 0058P003... 39 0.17
CU207366_2793(CU207366|pid:none) Gramella forsetii KT0803 comple... 38 0.22
AM494971_383(AM494971|pid:none) Leishmania braziliensis chromoso... 38 0.22
CP000140_2301(CP000140|pid:none) Parabacteroides distasonis ATCC... 38 0.22
CP000612_221(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 38 0.22
AM270183_11(AM270183|pid:none) Aspergillus niger contig An08c028... 38 0.22
(A1W2R6) RecName: Full=30S ribosomal protein S17; &CP000539_285... 38 0.22
CP000488_162(CP000488|pid:none) Candidatus Ruthia magnifica str.... 38 0.22
(Q1ISB3) RecName: Full=30S ribosomal protein S17; &CP000360_123... 38 0.22
(Q824P2) RecName: Full=30S ribosomal protein S17; &AE015925_101... 38 0.22
CU459003_3796(CU459003|pid:none) Magnetospirillum gryphiswaldens... 38 0.29
(A1S227) RecName: Full=30S ribosomal protein S17; &CP000507_221... 38 0.29
(Q1R0G6) RecName: Full=30S ribosomal protein S17; &CP000285_427... 38 0.29
(A1KRI2) RecName: Full=30S ribosomal protein S17; &(A9M3V7) Rec... 38 0.29
(Q73H95) RecName: Full=30S ribosomal protein S17; &AE017196_601... 38 0.29
(Q18CG8) RecName: Full=30S ribosomal protein S17; &AM180355_83(... 38 0.29
(Q4JT56) RecName: Full=30S ribosomal protein S17; &CR931997_182... 38 0.29
BC095143_1(BC095143|pid:none) Danio rerio zgc:110031, mRNA (cDNA... 38 0.29
(Q98PZ1) RecName: Full=30S ribosomal protein S17; &AL445565_51(... 38 0.29
CP000975_687(CP000975|pid:none) Methylacidiphilum infernorum V4,... 38 0.29
(B7IHV5) RecName: Full=30S ribosomal protein S17; &CP001185_119... 38 0.29
(Q5P323) RecName: Full=30S ribosomal protein S17; &CR555306_216... 37 0.38
(Q9Y2R5) RecName: Full=28S ribosomal protein S17, mitochondrial;... 37 0.38
(A7NR54) RecName: Full=30S ribosomal protein S17; &CP000804_391... 37 0.38
BT049440_1(BT049440|pid:none) Salmo salar clone ssal-evd-522-223... 37 0.38
CP000743_1376(CP000743|pid:none) Methanococcus aeolicus Nankai-3... 37 0.38
BC037405_1(BC037405|pid:none) Homo sapiens mitochondrial ribosom... 37 0.38
(A1TYK6) RecName: Full=30S ribosomal protein S17; &CP000514_717... 37 0.38
(A6UZJ7) RecName: Full=30S ribosomal protein S17; &(B7V653) Rec... 37 0.49
(B1IGE5) RecName: Full=30S ribosomal protein S17; &CP000939_348... 37 0.49
AY657043_1(AY657043|pid:none) Synthetic construct Peudomonas aer... 37 0.49
(A4VHN9) RecName: Full=30S ribosomal protein S17; &CP000304_782... 37 0.49
(A5CCK3) RecName: Full=30S ribosomal protein S17; &AM494475_367... 37 0.49
AP010656_85(AP010656|pid:none) Candidatus Azobacteroides pseudot... 37 0.49
CP001358_657(CP001358|pid:none) Desulfovibrio desulfuricans subs... 37 0.49
(Q488A2) RecName: Full=30S ribosomal protein S17; &CP000083_831... 37 0.49
(Q04PU7) RecName: Full=30S ribosomal protein S17; &CP000348_381... 37 0.49
CP000081_381(CP000081|pid:none) Leishmania major chromosome 35, ... 37 0.64
CR382138_249(CR382138|pid:none) Debaryomyces hansenii strain CBS... 37 0.64
(Q134T8) RecName: Full=30S ribosomal protein S17; &(Q2IXQ1) Rec... 37 0.64
(Q2RFQ6) RecName: Full=30S ribosomal protein S17; &CP000232_239... 37 0.64
(Q0BUP1) RecName: Full=30S ribosomal protein S17; &CP000394_563... 37 0.64
CP000236_401(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan... 37 0.64
(A9BPS7) RecName: Full=30S ribosomal protein S17; &CP000884_399... 37 0.64
(Q089P5) RecName: Full=30S ribosomal protein S17; &CP000447_157... 37 0.64
(Q8TRT8) RecName: Full=30S ribosomal protein S17P; &AE010299_10... 37 0.64
(Q7NQG1) RecName: Full=30S ribosomal protein S17; &AE016825_417... 37 0.64
(Q6LXE4) RecName: Full=30S ribosomal protein S17P; &BX950229_14... 37 0.64
(Q046B6) RecName: Full=30S ribosomal protein S17; &(Q74L80) Rec... 37 0.64
(Q2GH47) RecName: Full=30S ribosomal protein S17; 37 0.64
AM398681_1294(AM398681|pid:none) Flavobacterium psychrophilum JI... 37 0.64
(Q6F7S1) RecName: Full=30S ribosomal protein S17; &CR543861_289... 36 0.84
(Q7MTM2) RecName: Full=30S ribosomal protein S17; &AE015924_165... 36 0.84
GQ231542_18(GQ231542|pid:none) Aureoumbra lagunensis strain CCMP... 36 0.84
(A5I7J7) RecName: Full=30S ribosomal protein S17; &(A7FZ60) Rec... 36 0.84
CP000885_3614(CP000885|pid:none) Clostridium phytofermentans ISD... 36 0.84
CP001157_617(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 36 0.84
(A8GT60) RecName: Full=30S ribosomal protein S17; &CP000848_989... 36 0.84
(B1AIM9) RecName: Full=30S ribosomal protein S17; &(B5ZB49) Rec... 36 0.84
(P12741) RecName: Full=30S ribosomal protein S17P; AltName: Full... 36 0.84
(Q5NQ56) RecName: Full=30S ribosomal protein S17; &AE008692_525... 36 0.84
(B0KK76) RecName: Full=30S ribosomal protein S17; &(B1JDX5) Rec... 36 0.84
(B0BUQ1) RecName: Full=30S ribosomal protein S17; &CP000766_102... 36 0.84
(A5EX90) RecName: Full=30S ribosomal protein S17; &CP000513_120... 36 0.84
CP001145_954(CP001145|pid:none) Coprothermobacter proteolyticus ... 36 0.84
(Q12ZU2) RecName: Full=30S ribosomal protein S17P; &CP000300_10... 36 1.1
(Q48D45) RecName: Full=30S ribosomal protein S17; &(Q4ZMQ3) Rec... 36 1.1
(A4XBN7) RecName: Full=30S ribosomal protein S17; &CP000667_385... 36 1.1
(A1KB18) RecName: Full=30S ribosomal protein S17; 36 1.1
CP000473_5048(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 36 1.1
(B2FQJ3) RecName: Full=30S ribosomal protein S17; &AM743169_866... 36 1.1
EU686639_11(EU686639|pid:none) Uncultured marine group II euryar... 36 1.1
FM864216_133(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T... 36 1.1
CP000509_3844(CP000509|pid:none) Nocardioides sp. JS614, complet... 36 1.1
(A9NEE2) RecName: Full=30S ribosomal protein S17; &CP000896_78(... 36 1.1
AE006914_997(AE006914|pid:none) Rickettsia conorii str. Malish 7... 36 1.1
CP001322_1893(CP001322|pid:none) Desulfatibacillum alkenivorans ... 36 1.1
(Q92GX5) RecName: Full=30S ribosomal protein S17; &CP001227_756... 36 1.1
(A6LPS0) RecName: Full=30S ribosomal protein S17; &CP000721_160... 36 1.1
BT082752_1(BT082752|pid:none) Anoplopoma fimbria clone afim-evh-... 36 1.1
AL606656_5(AL606656|pid:none) Oryza sativa genomic DNA, chromoso... 36 1.1
CP001612_770(CP001612|pid:none) Rickettsia africae ESF-5, comple... 35 1.4
(A6TWH3) RecName: Full=30S ribosomal protein S17; &CP000724_429... 35 1.4
(Q6ME54) RecName: Full=30S ribosomal protein S17; &BX908798_421... 35 1.4
CP001337_2922(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 35 1.4
CU207211_2994(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 35 1.4
BC121535_1(BC121535|pid:none) Xenopus tropicalis mitochondrial r... 35 1.4
AP008957_1861(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 35 1.4
(Q8RIG4) RecName: Full=30S ribosomal protein S17; &AE009951_131... 35 1.4
(A8EZK7) RecName: Full=30S ribosomal protein S17; &CP000409_837... 35 1.4
CP001251_929(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 35 1.4
(Q5FFU9) RecName: Full=30S ribosomal protein S17; &(Q5HAT1) Rec... 35 1.4
CP001154_261(CP001154|pid:none) Laribacter hongkongensis HLHK9, ... 35 1.4
CR767821_622(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 35 1.4
(Q68W87) RecName: Full=30S ribosomal protein S17; &AE017197_615... 35 1.4
(A8YXL4) RecName: Full=30S ribosomal protein S17; &CP000517_254... 35 1.4
(Q3SSV7) RecName: Full=30S ribosomal protein S17; &CP000115_136... 35 1.9
(Q9V1U5) RecName: Full=30S ribosomal protein S17P; &AJ248284_34... 35 1.9
(A6W383) RecName: Full=30S ribosomal protein S17; &CP000749_421... 35 1.9
(Q02W33) RecName: Full=30S ribosomal protein S17; &CP000425_220... 35 1.9
(A5VXQ6) RecName: Full=30S ribosomal protein S17; &(Q88QM6) Rec... 35 1.9
AM746676_7968(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 35 1.9
(Q21RW7) RecName: Full=30S ribosomal protein S17; &CP000267_372... 35 1.9
(A1WHD4) RecName: Full=30S ribosomal protein S17; &CP000542_124... 35 1.9
CU469464_350(CU469464|pid:none) Candidatus Phytoplasma mali stra... 35 1.9
(Q1AU38) RecName: Full=30S ribosomal protein S17; &CP000386_210... 35 1.9
(Q4G357) RecName: Full=30S ribosomal protein S17, chloroplastic;... 35 1.9
AP009152_625(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 35 1.9
(A2RNP6) RecName: Full=30S ribosomal protein S17; &(Q9CDX1) Rec... 35 2.4
(Q5FM81) RecName: Full=30S ribosomal protein S17; &CP000033_285... 35 2.4
CP000568_2868(CP000568|pid:none) Clostridium thermocellum ATCC 2... 35 2.4
(A1WVB3) RecName: Full=30S ribosomal protein S17; &CP000544_830... 35 2.4
(Q13TH9) RecName: Full=30S ribosomal protein S17; &CP000270_407... 35 2.4
CP000678_752(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 35 2.4
AE013599_4062(AE013599|pid:none) Drosophila melanogaster chromos... 35 2.4
AP009153_882(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 35 2.4
(Q7VTC4) RecName: Full=30S ribosomal protein S17; &(Q7W2E7) Rec... 35 2.4
(O31164) RecName: Full=30S ribosomal protein S17; &AF031160_6(A... 35 2.4
AE008384_2133(AE008384|pid:none) Methanosarcina mazei strain Goe... 35 2.4
(A9IIY6) RecName: Full=30S ribosomal protein S17; &AM902716_496... 34 3.2
(B5XJ45) RecName: Full=30S ribosomal protein S17; &(Q1J905) Rec... 34 3.2
CP001104_298(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 34 3.2
(Q1GPA8) RecName: Full=30S ribosomal protein S17; &CP000356_278... 34 3.2
(Q3K5Z7) RecName: Full=30S ribosomal protein S17; &(Q4K542) Rec... 34 3.2
(Q0S3G7) RecName: Full=30S ribosomal protein S17; &AP011115_619... 34 3.2
EU686610_20(EU686610|pid:none) Uncultured marine group II euryar... 34 3.2
(Q07KM7) RecName: Full=30S ribosomal protein S17; &(Q211F7) Rec... 34 3.2
CP001399_1377(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 34 3.2
(B0RU73) RecName: Full=30S ribosomal protein S17; &AM920689_348... 34 3.2
(Q82X80) RecName: Full=30S ribosomal protein S17; &AL954747_410... 34 3.2
CP001628_1619(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 34 4.2
(A7X5F0) RecName: Full=30S ribosomal protein S17; &(Q7A462) Rec... 34 4.2
CP001056_217(CP001056|pid:none) Clostridium botulinum B str. Ekl... 34 4.2
CP001601_398(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 34 4.2
CP001047_322(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ... 34 4.2
(A1V894) RecName: Full=30S ribosomal protein S17; &(A2S7I5) Rec... 34 4.2
(Q2SU36) RecName: Full=30S ribosomal protein S17; &CP000086_300... 34 4.2
(Q8DS22) RecName: Full=30S ribosomal protein S17; &AE014133_182... 34 4.2
AP007281_1385(AP007281|pid:none) Lactobacillus reuteri JCM 1112 ... 34 4.2
CP000477_1682(CP000477|pid:none) Methanosaeta thermophila PT, co... 34 4.2
(Q4URE8) RecName: Full=30S ribosomal protein S17; &(Q8PC41) Rec... 34 4.2
(B6JEU2) RecName: Full=30S ribosomal protein S17; &CP001196_166... 33 5.4
BX294146_296(BX294146|pid:none) Rhodopirellula baltica SH 1 comp... 33 5.4
(A4QBJ1) RecName: Full=30S ribosomal protein S17; &(Q8NSZ7) Rec... 33 5.4
(Q49ZF9) RecName: Full=30S ribosomal protein S17; &AP008934_672... 33 5.4
(A9ADK2) RecName: Full=30S ribosomal protein S17; &AP009385_293... 33 5.4
AE017343_457(AE017343|pid:none) Cryptococcus neoformans var. neo... 33 5.4
(Q8FS73) RecName: Full=30S ribosomal protein S17; &BA000035_531... 33 5.4
(A0K3N4) RecName: Full=30S ribosomal protein S17; &(B1JU31) Rec... 33 5.4
(A4YSK1) RecName: Full=30S ribosomal protein S17; &(A5ELL8) Rec... 33 7.1
AE016819_80(AE016819|pid:none) Ashbya gossypii (= Eremothecium g... 33 7.1
(Q2G8X1) RecName: Full=30S ribosomal protein S17; &CP000248_125... 33 7.1
CP001280_558(CP001280|pid:none) Methylocella silvestris BL2, com... 33 7.1
(Q4L8A5) RecName: Full=30S ribosomal protein S17; &AP006716_811... 33 7.1
(Q661D3) RecName: Full=30S ribosomal protein S17; &CP000013_479... 33 7.1
(Q9TJN6) RecName: Full=30S ribosomal protein S17, chloroplastic;... 33 7.1
(Q5HM08) RecName: Full=30S ribosomal protein S17; &(Q8CRG8) Rec... 33 7.1
(A5IV25) RecName: Full=30S ribosomal protein S17; &(A6QJ83) Rec... 33 7.1
(O28363) RecName: Full=30S ribosomal protein S17P; &AE000782_18... 33 7.1
(A2RC23) RecName: Full=30S ribosomal protein S17; &(Q5XEC6) Rec... 33 9.3
CP001071_289(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 33 9.3
CP000382_903(CP000382|pid:none) Clostridium novyi NT, complete g... 33 9.3
AP009484_204(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 33 9.3
(Q83FZ5) RecName: Full=30S ribosomal protein S17; &(Q83I69) Rec... 33 9.3
AM295250_1717(AM295250|pid:none) Staphylococcus carnosus subsp. ... 33 9.3
(A3CK72) RecName: Full=30S ribosomal protein S17; &(A4VSG3) Rec... 33 9.3
CP000481_313(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 33 9.3
(Q2S3Q5) RecName: Full=30S ribosomal protein S17; &CP000159_101... 33 9.3
(A4IJJ8) RecName: Full=30S ribosomal protein S17; &CP000557_115... 33 9.3
(Q9A8U4) RecName: Full=30S ribosomal protein S17; &AE005673_125... 33 9.3
(A4SUX0) RecName: Full=30S ribosomal protein S17; &CP000655_62(... 33 9.3
(B0T2D1) RecName: Full=30S ribosomal protein S17; &CP000927_161... 33 9.3
(Q38US1) RecName: Full=30S ribosomal protein S17; &CR936503_175... 33 9.3

>(Q86K64) RecName: Full=Probable 28S ribosomal protein S17,
mitochondrial; Short=S17mt; AltName:
Full=MRP-S17; Flags: Precursor;
&AC116977_43(AC116977|pid:none)
Length = 127

Score = 256 bits (653), Expect = 5e-67
Identities = 122/122 (100%), Positives = 122/122 (100%)
Frame = +3

Query: 129 FEIVHKHQKFISGVCISKTHTKTAMCQVKRLYFDKGKYSALNYKTTKYMIHDPNDICAVG 308
FEIVHKHQKFISGVCISKTHTKTAMCQVKRLYFDKGKYSALNYKTTKYMIHDPNDICAVG
Sbjct: 6 FEIVHKHQKFISGVCISKTHTKTAMCQVKRLYFDKGKYSALNYKTTKYMIHDPNDICAVG 65

Query: 309 DQVHFRECAPVSKRKAHVVEKIVKKNPITEFLRQNPQYIVTPKEIAERKENDKIKYKHIT 488
DQVHFRECAPVSKRKAHVVEKIVKKNPITEFLRQNPQYIVTPKEIAERKENDKIKYKHIT
Sbjct: 66 DQVHFRECAPVSKRKAHVVEKIVKKNPITEFLRQNPQYIVTPKEIAERKENDKIKYKHIT 125

Query: 489 DL 494
DL
Sbjct: 126 DL 127

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 604,796,525
Number of extensions: 9862660
Number of successful extensions: 24626
Number of sequences better than 10.0: 373
Number of HSP's gapped: 24603
Number of HSP's successfully gapped: 373
Length of query: 215
Length of database: 1,051,180,864
Length adjustment: 123
Effective length of query: 92
Effective length of database: 653,084,107
Effective search space: 60083737844
Effective search space used: 60083737844
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)

PSORT

psg: 0.32 gvh: 0.35 alm: 0.49 top: 0.53 tms: 0.00 mit: 0.27 mip: 0.02
nuc: 0.21 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

48.0 %: nuclear
36.0 %: cytoplasmic
12.0 %: mitochondrial
4.0 %: cytoskeletal

>> prediction for Contig-U15129-1 is nuc

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 2
FC-IC (SUB) 0